F444730

General Info

Members Datasets Scaffolds Average Seq Length
441 287 441 152

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0134641|Ga0495628_0134641_623_1162
Length 179
Sequence LHYPADIAIWISNPEVACLRQSIYEKEARVSNRIEKRIELDAPPSRVWRALTDHREFGEWFRVKLDGPFVPGQVTRGSVADPGYEHLKWEATVQKMEPERLFSFTWHPYAIDPNFDYRSEPPTLVEFRLEAKEGGTVLFLTESGFDAIPQGRRFEAFRMNERGWTEQMKNIERHVGRPG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
98 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
99 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
100 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
279 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
280 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
281 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 4.08
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10005084 3300002459 Bacteria 2678
2 JGI24751J29686_10014465 3300002459 Bacteria 1628
3 Ga0065707_10257162 3300005295 Unclassified 1108
4 Ga0070676_10009166 3300005328 Bacteria 5353
5 Ga0070683_100009510 3300005329 Bacteria 8319
6 Ga0070683_100030032 3300005329 Bacteria 4928
7 Ga0070670_100044700 3300005331 Bacteria 3807
8 Ga0070677_10004905 3300005333 Bacteria 4392
9 Ga0070666_10038869 3300005335 Bacteria 3168
10 Ga0070680_100063564 3300005336 Bacteria 3023
11 Ga0070682_100018425 3300005337 Unclassified 4081
12 Ga0068868_100040845 3300005338 Bacteria 3612
13 Ga0070660_100006201 3300005339 Bacteria 8274
14 Ga0070660_100019860 3300005339 Bacteria 4930
15 Ga0070689_100046796 3300005340 Bacteria 3334
16 Ga0070689_100060016 3300005340 Bacteria 2956
17 Ga0070661_100001498 3300005344 Bacteria 16232
18 Ga0070668_100010882 3300005347 Bacteria 6769
19 Ga0070668_100916639 3300005347 Bacteria 784
20 Ga0070668_101090624 3300005347 Unclassified 720
21 Ga0070675_100186470 3300005354 Bacteria 1795
22 Ga0070675_100587538 3300005354 Bacteria 1009
23 Ga0070671_100024164 3300005355 Bacteria 4973
24 Ga0070674_100145632 3300005356 Unclassified 1783
25 Ga0070673_100001087 3300005364 Bacteria 15553
26 Ga0070673_100248514 3300005364 Bacteria 1549
27 Ga0070688_100007808 3300005365 Bacteria 5781
28 Ga0070659_100002865 3300005366 Bacteria 12281
29 Ga0070659_100007686 3300005366 Bacteria 7843
30 Ga0070667_100072920 3300005367 Bacteria 2926
31 Ga0070713_100040155 3300005436 Bacteria 3803
32 Ga0070713_100060843 3300005436 Unclassified 3158
33 Ga0070713_100169028 3300005436 Bacteria 1957
34 Ga0070713_100332795 3300005436 Bacteria 1405
35 Ga0070713_100453578 3300005436 Bacteria 1205
36 Ga0070713_100556899 3300005436 Bacteria 1086
37 Ga0070713_101620079 3300005436 Bacteria 628
38 Ga0070713_101650956 3300005436 Bacteria 622
39 Ga0070710_10004818 3300005437 Bacteria 6382
40 Ga0070710_10082774 3300005437 Bacteria 1877
41 Ga0070710_10293952 3300005437 Unclassified 1058
42 Ga0070711_100003446 3300005439 Bacteria 9215
43 Ga0070711_100040604 3300005439 Bacteria 3138
44 Ga0070711_100284307 3300005439 Bacteria 1310
45 Ga0070700_100050107 3300005441 Bacteria 2595
46 Ga0070694_100293331 3300005444 Bacteria 1244
47 Ga0070708_100015673 3300005445 Bacteria 6264
48 Ga0070708_100016628 3300005445 Bacteria 6111
49 Ga0070663_100009736 3300005455 Bacteria 5966
50 Ga0070663_100049907 3300005455 Bacteria 2974
51 Ga0070662_100417385 3300005457 Unclassified 1109
52 Ga0068867_100751228 3300005459 Unclassified 865
53 Ga0070706_100143206 3300005467 Bacteria 2231
54 Ga0070706_101275022 3300005467 Bacteria 674
55 Ga0070707_100068411 3300005468 Bacteria 3418
56 Ga0070707_100338886 3300005468 Bacteria 1461
57 Ga0070707_100968455 3300005468 Bacteria 816
58 Ga0070698_100048074 3300005471 Bacteria 4359
59 Ga0070698_100512194 3300005471 Bacteria 1138
60 Ga0070699_100182210 3300005518 Unclassified 1864
61 Ga0070699_101178146 3300005518 Bacteria 703
62 Ga0070679_100027842 3300005530 Bacteria 5568
63 Ga0070679_100784427 3300005530 Bacteria 896
64 Ga0070684_100002226 3300005535 Bacteria 14292
65 Ga0070697_100001384 3300005536 Bacteria 18346
66 Ga0070697_100009949 3300005536 Bacteria 7419
67 Ga0070697_100063082 3300005536 Bacteria 3026
68 Ga0070697_100254926 3300005536 Bacteria 1501
69 Ga0070697_100263616 3300005536 Bacteria 1476
70 Ga0070697_100356344 3300005536 Bacteria 1264
71 Ga0068853_100015249 3300005539 Bacteria 6317
72 Ga0068853_100259953 3300005539 Bacteria 1596
73 Ga0070672_100095863 3300005543 Bacteria 2400
74 Ga0070696_100939849 3300005546 Unclassified 719
75 Ga0070665_100073264 3300005548 Bacteria 3431
76 Ga0070665_100413990 3300005548 Bacteria 1356
77 Ga0070704_100045073 3300005549 Bacteria 3067
78 Ga0070704_100199300 3300005549 Bacteria 1615
79 Ga0070664_100082092 3300005564 Bacteria 2779
80 Ga0070664_100219070 3300005564 Bacteria 1702
81 Ga0068857_100009135 3300005577 Bacteria 8601
82 Ga0068857_100069490 3300005577 Bacteria 3136
83 Ga0068854_100175959 3300005578 Bacteria 1668
84 Ga0068856_100067957 3300005614 Bacteria 3522
85 Ga0068864_100036188 3300005618 Bacteria 4206
86 Ga0068864_101077040 3300005618 Bacteria 799
87 Ga0068861_100446075 3300005719 Unclassified 1158
88 Ga0068870_10000755 3300005840 Bacteria 12440
89 Ga0068863_100044634 3300005841 Bacteria 4206
90 Ga0068858_100026991 3300005842 Bacteria 5334
91 Ga0068862_100064421 3300005844 Bacteria 3155
92 Ga0081455_10036738 3300005937 Bacteria 4357
93 Ga0081540_1003469 3300005983 Bacteria 12445
94 Ga0070717_10014993 3300006028 Bacteria 5971
95 Ga0070717_10031233 3300006028 Bacteria 4283
96 Ga0070717_10187352 3300006028 Bacteria 1806
97 Ga0070717_10609569 3300006028 Unclassified 990
98 Ga0070717_12019967 3300006028 Unclassified 519
99 Ga0070715_10133740 3300006163 Bacteria 1197
100 Ga0070712_100005454 3300006175 Bacteria 7879
101 Ga0070712_100017935 3300006175 Bacteria 4588
102 Ga0070712_100072116 3300006175 Bacteria 2473
103 Ga0070712_100359826 3300006175 Bacteria 1193
104 Ga0070712_101368037 3300006175 Bacteria 617
105 Ga0068871_100282919 3300006358 Bacteria 1451
106 Ga0075428_100224357 3300006844 Bacteria 2029
107 Ga0075428_100814256 3300006844 Bacteria 992
108 Ga0075430_100091596 3300006846 Unclassified 2542
109 Ga0075431_100077120 3300006847 Unclassified 3439
110 Ga0075431_100260686 3300006847 Bacteria 1759
111 Ga0075434_101011235 3300006871 Bacteria 845
112 Ga0075434_102118194 3300006871 Unclassified 567
113 Ga0075429_100092627 3300006880 Bacteria 2636
