F444730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 441 | 287 | 441 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0134641|Ga0495628_0134641_623_1162 |
| Length | 179 |
| Sequence | LHYPADIAIWISNPEVACLRQSIYEKEARVSNRIEKRIELDAPPSRVWRALTDHREFGEWFRVKLDGPFVPGQVTRGSVADPGYEHLKWEATVQKMEPERLFSFTWHPYAIDPNFDYRSEPPTLVEFRLEAKEGGTVLFLTESGFDAIPQGRRFEAFRMNERGWTEQMKNIERHVGRPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 97 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 98 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 99 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 100 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 187 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 190 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 191 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 279 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 280 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 281 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 282 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 283 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 284 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.49 |
| Nodule | 0 |
| Rhizoplane | 4.08 |
| Rhizosphere | 91.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10005084 | 3300002459 | Bacteria | 2678 |
| 2 | JGI24751J29686_10014465 | 3300002459 | Bacteria | 1628 |
| 3 | Ga0065707_10257162 | 3300005295 | Unclassified | 1108 |
| 4 | Ga0070676_10009166 | 3300005328 | Bacteria | 5353 |
| 5 | Ga0070683_100009510 | 3300005329 | Bacteria | 8319 |
| 6 | Ga0070683_100030032 | 3300005329 | Bacteria | 4928 |
| 7 | Ga0070670_100044700 | 3300005331 | Bacteria | 3807 |
| 8 | Ga0070677_10004905 | 3300005333 | Bacteria | 4392 |
| 9 | Ga0070666_10038869 | 3300005335 | Bacteria | 3168 |
| 10 | Ga0070680_100063564 | 3300005336 | Bacteria | 3023 |
| 11 | Ga0070682_100018425 | 3300005337 | Unclassified | 4081 |
| 12 | Ga0068868_100040845 | 3300005338 | Bacteria | 3612 |
| 13 | Ga0070660_100006201 | 3300005339 | Bacteria | 8274 |
| 14 | Ga0070660_100019860 | 3300005339 | Bacteria | 4930 |
| 15 | Ga0070689_100046796 | 3300005340 | Bacteria | 3334 |
| 16 | Ga0070689_100060016 | 3300005340 | Bacteria | 2956 |
| 17 | Ga0070661_100001498 | 3300005344 | Bacteria | 16232 |
| 18 | Ga0070668_100010882 | 3300005347 | Bacteria | 6769 |
| 19 | Ga0070668_100916639 | 3300005347 | Bacteria | 784 |
| 20 | Ga0070668_101090624 | 3300005347 | Unclassified | 720 |
| 21 | Ga0070675_100186470 | 3300005354 | Bacteria | 1795 |
| 22 | Ga0070675_100587538 | 3300005354 | Bacteria | 1009 |
| 23 | Ga0070671_100024164 | 3300005355 | Bacteria | 4973 |
| 24 | Ga0070674_100145632 | 3300005356 | Unclassified | 1783 |
| 25 | Ga0070673_100001087 | 3300005364 | Bacteria | 15553 |
| 26 | Ga0070673_100248514 | 3300005364 | Bacteria | 1549 |
| 27 | Ga0070688_100007808 | 3300005365 | Bacteria | 5781 |
| 28 | Ga0070659_100002865 | 3300005366 | Bacteria | 12281 |
| 29 | Ga0070659_100007686 | 3300005366 | Bacteria | 7843 |
| 30 | Ga0070667_100072920 | 3300005367 | Bacteria | 2926 |
| 31 | Ga0070713_100040155 | 3300005436 | Bacteria | 3803 |
| 32 | Ga0070713_100060843 | 3300005436 | Unclassified | 3158 |
| 33 | Ga0070713_100169028 | 3300005436 | Bacteria | 1957 |
| 34 | Ga0070713_100332795 | 3300005436 | Bacteria | 1405 |
| 35 | Ga0070713_100453578 | 3300005436 | Bacteria | 1205 |
| 36 | Ga0070713_100556899 | 3300005436 | Bacteria | 1086 |
| 37 | Ga0070713_101620079 | 3300005436 | Bacteria | 628 |
| 38 | Ga0070713_101650956 | 3300005436 | Bacteria | 622 |
| 39 | Ga0070710_10004818 | 3300005437 | Bacteria | 6382 |
| 40 | Ga0070710_10082774 | 3300005437 | Bacteria | 1877 |
| 41 | Ga0070710_10293952 | 3300005437 | Unclassified | 1058 |
| 42 | Ga0070711_100003446 | 3300005439 | Bacteria | 9215 |
| 43 | Ga0070711_100040604 | 3300005439 | Bacteria | 3138 |
| 44 | Ga0070711_100284307 | 3300005439 | Bacteria | 1310 |
| 45 | Ga0070700_100050107 | 3300005441 | Bacteria | 2595 |
| 46 | Ga0070694_100293331 | 3300005444 | Bacteria | 1244 |
| 47 | Ga0070708_100015673 | 3300005445 | Bacteria | 6264 |
| 48 | Ga0070708_100016628 | 3300005445 | Bacteria | 6111 |
| 49 | Ga0070663_100009736 | 3300005455 | Bacteria | 5966 |
| 50 | Ga0070663_100049907 | 3300005455 | Bacteria | 2974 |
| 51 | Ga0070662_100417385 | 3300005457 | Unclassified | 1109 |
| 52 | Ga0068867_100751228 | 3300005459 | Unclassified | 865 |
| 53 | Ga0070706_100143206 | 3300005467 | Bacteria | 2231 |
| 54 | Ga0070706_101275022 | 3300005467 | Bacteria | 674 |
| 55 | Ga0070707_100068411 | 3300005468 | Bacteria | 3418 |
| 56 | Ga0070707_100338886 | 3300005468 | Bacteria | 1461 |
| 57 | Ga0070707_100968455 | 3300005468 | Bacteria | 816 |
| 58 | Ga0070698_100048074 | 3300005471 | Bacteria | 4359 |
| 59 | Ga0070698_100512194 | 3300005471 | Bacteria | 1138 |
| 60 | Ga0070699_100182210 | 3300005518 | Unclassified | 1864 |
| 61 | Ga0070699_101178146 | 3300005518 | Bacteria | 703 |
| 62 | Ga0070679_100027842 | 3300005530 | Bacteria | 5568 |
| 63 | Ga0070679_100784427 | 3300005530 | Bacteria | 896 |
| 64 | Ga0070684_100002226 | 3300005535 | Bacteria | 14292 |
| 65 | Ga0070697_100001384 | 3300005536 | Bacteria | 18346 |
| 66 | Ga0070697_100009949 | 3300005536 | Bacteria | 7419 |
| 67 | Ga0070697_100063082 | 3300005536 | Bacteria | 3026 |
| 68 | Ga0070697_100254926 | 3300005536 | Bacteria | 1501 |
| 69 | Ga0070697_100263616 | 3300005536 | Bacteria | 1476 |
| 70 | Ga0070697_100356344 | 3300005536 | Bacteria | 1264 |
| 71 | Ga0068853_100015249 | 3300005539 | Bacteria | 6317 |
| 72 | Ga0068853_100259953 | 3300005539 | Bacteria | 1596 |
| 73 | Ga0070672_100095863 | 3300005543 | Bacteria | 2400 |
| 74 | Ga0070696_100939849 | 3300005546 | Unclassified | 719 |
| 75 | Ga0070665_100073264 | 3300005548 | Bacteria | 3431 |
| 76 | Ga0070665_100413990 | 3300005548 | Bacteria | 1356 |
| 77 | Ga0070704_100045073 | 3300005549 | Bacteria | 3067 |
| 78 | Ga0070704_100199300 | 3300005549 | Bacteria | 1615 |
| 79 | Ga0070664_100082092 | 3300005564 | Bacteria | 2779 |
| 80 | Ga0070664_100219070 | 3300005564 | Bacteria | 1702 |