114 Ga0075436_100000321 3300006914 Bacteria 30575
115 Ga0075436_100668413 3300006914 Unclassified 768
116 Ga0099794_10225163 3300007265 Bacteria 964
117 Ga0099795_10030663 3300007788 Bacteria 1847
118 Ga0099795_10097459 3300007788 Bacteria 1149
119 Ga0105251_10238950 3300009011 Unclassified 818
120 Ga0105250_10024956 3300009092 Bacteria 2409
121 Ga0105240_10070392 3300009093 Bacteria 4327
122 Ga0105245_10034123 3300009098 Unclassified 4511
123 Ga0105247_10003532 3300009101 Bacteria 10163
124 Ga0105247_10481916 3300009101 Bacteria 900
125 Ga0114129_10117356 3300009147 Bacteria 3667
126 Ga0114129_10121514 3300009147 Unclassified 3594
127 Ga0105241_10006132 3300009174 Bacteria 8861
128 Ga0105241_10630258 3300009174 Bacteria 972
129 Ga0105242_10008370 3300009176 Bacteria 7947
130 Ga0105242_12160180 3300009176 Bacteria 601
131 Ga0105248_10195090 3300009177 Bacteria 2281
132 Ga0105248_10736007 3300009177 Bacteria 1113
133 Ga0105237_10014537 3300009545 Bacteria 8226
134 Ga0105238_10053880 3300009551 Bacteria 4042
135 Ga0105249_10019268 3300009553 Bacteria 6085
136 Ga0099796_10130796 3300010159 Bacteria 973
137 Ga0105239_10095401 3300010375 Unclassified 3286
138 Ga0105239_10270785 3300010375 Bacteria 1910
139 Ga0105246_10006758 3300011119 Bacteria 7014
140 Ga0105246_10434166 3300011119 Bacteria 1099
141 Ga0105246_10943746 3300011119 Bacteria 777
142 Ga0157373_10181883 3300013100 Unclassified 1480
143 Ga0157371_10547879 3300013102 Unclassified 857
144 Ga0157370_10027606 3300013104 Bacteria 5597
145 Ga0157370_10888772 3300013104 Unclassified 809
146 Ga0157369_10019003 3300013105 Bacteria 7695
147 Ga0157369_10023099 3300013105 Bacteria 6930
148 Ga0157369_10098030 3300013105 Bacteria 3127
149 Ga0157369_10385870 3300013105 Bacteria 1454
150 Ga0157374_10669765 3300013296 Bacteria 1050
151 Ga0163162_11181364 3300013306 Unclassified 868
152 Ga0157372_10044713 3300013307 Unclassified 4908
153 Ga0163163_10520975 3300014325 Bacteria 1251
154 Ga0163163_12295052 3300014325 Bacteria 598
155 Ga0163163_12295054 3300014325 Unclassified 598
156 Ga0157379_10131451 3300014968 Bacteria 2253
157 Ga0157379_10404800 3300014968 Bacteria 1255
158 Ga0157376_10033432 3300014969 Bacteria 4140
159 Ga0157376_12160791 3300014969 Unclassified 595
160 Ga0163161_10098096 3300017792 Bacteria 2177
161 Ga0213872_10002098 3300021361 Bacteria 12026
162 Ga0213872_10059704 3300021361 Bacteria 1725
163 Ga0213876_10014903 3300021384 Unclassified 4120
164 Ga0213875_10000033 3300021388 Bacteria 170944
165 Ga0213871_10012232 3300021441 Bacteria 1989
166 Ga0224569_100743 3300022732 Bacteria 2769
167 Ga0224571_100336 3300022734 Unclassified 2474
168 Ga0224572_1011182 3300024225 Bacteria 1697
169 Ga0228598_1001241 3300024227 Bacteria 5627
170 Ga0228598_1013386 3300024227 Bacteria 1624
171 Ga0207697_10022941 3300025315 Bacteria 2556
172 Ga0207656_10013992 3300025321 Bacteria 3080
173 Ga0207682_10003265 3300025893 Bacteria 7096
174 Ga0207692_10039509 3300025898 Unclassified 2322
175 Ga0207692_10069329 3300025898 Bacteria 1852
176 Ga0207692_10545451 3300025898 Bacteria 740
177 Ga0207642_10134641 3300025899 Unclassified 1294
178 Ga0207710_10065493 3300025900 Bacteria 1657
179 Ga0207688_10002862 3300025901 Bacteria 9376
180 Ga0207647_10008037 3300025904 Bacteria 7584
181 Ga0207699_10092593 3300025906 Bacteria 1900
182 Ga0207699_10171097 3300025906 Bacteria 1453
183 Ga0207645_10000892 3300025907 Bacteria 24746
184 Ga0207643_10000476 3300025908 Bacteria 25945
185 Ga0207705_10001124 3300025909 Bacteria 21762
186 Ga0207684_10003341 3300025910 Bacteria 15731
187 Ga0207684_10077844 3300025910 Bacteria 2820
188 Ga0207695_10491094 3300025913 Bacteria 1110
189 Ga0207671_10161045 3300025914 Bacteria 1738
190 Ga0207693_10000039 3300025915 Bacteria 108357
191 Ga0207693_10013298 3300025915 Bacteria 6639
192 Ga0207693_10033413 3300025915 Bacteria 4059
193 Ga0207693_10117615 3300025915 Bacteria 2087
194 Ga0207663_10012145 3300025916 Unclassified 4646
195 Ga0207663_10085447 3300025916 Bacteria 2077
196 Ga0207663_10185369 3300025916 Bacteria 1490
197 Ga0207663_10216457 3300025916 Bacteria 1391
198 Ga0207660_10327095 3300025917 Bacteria 1225
199 Ga0207662_10008767 3300025918 Bacteria 5547
200 Ga0207657_10002508 3300025919 Bacteria 19865
201 Ga0207657_10003733 3300025919 Bacteria 16182
202 Ga0207649_10001149 3300025920 Bacteria 15980
203 Ga0207652_10010031 3300025921 Bacteria 7628
204 Ga0207646_10061740 3300025922 Bacteria 3345
205 Ga0207646_10285282 3300025922 Bacteria 1492
206 Ga0207681_10419850 3300025923 Unclassified 1083
207 Ga0207650_10000072 3300025925 Bacteria 137765
208 Ga0207650_10000078 3300025925 Bacteria 130954
209 Ga0207650_10006965 3300025925 Bacteria 7708
210 Ga0207659_10050481 3300025926 Unclassified 2955
211 Ga0207659_10271213 3300025926 Bacteria 1384
212 Ga0207687_10038254 3300025927 Bacteria 3278
213 Ga0207687_10958481 3300025927 Bacteria 733
214 Ga0207700_10322430 3300025928 Bacteria 1339
215 Ga0207700_10580697 3300025928 Bacteria 997
216 Ga0207700_11795537 3300025928 Unclassified 539
217 Ga0207664_10046447 3300025929 Unclassified 3408
218 Ga0207644_10027302 3300025931 Bacteria 3943
219 Ga0207690_10049040 3300025932 Bacteria 2812
220 Ga0207690_11861343 3300025932 Bacteria 502
221 Ga0207706_10011756 3300025933 Bacteria 7973
222 Ga0207686_11668847 3300025934 Bacteria 527
223 Ga0207670_10026176 3300025936 Bacteria 3673
224 Ga0207670_10030833 3300025936 Bacteria 3428
225 Ga0207669_10865814 3300025937 Unclassified 753
226 Ga0207704_10598809 3300025938 Unclassified 902
227 Ga0207665_10251126 3300025939 Bacteria 1307
228 Ga0207691_10002536 3300025940 Bacteria 17845
229 Ga0207691_10014478 3300025940 Bacteria 7521
230 Ga0207711_10293395 3300025941 Unclassified 1499
231 Ga0207689_10001721 3300025942 Bacteria 20713
232 Ga0207661_10001517 3300025944 Bacteria 15755
233 Ga0207661_10482105 3300025944 Bacteria 1132
234 Ga0207679_10001269 3300025945 Bacteria 15990
235 Ga0207667_10081714 3300025949 Bacteria 3347
236 Ga0207651_10046487 3300025960 Bacteria 2919
237 Ga0207651_10090765 3300025960 Bacteria 2234
238 Ga0207712_10349453 3300025961 Bacteria 1229
239 Ga0207668_10760113 3300025972 Unclassified 856
240 Ga0207668_10980676 3300025972 Bacteria 755
241 Ga0207640_10323261 3300025981 Bacteria 1229
242 Ga0207658_10022736 3300025986 Bacteria 4367
243 Ga0207677_10025406 3300026023 Unclassified 3695
244 Ga0207703_10491149 3300026035 Unclassified 1151
245 Ga0207703_11711796 3300026035 Bacteria 605
246 Ga0207639_10030286 3300026041 Unclassified 3968
247 Ga0207639_10193836 3300026041 Bacteria 1737
248 Ga0207678_10005634 3300026067 Bacteria 11194
249 Ga0207678_10007353 3300026067 Bacteria 9752
250 Ga0207678_11226727 3300026067 Unclassified 664
251 Ga0207641_10000237 3300026088 Bacteria 71168
252 Ga0207641_10058198 3300026088 Bacteria 3289
253 Ga0207648_10002084 3300026089 Bacteria 21777
254 Ga0207676_10000050 3300026095 Bacteria 133298
255 Ga0207674_10000130 3300026116 Bacteria 88123
256 Ga0207674_10000408 3300026116 Bacteria 55815
257 Ga0207675_100020881 3300026118 Bacteria 6106
258 Ga0207683_10009014 3300026121 Bacteria 8500
259 Ga0207683_10491340 3300026121 Bacteria 1133
260 Ga0207698_10123528 3300026142 Bacteria 2196
261 Ga0209179_1000496 3300027512 Bacteria 4034
262 Ga0209588_1025866 3300027671 Bacteria 1860
263 Ga0268266_10033326 3300028379 Bacteria 4378
264 Ga0268266_10033937 3300028379 Bacteria 4337
265 Ga0268266_10405568 3300028379 Bacteria 1290
266 Ga0268264_10680701 3300028381 Bacteria 1020
267 Ga0265337_1000179 3300028556 Bacteria 33387
268 Ga0265338_10000339 3300028800 Bacteria 85119
269 Ga0265338_10448982 3300028800 Unclassified 913
270 Ga0265324_10001995 3300029957 Bacteria 10897
271 Ga0265320_10097711 3300031240 Bacteria 1354
272 Ga0265340_10002081 3300031247 Bacteria 11461
273 Ga0307408_100852196 3300031548 Bacteria 831
274 Ga0265313_10000165 3300031595 Bacteria 69129
275 Ga0265342_10003307 3300031712 Bacteria 13314
276 Ga0307416_103454715 3300032002 Unclassified 529
277 Ga0373923_0058194 3300035111 Bacteria 1636
278 Ga0373943_0084626 3300035170 Bacteria 1632
279 Ga0373946_0464362 3300035171 Bacteria 646
280 Ga0373955_0253693 3300035172 Bacteria 1055
281 Ga0373935_0221866 3300035692 Bacteria 1313
282 Ga0373935_0297575 3300035692 Bacteria 1140
283 Ga0373935_0358888 3300035692 Unclassified 1040
284 Ga0373933_0122986 3300035724 Bacteria 1626
285 Ga0373947_0033938 3300035725 Bacteria 3017
286 Ga0373937_1132750 3300036401 Bacteria 731
287 Ga0373925_0097263 3300037068 Bacteria 2258
288 Ga0373925_0113349 3300037068 Bacteria 2097
289 Ga0373925_0179341 3300037068 Unclassified 1676
290 Ga0395905_1046863 3300037471 Bacteria 719
291 Ga0436364_0046630 3300037853 Unclassified 1604
292 Ga0436364_0540318 3300037853 Bacteria 6168
293 Ga0436364_1365438 3300037853 Unclassified 3543
294 Ga0436364_1406452 3300037853 Bacteria 10842
295 Ga0436364_1416149 3300037853 Bacteria 1070
296 Ga0395901_0219380 3300038443 Bacteria 1988
297 Ga0436365_1863579 3300039437 Bacteria 54364
298 Ga0436360_1058374 3300039438 Bacteria 2776
299 Ga0436360_1116302 3300039438 Bacteria 1607
300 Ga0436360_1199898 3300039438 Bacteria 5031
301 Ga0436361_0262657 3300039447 Bacteria 1812
302 Ga0436361_0374779 3300039447 Bacteria 5657
303 Ga0436361_0610116 3300039447 Bacteria 176709
304 Ga0436361_0870398 3300039447 Unclassified 642
305 Ga0436361_0999445 3300039447 Bacteria 5586
306 Ga0436363_0268987 3300039450 Unclassified 584
307 Ga0436363_1436362 3300039450 Bacteria 10958
308 Ga0436362_0156652 3300039453 Bacteria 2436
309 Ga0439460_0028478 3300042461 Bacteria 1576
310 Ga0466964_0238671 3300044706 Bacteria 891
311 Ga0453684_0191495 3300044712 Bacteria 2392
312 Ga0453684_1409067 3300044712 Bacteria 722
313 Ga0466967_0319766 3300045976 Bacteria 1496
314 Ga0466967_0361433 3300045976 Unclassified 1407
315 Ga0495638_0000027 3300046460 Bacteria 337569
316 Ga0495638_0061181 3300046460 Bacteria 2327
317 Ga0495653_0325051 3300046463 Bacteria 996
318 Ga0495650_0002685 3300046471 Bacteria 13820
319 Ga0495580_0056158 3300046472 Bacteria 2773
320 Ga0495580_0088262 3300046472 Bacteria 2160
321 Ga0495605_0002378 3300046474 Bacteria 11676
322 Ga0495605_0054246 3300046474 Bacteria 1942
323 Ga0495639_0081276 3300046475 Bacteria 1510
324 Ga0495664_0253735 3300046477 Bacteria 1064
325 Ga0495585_0004923 3300046492 Bacteria 8541
326 Ga0495585_0012917 3300046492 Bacteria 4908
327 Ga0495607_0089425 3300046501 Bacteria 1672
328 Ga0495607_0123316 3300046501 Bacteria 1357
329 Ga0495583_0000006 3300046506 Bacteria 436893
330 Ga0495583_0000396 3300046506 Bacteria 66329
331 Ga0495583_0009228 3300046506 Bacteria 5916
332 Ga0495606_0008861 3300046507 Bacteria 8623
333 Ga0495608_0302633 3300046511 Bacteria 990
334 Ga0495610_0011813 3300046512 Bacteria 5307
335 Ga0495616_0013399 3300046513 Bacteria 4625
336 Ga0495616_0137242 3300046513 Bacteria 1116
337 Ga0495618_0305023 3300046514 Bacteria 989
338 Ga0495628_0134641 3300046516 Bacteria 1889
339 Ga0495630_0075744 3300046517 Bacteria 2535
340 Ga0495643_0000117 3300046522 Bacteria 129698
341 Ga0495643_0106577 3300046522 Bacteria 1430
342 Ga0495644_0000647 3300046523 Bacteria 14574
343 Ga0495648_0000078 3300046524 Bacteria 127397
344 Ga0495648_0001243 3300046524 Bacteria 25500
345 Ga0495642_0001450 3300046528 Bacteria 10625
346 Ga0495642_0157862 3300046528 Bacteria 983
347 Ga0495652_0192072 3300046529 Bacteria 1557
348 Ga0495654_0125879 3300046530 Bacteria 1155
349 Ga0495640_0073852 3300046533 Bacteria 2282
350 Ga0495609_0002623 3300046538 Bacteria 10918
351 Ga0495609_0026791 3300046538 Bacteria 2637
352 Ga0495597_0002247 3300046542 Bacteria 12589
353 Ga0495622_0000281 3300046557 Bacteria 38709
354 Ga0495633_0000375 3300046558 Bacteria 47710
355 Ga0495656_0025318 3300046615 Bacteria 2351
356 Ga0495668_0009894 3300046616 Bacteria 5815
357 Ga0495668_0113904 3300046616 Bacteria 1479
358 Ga0495634_0093720 3300046642 Bacteria 1947
359 Ga0495634_0259016 3300046642 Bacteria 1062
360 Ga0495611_0007573 3300046648 Bacteria 4606
361 Ga0495625_0000516 3300046660 Bacteria 56935
362 Ga0495625_0004833 3300046660 Bacteria 12583
363 Ga0495625_0052593 3300046660 Bacteria 2915
364 Ga0495659_0001042 3300046664 Bacteria 9682
365 Ga0495661_0015837 3300046665 Bacteria 5020
366 Ga0495661_0500893 3300046665 Bacteria 579
367 Ga0495613_0043935 3300046689 Bacteria 3307
368 Ga0495624_0173368 3300046690 Bacteria 1316
369 Ga0495624_0293465 3300046690 Bacteria 981
370 Ga0495670_0002747 3300046691 Bacteria 8698
371 Ga0495670_0024908 3300046691 Bacteria 2958
372 Ga0495649_0175412 3300046694 Bacteria 1120
373 Ga0495600_0617384 3300046809 Bacteria 658
374 Ga0495660_0028483 3300046810 Bacteria 3156