| 81 | Ga0068857_100009135 | 3300005577 | Bacteria | 8601 |
| 82 | Ga0068857_100069490 | 3300005577 | Bacteria | 3136 |
| 83 | Ga0068854_100175959 | 3300005578 | Bacteria | 1668 |
| 84 | Ga0068856_100067957 | 3300005614 | Bacteria | 3522 |
| 85 | Ga0068864_100036188 | 3300005618 | Bacteria | 4206 |
| 86 | Ga0068864_101077040 | 3300005618 | Bacteria | 799 |
| 87 | Ga0068861_100446075 | 3300005719 | Unclassified | 1158 |
| 88 | Ga0068870_10000755 | 3300005840 | Bacteria | 12440 |
| 89 | Ga0068863_100044634 | 3300005841 | Bacteria | 4206 |
| 90 | Ga0068858_100026991 | 3300005842 | Bacteria | 5334 |
| 91 | Ga0068862_100064421 | 3300005844 | Bacteria | 3155 |
| 92 | Ga0081455_10036738 | 3300005937 | Bacteria | 4357 |
| 93 | Ga0081540_1003469 | 3300005983 | Bacteria | 12445 |
| 94 | Ga0070717_10014993 | 3300006028 | Bacteria | 5971 |
| 95 | Ga0070717_10031233 | 3300006028 | Bacteria | 4283 |
| 96 | Ga0070717_10187352 | 3300006028 | Bacteria | 1806 |
| 97 | Ga0070717_10609569 | 3300006028 | Unclassified | 990 |
| 98 | Ga0070717_12019967 | 3300006028 | Unclassified | 519 |
| 99 | Ga0070715_10133740 | 3300006163 | Bacteria | 1197 |
| 100 | Ga0070712_100005454 | 3300006175 | Bacteria | 7879 |
| 101 | Ga0070712_100017935 | 3300006175 | Bacteria | 4588 |
| 102 | Ga0070712_100072116 | 3300006175 | Bacteria | 2473 |
| 103 | Ga0070712_100359826 | 3300006175 | Bacteria | 1193 |
| 104 | Ga0070712_101368037 | 3300006175 | Bacteria | 617 |
| 105 | Ga0068871_100282919 | 3300006358 | Bacteria | 1451 |
| 106 | Ga0075428_100224357 | 3300006844 | Bacteria | 2029 |
| 107 | Ga0075428_100814256 | 3300006844 | Bacteria | 992 |
| 108 | Ga0075430_100091596 | 3300006846 | Unclassified | 2542 |
| 109 | Ga0075431_100077120 | 3300006847 | Unclassified | 3439 |
| 110 | Ga0075431_100260686 | 3300006847 | Bacteria | 1759 |
| 111 | Ga0075434_101011235 | 3300006871 | Bacteria | 845 |
| 112 | Ga0075434_102118194 | 3300006871 | Unclassified | 567 |
| 113 | Ga0075429_100092627 | 3300006880 | Bacteria | 2636 |
| 114 | Ga0075436_100000321 | 3300006914 | Bacteria | 30575 |
| 115 | Ga0075436_100668413 | 3300006914 | Unclassified | 768 |
| 116 | Ga0099794_10225163 | 3300007265 | Bacteria | 964 |
| 117 | Ga0099795_10030663 | 3300007788 | Bacteria | 1847 |
| 118 | Ga0099795_10097459 | 3300007788 | Bacteria | 1149 |
| 119 | Ga0105251_10238950 | 3300009011 | Unclassified | 818 |
| 120 | Ga0105250_10024956 | 3300009092 | Bacteria | 2409 |
| 121 | Ga0105240_10070392 | 3300009093 | Bacteria | 4327 |
| 122 | Ga0105245_10034123 | 3300009098 | Unclassified | 4511 |
| 123 | Ga0105247_10003532 | 3300009101 | Bacteria | 10163 |
| 124 | Ga0105247_10481916 | 3300009101 | Bacteria | 900 |
| 125 | Ga0114129_10117356 | 3300009147 | Bacteria | 3667 |
| 126 | Ga0114129_10121514 | 3300009147 | Unclassified | 3594 |
| 127 | Ga0105241_10006132 | 3300009174 | Bacteria | 8861 |
| 128 | Ga0105241_10630258 | 3300009174 | Bacteria | 972 |
| 129 | Ga0105242_10008370 | 3300009176 | Bacteria | 7947 |
| 130 | Ga0105242_12160180 | 3300009176 | Bacteria | 601 |