375 Ga0495636_0007579 3300047318 Bacteria 4272
376 Ga0495636_0011888 3300047318 Bacteria 3448
377 Ga0495674_0110274 3300047319 Bacteria 2334
378 Ga0495674_0412734 3300047319 Bacteria 1089
379 Ga0495672_0020129 3300047320 Bacteria 4381
380 Ga0495683_0138362 3300047323 Bacteria 1143
381 Ga0495687_000587 3300047443 Bacteria 42438
382 Ga0495677_0036945 3300047445 Bacteria 1784
383 Ga0495677_0055329 3300047445 Bacteria 1464
384 Ga0495685_000078 3300047447 Bacteria 37109
385 Ga0495684_0547817 3300047471 Bacteria 788
386 Ga0496101_0253784 3300048904 Bacteria 1371
387 Ga0496102_0017201 3300048905 Bacteria 6331
388 Ga0496103_0165106 3300048906 Bacteria 1421
389 Ga0496104_0120564 3300048907 Bacteria 2518
390 Ga0496104_0872054 3300048907 Bacteria 805
391 Ga0496107_0170109 3300048910 Bacteria 1617
392 Ga0496108_0000106 3300048911 Bacteria 87028
393 Ga0496109_0000133 3300048912 Bacteria 76299
394 Ga0496109_0492491 3300048912 Bacteria 1157
395 Ga0496110_0013287 3300048913 Bacteria 6801
396 Ga0496111_0017707 3300048914 Bacteria 4927
397 Ga0496112_0000028 3300048915 Bacteria 130942
398 Ga0496112_0015337 3300048915 Bacteria 7146
399 Ga0496112_0517896 3300048915 Bacteria 1127
400 Ga0496112_1079627 3300048915 Bacteria 721
401 Ga0496113_0000995 3300048916 Bacteria 15184
402 Ga0496113_0557678 3300048916 Bacteria 919
403 Ga0496115_0231379 3300048918 Unclassified 1524
404 Ga0495678_010336 3300049459 Bacteria 4544
405 Ga0495678_030279 3300049459 Bacteria 2265
406 Ga0495682_0000618 3300049460 Bacteria 23926
407 Ga0501034_0009998 3300049571 Bacteria 9911
408 Ga0501040_0621062 3300049576 Bacteria 781
409 Ga0501042_0738121 3300049578 Unclassified 716
410 Ga0501043_0450665 3300049579 Bacteria 967
411 Ga0501043_0600115 3300049579 Bacteria 813
412 Ga0501076_1741263 3300049592 Bacteria 511
413 Ga0501079_0569624 3300049741 Bacteria 891
414 Ga0501080_0697057 3300049742 Bacteria 896
415 Ga0501081_0847376 3300049743 Unclassified 688
416 Ga0501035_0667677 3300049822 Unclassified 841
417 Ga0501044_0001789 3300049823 Bacteria 25105
418 Ga0501044_0038067 3300049823 Bacteria 5023
419 nmdc:mga0yw44_1147799_c1 3300050492 Bacteria 524
420 nmdc:mga0k408_590299_c1 3300050493 Bacteria 655
421 nmdc:mga05p37_196485_c1 3300050507 Unclassified 2446
422 nmdc:mga0qj67_158445_c1 3300050509 Bacteria 1838
423 nmdc:mga06r32_580211_c1 3300050510 Unclassified 1093
424 nmdc:mga0n895_1577688_c1 3300050512 Unclassified 621
425 nmdc:mga0n895_871195_c1 3300050512 Bacteria 887
426 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
427 Ga0495601_0019536 3300053077 Bacteria 4133
428 Ga0495601_0165505 3300053077 Bacteria 1445
429 Ga0500610_0004362 3300053079 Bacteria 5604
430 Ga0495595_0051669 3300053084 Bacteria 1905
431 Ga0495619_0150534 3300053085 Bacteria 1605
432 Ga0500646_0152729 3300053090 Bacteria 765
433 Ga0500557_002820 3300053105 Bacteria 3296
434 Ga0500569_001301 3300053109 Bacteria 4666
435 Ga0500594_0001591 3300053118 Bacteria 4947
436 Ga0500568_0001773 3300053139 Bacteria 13311
437 Ga0500577_0103478 3300053142 Bacteria 1167
438 Ga0500616_0006243 3300053153 Bacteria 7856
439 Ga0500645_012720 3300053730 Bacteria 2716
440 Ga0501082_0106472 3300060353 Bacteria 2426
441 Ga0530510_0112621 3300061734 Bacteria 1994

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0231379 Ga0496115_0231379_516_983 144
2 3300005445 Ga0070708_100015673 Ga0070708_1000156733 146
3 3300007265 Ga0099794_10225163 Ga0099794_102251632 146
4 3300027671 Ga0209588_1025866 Ga0209588_10258662 146
5 3300006844 Ga0075428_100224357 Ga0075428_1002243572 147
6 3300006847 Ga0075431_100260686 Ga0075431_1002606863 147
7 3300021361 Ga0213872_10002098 Ga0213872_100020987 147
8 3300039447 Ga0436361_0610116 Ga0436361_0610116_138197_138643 147
9 3300044712 Ga0453684_0191495 Ga0453684_0191495_683_1168 147
10 3300044712 Ga0453684_1409067 Ga0453684_1409067_206_652 147
11 3300046474 Ga0495605_0002378 Ga0495605_0002378_4490_4990 147
12 3300046492 Ga0495585_0012917 Ga0495585_0012917_522_1022 147
13 3300046501 Ga0495607_0089425 Ga0495607_0089425_52_552 147
14 3300046506 Ga0495583_0009228 Ga0495583_0009228_1201_1701 147
15 3300046513 Ga0495616_0013399 Ga0495616_0013399_179_679 147
16 3300046522 Ga0495643_0106577 Ga0495643_0106577_258_758 147
17 3300046530 Ga0495654_0125879 Ga0495654_0125879_47_547 147
18 3300046616 Ga0495668_0009894 Ga0495668_0009894_4317_4817 147
19 3300046660 Ga0495625_0004833 Ga0495625_0004833_4200_4700 147
20 3300046691 Ga0495670_0024908 Ga0495670_0024908_2364_2864 147
21 3300047318 Ga0495636_0011888 Ga0495636_0011888_2157_2657 147
22 3300047320 Ga0495672_0020129 Ga0495672_0020129_3326_3826 147
23 3300047323 Ga0495683_0138362 Ga0495683_0138362_379_879 147
24 3300049579 Ga0501043_0450665 Ga0501043_0450665_332_778 147
25 3300050510 nmdc:mga06r32_580211_c1 nmdc:mga06r32_580211_c1_140_583 147
26 3300053079 Ga0500610_0004362 Ga0500610_0004362_2180_2680 147
27 3300053090 Ga0500646_0152729 Ga0500646_0152729_105_548 147
28 3300053105 Ga0500557_002820 Ga0500557_002820_2131_2631 147
29 3300053109 Ga0500569_001301 Ga0500569_001301_318_818 147
30 3300053118 Ga0500594_0001591 Ga0500594_0001591_3630_4130 147
31 3300053139 Ga0500568_0001773 Ga0500568_0001773_4375_4875 147
32 3300053142 Ga0500577_0103478 Ga0500577_0103478_376_876 147
33 3300053153 Ga0500616_0006243 Ga0500616_0006243_2664_3164 147
34 3300053730 Ga0500645_012720 Ga0500645_012720_760_1260 147
35 3300005347 Ga0070668_100916639 Ga0070668_1009166392 148
36 3300005548 Ga0070665_100413990 Ga0070665_1004139903 148
37 3300006175 Ga0070712_100359826 Ga0070712_1003598263 148
38 3300006175 Ga0070712_101368037 Ga0070712_1013680371 148
39 3300011119 Ga0105246_10434166 Ga0105246_104341662 148
40 3300013105 Ga0157369_10385870 Ga0157369_103858702 148
41 3300025972 Ga0207668_10980676 Ga0207668_109806762 148
42 3300026121 Ga0207683_10491340 Ga0207683_104913402 148
43 3300028379 Ga0268266_10405568 Ga0268266_104055682 148
44 3300039450 Ga0436363_1436362 Ga0436363_1436362_6955_7401 148
45 3300045976 Ga0466967_0319766 Ga0466967_0319766_342_791 148
46 3300046460 Ga0495638_0000027 Ga0495638_0000027_298695_299141 148
47 3300046471 Ga0495650_0002685 Ga0495650_0002685_2743_3189 148
48 3300046475 Ga0495639_0081276 Ga0495639_0081276_91_537 148
49 3300046506 Ga0495583_0000006 Ga0495583_0000006_252354_252800 148
50 3300046512 Ga0495610_0011813 Ga0495610_0011813_4776_5246 148
51 3300046522 Ga0495643_0000117 Ga0495643_0000117_126362_126808 148
52 3300046524 Ga0495648_0000078 Ga0495648_0000078_29999_30445 148
53 3300046528 Ga0495642_0001450 Ga0495642_0001450_6819_7265 148
54 3300046538 Ga0495609_0026791 Ga0495609_0026791_2111_2557 148
55 3300046542 Ga0495597_0002247 Ga0495597_0002247_3575_4021 148
56 3300046557 Ga0495622_0000281 Ga0495622_0000281_34579_35025 148
57 3300046558 Ga0495633_0000375 Ga0495633_0000375_1646_2092 148
58 3300046660 Ga0495625_0000516 Ga0495625_0000516_2888_3334 148
59 3300046665 Ga0495661_0500893 Ga0495661_0500893_72_518 148
60 3300046694 Ga0495649_0175412 Ga0495649_0175412_365_811 148
61 3300046810 Ga0495660_0028483 Ga0495660_0028483_1786_2232 148
62 3300047445 Ga0495677_0036945 Ga0495677_0036945_184_630 148
63 3300049459 Ga0495678_030279 Ga0495678_030279_543_989 148
64 3300050492 nmdc:mga0yw44_1147799_c1 nmdc:mga0yw44_1147799_c1_54_500 148
65 3300050493 nmdc:mga0k408_590299_c1 nmdc:mga0k408_590299_c1_54_500 148
66 3300005444 Ga0070694_100293331 Ga0070694_1002933312 149
67 3300005468 Ga0070707_100068411 Ga0070707_1000684113 149
68 3300005471 Ga0070698_100512194 Ga0070698_1005121942 149
69 3300005549 Ga0070704_100199300 Ga0070704_1001993003 149
70 3300005983 Ga0081540_1003469 Ga0081540_10034698 149
71 3300013296 Ga0157374_10669765 Ga0157374_106697652 149
72 3300025922 Ga0207646_10061740 Ga0207646_100617404 149
73 3300025927 Ga0207687_10958481 Ga0207687_109584812 149
74 3300026067 Ga0207678_11226727 Ga0207678_112267272 149
75 3300032002 Ga0307416_103454715 Ga0307416_1034547151 149
76 3300002459 JGI24751J29686_10005084 JGI24751J29686_100050846 150
77 3300002459 JGI24751J29686_10014465 JGI24751J29686_100144652 150
78 3300005295 Ga0065707_10257162 Ga0065707_102571621 150
79 3300005328 Ga0070676_10009166 Ga0070676_100091662 150
80 3300005329 Ga0070683_100009510 Ga0070683_1000095106 150
81 3300005329 Ga0070683_100030032 Ga0070683_1000300324 150
82 3300005331 Ga0070670_100044700 Ga0070670_1000447004 150
83 3300005333 Ga0070677_10004905 Ga0070677_100049053 150
84 3300005335 Ga0070666_10038869 Ga0070666_100388694 150
85 3300005336 Ga0070680_100063564 Ga0070680_1000635641 150
86 3300005337 Ga0070682_100018425 Ga0070682_1000184252 150
87 3300005338 Ga0068868_100040845 Ga0068868_1000408456 150
88 3300005339 Ga0070660_100006201 Ga0070660_1000062017 150
89 3300005339 Ga0070660_100019860 Ga0070660_1000198602 150
90 3300005340 Ga0070689_100046796 Ga0070689_1000467966 150
91 3300005340 Ga0070689_100060016 Ga0070689_1000600166 150
92 3300005344 Ga0070661_100001498 Ga0070661_10000149811 150
93 3300005347 Ga0070668_100010882 Ga0070668_1000108826 150
94 3300005347 Ga0070668_101090624 Ga0070668_1010906241 150
95 3300005354 Ga0070675_100186470 Ga0070675_1001864702 150
96 3300005354 Ga0070675_100587538 Ga0070675_1005875381 150
97 3300005355 Ga0070671_100024164 Ga0070671_1000241646 150
98 3300005356 Ga0070674_100145632 Ga0070674_1001456322 150
99 3300005364 Ga0070673_100001087 Ga0070673_10000108714 150
100 3300005364 Ga0070673_100248514 Ga0070673_1002485141 150
101 3300005365 Ga0070688_100007808 Ga0070688_1000078087 150
102 3300005366 Ga0070659_100002865 Ga0070659_10000286512 150
103 3300005366 Ga0070659_100007686 Ga0070659_1000076866 150
104 3300005367 Ga0070667_100072920 Ga0070667_1000729201 150
105 3300005436 Ga0070713_100040155 Ga0070713_1000401556 150
106 3300005436 Ga0070713_100060843 Ga0070713_1000608431 150
107 3300005436 Ga0070713_100169028 Ga0070713_1001690282 150
108 3300005436 Ga0070713_100332795 Ga0070713_1003327953 150
109 3300005436 Ga0070713_100453578 Ga0070713_1004535782 150
110 3300005436 Ga0070713_100556899 Ga0070713_1005568991 150
111 3300005436 Ga0070713_101620079 Ga0070713_1016200791 150
112 3300005436 Ga0070713_101650956 Ga0070713_1016509561 150
113 3300005437 Ga0070710_10004818 Ga0070710_100048186 150
114 3300005437 Ga0070710_10082774 Ga0070710_100827743 150
115 3300005437 Ga0070710_10293952 Ga0070710_102939521 150
116 3300005439 Ga0070711_100003446 Ga0070711_1000034462 150
117 3300005439 Ga0070711_100040604 Ga0070711_1000406042 150
118 3300005439 Ga0070711_100284307 Ga0070711_1002843072 150
119 3300005441 Ga0070700_100050107 Ga0070700_1000501076 150
120 3300005445 Ga0070708_100016628 Ga0070708_1000166286 150
121 3300005455 Ga0070663_100009736 Ga0070663_1000097367 150
122 3300005455 Ga0070663_100049907 Ga0070663_1000499073 150
123 3300005457 Ga0070662_100417385 Ga0070662_1004173852 150
124 3300005459 Ga0068867_100751228 Ga0068867_1007512282 150
125 3300005467 Ga0070706_100143206 Ga0070706_1001432064 150
126 3300005467 Ga0070706_101275022 Ga0070706_1012750221 150
127 3300005468 Ga0070707_100338886 Ga0070707_1003388862 150
128 3300005468 Ga0070707_100968455 Ga0070707_1009684551 150
129 3300005471 Ga0070698_100048074 Ga0070698_1000480749 150
130 3300005518 Ga0070699_100182210 Ga0070699_1001822104 150
131 3300005518 Ga0070699_101178146 Ga0070699_1011781461 150
132 3300005530 Ga0070679_100027842 Ga0070679_1000278423 150
133 3300005530 Ga0070679_100784427 Ga0070679_1007844271 150
134 3300005535 Ga0070684_100002226 Ga0070684_10000222610 150
135 3300005536 Ga0070697_100001384 Ga0070697_10000138417 150
136 3300005536 Ga0070697_100009949 Ga0070697_1000099494 150
137 3300005536 Ga0070697_100063082 Ga0070697_1000630822 150
138 3300005536 Ga0070697_100254926 Ga0070697_1002549263 150
139 3300005536 Ga0070697_100263616 Ga0070697_1002636162 150
140 3300005536 Ga0070697_100356344 Ga0070697_1003563442 150
141 3300005539 Ga0068853_100015249 Ga0068853_1000152495 150
142 3300005539 Ga0068853_100259953 Ga0068853_1002599532 150
143 3300005543 Ga0070672_100095863 Ga0070672_1000958634 150
144 3300005546 Ga0070696_100939849 Ga0070696_1009398492 150
145 3300005548 Ga0070665_100073264 Ga0070665_1000732645 150
146 3300005549 Ga0070704_100045073 Ga0070704_1000450731 150
147 3300005564 Ga0070664_100082092 Ga0070664_1000820923 150
148 3300005564 Ga0070664_100219070 Ga0070664_1002190702 150
149 3300005577 Ga0068857_100009135 Ga0068857_1000091356 150
150 3300005577 Ga0068857_100069490 Ga0068857_1000694903 150
151 3300005578 Ga0068854_100175959 Ga0068854_1001759592 150
152 3300005614 Ga0068856_100067957 Ga0068856_1000679571 150
153 3300005618 Ga0068864_100036188 Ga0068864_1000361882 150