| 131 | Ga0105248_10195090 | 3300009177 | Bacteria | 2281 |
| 132 | Ga0105248_10736007 | 3300009177 | Bacteria | 1113 |
| 133 | Ga0105237_10014537 | 3300009545 | Bacteria | 8226 |
| 134 | Ga0105238_10053880 | 3300009551 | Bacteria | 4042 |
| 135 | Ga0105249_10019268 | 3300009553 | Bacteria | 6085 |
| 136 | Ga0099796_10130796 | 3300010159 | Bacteria | 973 |
| 137 | Ga0105239_10095401 | 3300010375 | Unclassified | 3286 |
| 138 | Ga0105239_10270785 | 3300010375 | Bacteria | 1910 |
| 139 | Ga0105246_10006758 | 3300011119 | Bacteria | 7014 |
| 140 | Ga0105246_10434166 | 3300011119 | Bacteria | 1099 |
| 141 | Ga0105246_10943746 | 3300011119 | Bacteria | 777 |
| 142 | Ga0157373_10181883 | 3300013100 | Unclassified | 1480 |
| 143 | Ga0157371_10547879 | 3300013102 | Unclassified | 857 |
| 144 | Ga0157370_10027606 | 3300013104 | Bacteria | 5597 |
| 145 | Ga0157370_10888772 | 3300013104 | Unclassified | 809 |
| 146 | Ga0157369_10019003 | 3300013105 | Bacteria | 7695 |
| 147 | Ga0157369_10023099 | 3300013105 | Bacteria | 6930 |
| 148 | Ga0157369_10098030 | 3300013105 | Bacteria | 3127 |
| 149 | Ga0157369_10385870 | 3300013105 | Bacteria | 1454 |
| 150 | Ga0157374_10669765 | 3300013296 | Bacteria | 1050 |
| 151 | Ga0163162_11181364 | 3300013306 | Unclassified | 868 |
| 152 | Ga0157372_10044713 | 3300013307 | Unclassified | 4908 |
| 153 | Ga0163163_10520975 | 3300014325 | Bacteria | 1251 |
| 154 | Ga0163163_12295052 | 3300014325 | Bacteria | 598 |
| 155 | Ga0163163_12295054 | 3300014325 | Unclassified | 598 |
| 156 | Ga0157379_10131451 | 3300014968 | Bacteria | 2253 |
| 157 | Ga0157379_10404800 | 3300014968 | Bacteria | 1255 |
| 158 | Ga0157376_10033432 | 3300014969 | Bacteria | 4140 |
| 159 | Ga0157376_12160791 | 3300014969 | Unclassified | 595 |
| 160 | Ga0163161_10098096 | 3300017792 | Bacteria | 2177 |
| 161 | Ga0213872_10002098 | 3300021361 | Bacteria | 12026 |
| 162 | Ga0213872_10059704 | 3300021361 | Bacteria | 1725 |
| 163 | Ga0213876_10014903 | 3300021384 | Unclassified | 4120 |
| 164 | Ga0213875_10000033 | 3300021388 | Bacteria | 170944 |
| 165 | Ga0213871_10012232 | 3300021441 | Bacteria | 1989 |
| 166 | Ga0224569_100743 | 3300022732 | Bacteria | 2769 |
| 167 | Ga0224571_100336 | 3300022734 | Unclassified | 2474 |
| 168 | Ga0224572_1011182 | 3300024225 | Bacteria | 1697 |
| 169 | Ga0228598_1001241 | 3300024227 | Bacteria | 5627 |
| 170 | Ga0228598_1013386 | 3300024227 | Bacteria | 1624 |
| 171 | Ga0207697_10022941 | 3300025315 | Bacteria | 2556 |
| 172 | Ga0207656_10013992 | 3300025321 | Bacteria | 3080 |
| 173 | Ga0207682_10003265 | 3300025893 | Bacteria | 7096 |
| 174 | Ga0207692_10039509 | 3300025898 | Unclassified | 2322 |
| 175 | Ga0207692_10069329 | 3300025898 | Bacteria | 1852 |
| 176 | Ga0207692_10545451 | 3300025898 | Bacteria | 740 |
| 177 | Ga0207642_10134641 | 3300025899 | Unclassified | 1294 |
| 178 | Ga0207710_10065493 | 3300025900 | Bacteria | 1657 |
| 179 | Ga0207688_10002862 | 3300025901 | Bacteria | 9376 |
| 180 | Ga0207647_10008037 | 3300025904 | Bacteria | 7584 |