154 3300005618 Ga0068864_101077040 Ga0068864_1010770402 150
155 3300005719 Ga0068861_100446075 Ga0068861_1004460752 150
156 3300005840 Ga0068870_10000755 Ga0068870_100007554 150
157 3300005841 Ga0068863_100044634 Ga0068863_1000446342 150
158 3300005842 Ga0068858_100026991 Ga0068858_1000269911 150
159 3300005844 Ga0068862_100064421 Ga0068862_1000644216 150
160 3300005937 Ga0081455_10036738 Ga0081455_100367385 150
161 3300006028 Ga0070717_10014993 Ga0070717_100149938 150
162 3300006028 Ga0070717_10031233 Ga0070717_100312332 150
163 3300006028 Ga0070717_10187352 Ga0070717_101873521 150
164 3300006028 Ga0070717_10609569 Ga0070717_106095692 150
165 3300006028 Ga0070717_12019967 Ga0070717_120199671 150
166 3300006163 Ga0070715_10133740 Ga0070715_101337401 150
167 3300006175 Ga0070712_100005454 Ga0070712_1000054548 150
168 3300006175 Ga0070712_100017935 Ga0070712_1000179356 150
169 3300006175 Ga0070712_100072116 Ga0070712_1000721165 150
170 3300006358 Ga0068871_100282919 Ga0068871_1002829191 150
171 3300006844 Ga0075428_100814256 Ga0075428_1008142562 150
172 3300006846 Ga0075430_100091596 Ga0075430_1000915962 150
173 3300006847 Ga0075431_100077120 Ga0075431_1000771205 150
174 3300006871 Ga0075434_101011235 Ga0075434_1010112352 150
175 3300006871 Ga0075434_102118194 Ga0075434_1021181941 150
176 3300006880 Ga0075429_100092627 Ga0075429_1000926273 150
177 3300006914 Ga0075436_100000321 Ga0075436_1000003215 150
178 3300006914 Ga0075436_100668413 Ga0075436_1006684131 150
179 3300007788 Ga0099795_10030663 Ga0099795_100306633 150
180 3300007788 Ga0099795_10097459 Ga0099795_100974592 150
181 3300009011 Ga0105251_10238950 Ga0105251_102389502 150
182 3300009092 Ga0105250_10024956 Ga0105250_100249562 150
183 3300009093 Ga0105240_10070392 Ga0105240_100703925 150
184 3300009098 Ga0105245_10034123 Ga0105245_100341232 150
185 3300009101 Ga0105247_10003532 Ga0105247_100035325 150
186 3300009101 Ga0105247_10481916 Ga0105247_104819162 150
187 3300009147 Ga0114129_10117356 Ga0114129_101173562 150
188 3300009147 Ga0114129_10121514 Ga0114129_101215142 150
189 3300009174 Ga0105241_10006132 Ga0105241_100061325 150
190 3300009174 Ga0105241_10630258 Ga0105241_106302582 150
191 3300009176 Ga0105242_10008370 Ga0105242_100083708 150
192 3300009176 Ga0105242_12160180 Ga0105242_121601801 150
193 3300009177 Ga0105248_10195090 Ga0105248_101950903 150
194 3300009177 Ga0105248_10736007 Ga0105248_107360072 150
195 3300009545 Ga0105237_10014537 Ga0105237_100145378 150
196 3300009551 Ga0105238_10053880 Ga0105238_100538803 150
197 3300009553 Ga0105249_10019268 Ga0105249_100192684 150
198 3300010159 Ga0099796_10130796 Ga0099796_101307962 150
199 3300010375 Ga0105239_10095401 Ga0105239_100954012 150
200 3300010375 Ga0105239_10270785 Ga0105239_102707853 150
201 3300011119 Ga0105246_10006758 Ga0105246_100067587 150
202 3300011119 Ga0105246_10943746 Ga0105246_109437461 150
203 3300013100 Ga0157373_10181883 Ga0157373_101818832 150
204 3300013102 Ga0157371_10547879 Ga0157371_105478792 150
205 3300013104 Ga0157370_10027606 Ga0157370_100276066 150
206 3300013104 Ga0157370_10888772 Ga0157370_108887722 150
207 3300013105 Ga0157369_10019003 Ga0157369_100190037 150
208 3300013105 Ga0157369_10023099 Ga0157369_100230995 150
209 3300013105 Ga0157369_10098030 Ga0157369_100980303 150
210 3300013306 Ga0163162_11181364 Ga0163162_111813642 150
211 3300013307 Ga0157372_10044713 Ga0157372_100447134 150
212 3300014325 Ga0163163_10520975 Ga0163163_105209752 150
213 3300014325 Ga0163163_12295052 Ga0163163_122950521 150
214 3300014325 Ga0163163_12295054 Ga0163163_122950541 150
215 3300014968 Ga0157379_10131451 Ga0157379_101314515 150
216 3300014968 Ga0157379_10404800 Ga0157379_104048001 150
217 3300014969 Ga0157376_10033432 Ga0157376_100334324 150
218 3300014969 Ga0157376_12160791 Ga0157376_121607911 150
219 3300017792 Ga0163161_10098096 Ga0163161_100980961 150
220 3300021361 Ga0213872_10059704 Ga0213872_100597043 150
221 3300021384 Ga0213876_10014903 Ga0213876_100149032 150
222 3300021388 Ga0213875_10000033 Ga0213875_1000003390 150
223 3300021441 Ga0213871_10012232 Ga0213871_100122321 150
224 3300022732 Ga0224569_100743 Ga0224569_1007431 150
225 3300022734 Ga0224571_100336 Ga0224571_1003363 150
226 3300024225 Ga0224572_1011182 Ga0224572_10111822 150
227 3300024227 Ga0228598_1001241 Ga0228598_10012413 150
228 3300024227 Ga0228598_1013386 Ga0228598_10133863 150
229 3300025315 Ga0207697_10022941 Ga0207697_100229412 150
230 3300025321 Ga0207656_10013992 Ga0207656_100139922 150
231 3300025893 Ga0207682_10003265 Ga0207682_100032655 150
232 3300025898 Ga0207692_10039509 Ga0207692_100395093 150
233 3300025898 Ga0207692_10069329 Ga0207692_100693292 150
234 3300025898 Ga0207692_10545451 Ga0207692_105454511 150
235 3300025899 Ga0207642_10134641 Ga0207642_101346412 150
236 3300025900 Ga0207710_10065493 Ga0207710_100654931 150
237 3300025901 Ga0207688_10002862 Ga0207688_100028628 150
238 3300025904 Ga0207647_10008037 Ga0207647_100080374 150
239 3300025906 Ga0207699_10092593 Ga0207699_100925932 150
240 3300025906 Ga0207699_10171097 Ga0207699_101710971 150
241 3300025907 Ga0207645_10000892 Ga0207645_1000089212 150
242 3300025908 Ga0207643_10000476 Ga0207643_1000047612 150
243 3300025909 Ga0207705_10001124 Ga0207705_1000112413 150
244 3300025910 Ga0207684_10003341 Ga0207684_1000334115 150
245 3300025910 Ga0207684_10077844 Ga0207684_100778441 150
246 3300025913 Ga0207695_10491094 Ga0207695_104910942 150
247 3300025914 Ga0207671_10161045 Ga0207671_101610452 150
248 3300025915 Ga0207693_10000039 Ga0207693_1000003944 150
249 3300025915 Ga0207693_10013298 Ga0207693_100132986 150
250 3300025915 Ga0207693_10033413 Ga0207693_100334133 150
251 3300025915 Ga0207693_10117615 Ga0207693_101176151 150
252 3300025916 Ga0207663_10012145 Ga0207663_100121454 150
253 3300025916 Ga0207663_10085447 Ga0207663_100854472 150
254 3300025916 Ga0207663_10185369 Ga0207663_101853694 150
255 3300025916 Ga0207663_10216457 Ga0207663_102164571 150
256 3300025917 Ga0207660_10327095 Ga0207660_103270953 150
257 3300025918 Ga0207662_10008767 Ga0207662_100087672 150
258 3300025919 Ga0207657_10002508 Ga0207657_1000250810 150
259 3300025919 Ga0207657_10003733 Ga0207657_100037337 150
260 3300025920 Ga0207649_10001149 Ga0207649_100011499 150
261 3300025921 Ga0207652_10010031 Ga0207652_100100313 150
262 3300025922 Ga0207646_10285282 Ga0207646_102852821 150
263 3300025923 Ga0207681_10419850 Ga0207681_104198502 150
264 3300025925 Ga0207650_10000072 Ga0207650_10000072103 150
265 3300025925 Ga0207650_10000078 Ga0207650_1000007815 150
266 3300025925 Ga0207650_10006965 Ga0207650_100069659 150
267 3300025926 Ga0207659_10050481 Ga0207659_100504812 150
268 3300025926 Ga0207659_10271213 Ga0207659_102712132 150
269 3300025927 Ga0207687_10038254 Ga0207687_100382543 150
270 3300025928 Ga0207700_10322430 Ga0207700_103224302 150
271 3300025928 Ga0207700_10580697 Ga0207700_105806971 150
272 3300025928 Ga0207700_11795537 Ga0207700_117955371 150
273 3300025929 Ga0207664_10046447 Ga0207664_100464475 150
274 3300025931 Ga0207644_10027302 Ga0207644_100273026 150
275 3300025932 Ga0207690_10049040 Ga0207690_100490401 150
276 3300025932 Ga0207690_11861343 Ga0207690_118613431 150
277 3300025933 Ga0207706_10011756 Ga0207706_100117562 150
278 3300025934 Ga0207686_11668847 Ga0207686_116688471 150
279 3300025936 Ga0207670_10026176 Ga0207670_100261763 150
280 3300025936 Ga0207670_10030833 Ga0207670_100308331 150
281 3300025937 Ga0207669_10865814 Ga0207669_108658141 150
282 3300025938 Ga0207704_10598809 Ga0207704_105988091 150
283 3300025939 Ga0207665_10251126 Ga0207665_102511263 150
284 3300025940 Ga0207691_10002536 Ga0207691_100025363 150
285 3300025940 Ga0207691_10014478 Ga0207691_100144782 150
286 3300025941 Ga0207711_10293395 Ga0207711_102933952 150
287 3300025942 Ga0207689_10001721 Ga0207689_1000172113 150
288 3300025944 Ga0207661_10001517 Ga0207661_100015175 150
289 3300025944 Ga0207661_10482105 Ga0207661_104821051 150
290 3300025945 Ga0207679_10001269 Ga0207679_1000126915 150
291 3300025949 Ga0207667_10081714 Ga0207667_100817142 150
292 3300025960 Ga0207651_10046487 Ga0207651_100464873 150
293 3300025960 Ga0207651_10090765 Ga0207651_100907655 150
294 3300025961 Ga0207712_10349453 Ga0207712_103494532 150
295 3300025972 Ga0207668_10760113 Ga0207668_107601131 150
296 3300025981 Ga0207640_10323261 Ga0207640_103232611 150
297 3300025986 Ga0207658_10022736 Ga0207658_100227361 150
298 3300026023 Ga0207677_10025406 Ga0207677_100254063 150
299 3300026035 Ga0207703_10491149 Ga0207703_104911493 150
300 3300026035 Ga0207703_11711796 Ga0207703_117117961 150
301 3300026041 Ga0207639_10030286 Ga0207639_100302862 150
302 3300026041 Ga0207639_10193836 Ga0207639_101938363 150
303 3300026067 Ga0207678_10005634 Ga0207678_100056342 150
304 3300026067 Ga0207678_10007353 Ga0207678_100073539 150
305 3300026088 Ga0207641_10000237 Ga0207641_1000023760 150
306 3300026088 Ga0207641_10058198 Ga0207641_100581982 150
307 3300026089 Ga0207648_10002084 Ga0207648_1000208416 150
308 3300026095 Ga0207676_10000050 Ga0207676_10000050103 150
309 3300026116 Ga0207674_10000130 Ga0207674_1000013074 150
310 3300026116 Ga0207674_10000408 Ga0207674_100004086 150
311 3300026118 Ga0207675_100020881 Ga0207675_1000208815 150
312 3300026121 Ga0207683_10009014 Ga0207683_100090143 150
313 3300026142 Ga0207698_10123528 Ga0207698_101235285 150
314 3300027512 Ga0209179_1000496 Ga0209179_10004966 150
315 3300028379 Ga0268266_10033326 Ga0268266_100333262 150
316 3300028379 Ga0268266_10033937 Ga0268266_100339375 150
317 3300028381 Ga0268264_10680701 Ga0268264_106807012 150
318 3300028556 Ga0265337_1000179 Ga0265337_10001798 150
319 3300028800 Ga0265338_10000339 Ga0265338_1000033966 150
320 3300028800 Ga0265338_10448982 Ga0265338_104489822 150
321 3300029957 Ga0265324_10001995 Ga0265324_100019958 150
322 3300031240 Ga0265320_10097711 Ga0265320_100977112 150
323 3300031247 Ga0265340_10002081 Ga0265340_100020816 150
324 3300031548 Ga0307408_100852196 Ga0307408_1008521961 150
325 3300031595 Ga0265313_10000165 Ga0265313_1000016566 150
326 3300031712 Ga0265342_10003307 Ga0265342_100033072 150
327 3300035111 Ga0373923_0058194 Ga0373923_0058194_822_1328 150
328 3300035170 Ga0373943_0084626 Ga0373943_0084626_973_1434 150
329 3300035171 Ga0373946_0464362 Ga0373946_0464362_170_622 150
330 3300035172 Ga0373955_0253693 Ga0373955_0253693_592_1044 150
331 3300035692 Ga0373935_0221866 Ga0373935_0221866_532_984 150
332 3300035692 Ga0373935_0297575 Ga0373935_0297575_644_1105 150
333 3300035692 Ga0373935_0358888 Ga0373935_0358888_458_994 150
334 3300035724 Ga0373933_0122986 Ga0373933_0122986_1068_1520 150
335 3300035725 Ga0373947_0033938 Ga0373947_0033938_318_779 150
336 3300036401 Ga0373937_1132750 Ga0373937_1132750_38_490 150
337 3300037068 Ga0373925_0097263 Ga0373925_0097263_1377_1838 150
338 3300037068 Ga0373925_0113349 Ga0373925_0113349_766_1218 150
339 3300037068 Ga0373925_0179341 Ga0373925_0179341_850_1302 150
340 3300037471 Ga0395905_1046863 Ga0395905_1046863_197_649 150
341 3300037853 Ga0436364_0046630 Ga0436364_0046630_814_1266 150
342 3300037853 Ga0436364_0540318 Ga0436364_0540318_3880_4332 150
343 3300037853 Ga0436364_1365438 Ga0436364_1365438_936_1388 150
344 3300037853 Ga0436364_1406452 Ga0436364_1406452_6416_6868 150
345 3300037853 Ga0436364_1416149 Ga0436364_1416149_295_747 150
346 3300038443 Ga0395901_0219380 Ga0395901_0219380_1061_1513 150
347 3300039437 Ga0436365_1863579 Ga0436365_1863579_50332_50784 150
348 3300039438 Ga0436360_1058374 Ga0436360_1058374_1989_2441 150
349 3300039438 Ga0436360_1116302 Ga0436360_1116302_620_1072 150
350 3300039438 Ga0436360_1199898 Ga0436360_1199898_1429_1881 150
351 3300039447 Ga0436361_0262657 Ga0436361_0262657_335_787 150
352 3300039447 Ga0436361_0374779 Ga0436361_0374779_2022_2474 150
353 3300039447 Ga0436361_0870398 Ga0436361_0870398_43_495 150
354 3300039447 Ga0436361_0999445 Ga0436361_0999445_3126_3578 150
355 3300039450 Ga0436363_0268987 Ga0436363_0268987_24_485 150
356 3300039453 Ga0436362_0156652 Ga0436362_0156652_1686_2138 150
357 3300042461 Ga0439460_0028478 Ga0439460_0028478_646_1098 150
358 3300044706 Ga0466964_0238671 Ga0466964_0238671_167_619 150
359 3300045976 Ga0466967_0361433 Ga0466967_0361433_760_1212 150
360 3300046460 Ga0495638_0061181 Ga0495638_0061181_1471_1923 150
361 3300046463 Ga0495653_0325051 Ga0495653_0325051_493_975 150
362 3300046472 Ga0495580_0056158 Ga0495580_0056158_294_746 150
363 3300046472 Ga0495580_0088262 Ga0495580_0088262_624_1085 150
364 3300046474 Ga0495605_0054246 Ga0495605_0054246_496_948 150
365 3300046477 Ga0495664_0253735 Ga0495664_0253735_85_537 150
366 3300046492 Ga0495585_0004923 Ga0495585_0004923_5495_5947 150
367 3300046501 Ga0495607_0123316 Ga0495607_0123316_514_966 150
368 3300046506 Ga0495583_0000396 Ga0495583_0000396_41380_41832 150
369 3300046507 Ga0495606_0008861 Ga0495606_0008861_4323_4799 150
370 3300046511 Ga0495608_0302633 Ga0495608_0302633_210_716 150
371 3300046513 Ga0495616_0137242 Ga0495616_0137242_398_850 150
372 3300046514 Ga0495618_0305023 Ga0495618_0305023_192_653 150
373 3300046516 Ga0495628_0134641 Ga0495628_0134641_623_1162 150
374 3300046517 Ga0495630_0075744 Ga0495630_0075744_493_954 150
375 3300046523 Ga0495644_0000647 Ga0495644_0000647_12154_12606 150
376 3300046524 Ga0495648_0001243 Ga0495648_0001243_21564_22016 150
377 3300046528 Ga0495642_0157862 Ga0495642_0157862_281_748 150
378 3300046529 Ga0495652_0192072 Ga0495652_0192072_192_731 150
379 3300046533 Ga0495640_0073852 Ga0495640_0073852_810_1271 150
380 3300046538 Ga0495609_0002623 Ga0495609_0002623_5242_5694 150
381 3300046615 Ga0495656_0025318 Ga0495656_0025318_180_632 150
382 3300046616 Ga0495668_0113904 Ga0495668_0113904_595_1047 150
383 3300046642 Ga0495634_0093720 Ga0495634_0093720_916_1377 150
384 3300046642 Ga0495634_0259016 Ga0495634_0259016_513_1019 150
385 3300046648 Ga0495611_0007573 Ga0495611_0007573_2379_2831 150
386 3300046660 Ga0495625_0052593 Ga0495625_0052593_1574_2026 150
387 3300046664 Ga0495659_0001042 Ga0495659_0001042_3327_3779 150
388 3300046665 Ga0495661_0015837 Ga0495661_0015837_1738_2190 150
389 3300046689 Ga0495613_0043935 Ga0495613_0043935_40_501 150
390 3300046690 Ga0495624_0173368 Ga0495624_0173368_317_826 150
391 3300046690 Ga0495624_0293465 Ga0495624_0293465_248_709 150
392 3300046691 Ga0495670_0002747 Ga0495670_0002747_3329_3781 150
393 3300046809 Ga0495600_0617384 Ga0495600_0617384_27_533 150
394 3300047318 Ga0495636_0007579 Ga0495636_0007579_425_877 150
395 3300047319 Ga0495674_0110274 Ga0495674_0110274_978_1439 150
396 3300047319 Ga0495674_0412734 Ga0495674_0412734_215_754 150
397 3300047443 Ga0495687_000587 Ga0495687_000587_41463_41915 150
398 3300047445 Ga0495677_0055329 Ga0495677_0055329_489_941 150
399 3300047447 Ga0495685_000078 Ga0495685_000078_3611_4063 150
400 3300047471 Ga0495684_0547817 Ga0495684_0547817_16_498 150
401 3300048904 Ga0496101_0253784 Ga0496101_0253784_285_770 150
402 3300048905 Ga0496102_0017201 Ga0496102_0017201_1941_2402 150
403 3300048906 Ga0496103_0165106 Ga0496103_0165106_313_798 150
404 3300048907 Ga0496104_0120564 Ga0496104_0120564_1241_1702 150
405 3300048907 Ga0496104_0872054 Ga0496104_0872054_248_733 150
406 3300048910 Ga0496107_0170109 Ga0496107_0170109_687_1172 150
407 3300048911 Ga0496108_0000106 Ga0496108_0000106_7530_7991 150
408 3300048912 Ga0496109_0000133 Ga0496109_0000133_9399_9860 150
409 3300048912 Ga0496109_0492491 Ga0496109_0492491_88_573 150
410 3300048913 Ga0496110_0013287 Ga0496110_0013287_1583_2044 150
411 3300048914 Ga0496111_0017707 Ga0496111_0017707_1961_2422 150
412 3300048915 Ga0496112_0000028 Ga0496112_0000028_118148_118609 150
413 3300048915 Ga0496112_0015337 Ga0496112_0015337_1239_1724 150
414 3300048915 Ga0496112_0517896 Ga0496112_0517896_321_806 150
415 3300048915 Ga0496112_1079627 Ga0496112_1079627_170_703 150
416 3300048916 Ga0496113_0000995 Ga0496113_0000995_5325_5786 150
417 3300048916 Ga0496113_0557678 Ga0496113_0557678_44_496 150
418 3300049459 Ga0495678_010336 Ga0495678_010336_476_928 150
419 3300049460 Ga0495682_0000618 Ga0495682_0000618_1912_2364 150
420 3300049571 Ga0501034_0009998 Ga0501034_0009998_6195_6647 150
421 3300049576 Ga0501040_0621062 Ga0501040_0621062_257_709 150
422 3300049578 Ga0501042_0738121 Ga0501042_0738121_103_555 150
423 3300049579 Ga0501043_0600115 Ga0501043_0600115_166_618 150
424 3300049592 Ga0501076_1741263 Ga0501076_1741263_13_465 150
425 3300049741 Ga0501079_0569624 Ga0501079_0569624_201_653 150
426 3300049742 Ga0501080_0697057 Ga0501080_0697057_242_694 150
427 3300049743 Ga0501081_0847376 Ga0501081_0847376_212_667 150
428 3300049822 Ga0501035_0667677 Ga0501035_0667677_256_708 150
429 3300049823 Ga0501044_0001789 Ga0501044_0001789_17938_18390 150
430 3300049823 Ga0501044_0038067 Ga0501044_0038067_1581_2033 150
431 3300050507 nmdc:mga05p37_196485_c1 nmdc:mga05p37_196485_c1_462_914 150
432 3300050509 nmdc:mga0qj67_158445_c1 nmdc:mga0qj67_158445_c1_303_755 150
433 3300050512 nmdc:mga0n895_1577688_c1 nmdc:mga0n895_1577688_c1_119_571 150
434 3300050512 nmdc:mga0n895_871195_c1 nmdc:mga0n895_871195_c1_215_667 150
435 3300050514 nmdc:mga08x19_4_c1 nmdc:mga08x19_4_c1_119579_120031 150
436 3300053077 Ga0495601_0019536 Ga0495601_0019536_2423_2884 150
437 3300053077 Ga0495601_0165505 Ga0495601_0165505_236_775 150
438 3300053084 Ga0495595_0051669 Ga0495595_0051669_1177_1683 150
439 3300053085 Ga0495619_0150534 Ga0495619_0150534_263_715 150
440 3300060353 Ga0501082_0106472 Ga0501082_0106472_1554_2006 150
441 3300061734 Ga0530510_0112621 Ga0530510_0112621_719_1171 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

41

176

0.91

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

31

176

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8669 1 150
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8635 4 150
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8513 4 150
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8462 4 150
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8455 4 150
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8245 4 150 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8078 4 146 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8074 4 146 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8001 6 149 3.30.530.20
af_Q8BK64_207_336_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7999 4 148 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7Y1TVD1-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 0.9885 2 79 GO:0008168
GO:0032259
AF-A0A1H8NFQ3-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9879 1 147
AF-C4WF00-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9864 1 146
AF-A0A6L5FIU4-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 0.9847 1 150 GO:0008168
GO:0032259
AF-A0A2K4G3G9-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 0.9847 3 148 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
94.21 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map