| 181 | Ga0207699_10092593 | 3300025906 | Bacteria | 1900 |
| 182 | Ga0207699_10171097 | 3300025906 | Bacteria | 1453 |
| 183 | Ga0207645_10000892 | 3300025907 | Bacteria | 24746 |
| 184 | Ga0207643_10000476 | 3300025908 | Bacteria | 25945 |
| 185 | Ga0207705_10001124 | 3300025909 | Bacteria | 21762 |
| 186 | Ga0207684_10003341 | 3300025910 | Bacteria | 15731 |
| 187 | Ga0207684_10077844 | 3300025910 | Bacteria | 2820 |
| 188 | Ga0207695_10491094 | 3300025913 | Bacteria | 1110 |
| 189 | Ga0207671_10161045 | 3300025914 | Bacteria | 1738 |
| 190 | Ga0207693_10000039 | 3300025915 | Bacteria | 108357 |
| 191 | Ga0207693_10013298 | 3300025915 | Bacteria | 6639 |
| 192 | Ga0207693_10033413 | 3300025915 | Bacteria | 4059 |
| 193 | Ga0207693_10117615 | 3300025915 | Bacteria | 2087 |
| 194 | Ga0207663_10012145 | 3300025916 | Unclassified | 4646 |
| 195 | Ga0207663_10085447 | 3300025916 | Bacteria | 2077 |
| 196 | Ga0207663_10185369 | 3300025916 | Bacteria | 1490 |
| 197 | Ga0207663_10216457 | 3300025916 | Bacteria | 1391 |
| 198 | Ga0207660_10327095 | 3300025917 | Bacteria | 1225 |
| 199 | Ga0207662_10008767 | 3300025918 | Bacteria | 5547 |
| 200 | Ga0207657_10002508 | 3300025919 | Bacteria | 19865 |
| 201 | Ga0207657_10003733 | 3300025919 | Bacteria | 16182 |
| 202 | Ga0207649_10001149 | 3300025920 | Bacteria | 15980 |
| 203 | Ga0207652_10010031 | 3300025921 | Bacteria | 7628 |
| 204 | Ga0207646_10061740 | 3300025922 | Bacteria | 3345 |
| 205 | Ga0207646_10285282 | 3300025922 | Bacteria | 1492 |
| 206 | Ga0207681_10419850 | 3300025923 | Unclassified | 1083 |
| 207 | Ga0207650_10000072 | 3300025925 | Bacteria | 137765 |
| 208 | Ga0207650_10000078 | 3300025925 | Bacteria | 130954 |
| 209 | Ga0207650_10006965 | 3300025925 | Bacteria | 7708 |
| 210 | Ga0207659_10050481 | 3300025926 | Unclassified | 2955 |
| 211 | Ga0207659_10271213 | 3300025926 | Bacteria | 1384 |
| 212 | Ga0207687_10038254 | 3300025927 | Bacteria | 3278 |
| 213 | Ga0207687_10958481 | 3300025927 | Bacteria | 733 |
| 214 | Ga0207700_10322430 | 3300025928 | Bacteria | 1339 |
| 215 | Ga0207700_10580697 | 3300025928 | Bacteria | 997 |
| 216 | Ga0207700_11795537 | 3300025928 | Unclassified | 539 |
| 217 | Ga0207664_10046447 | 3300025929 | Unclassified | 3408 |
| 218 | Ga0207644_10027302 | 3300025931 | Bacteria | 3943 |
| 219 | Ga0207690_10049040 | 3300025932 | Bacteria | 2812 |
| 220 | Ga0207690_11861343 | 3300025932 | Bacteria | 502 |
| 221 | Ga0207706_10011756 | 3300025933 | Bacteria | 7973 |
| 222 | Ga0207686_11668847 | 3300025934 | Bacteria | 527 |
| 223 | Ga0207670_10026176 | 3300025936 | Bacteria | 3673 |
| 224 | Ga0207670_10030833 | 3300025936 | Bacteria | 3428 |
| 225 | Ga0207669_10865814 | 3300025937 | Unclassified | 753 |
| 226 | Ga0207704_10598809 | 3300025938 | Unclassified | 902 |
| 227 | Ga0207665_10251126 | 3300025939 | Bacteria | 1307 |
| 228 | Ga0207691_10002536 | 3300025940 | Bacteria | 17845 |
| 229 | Ga0207691_10014478 | 3300025940 | Bacteria | 7521 |
| 230 | Ga0207711_10293395 | 3300025941 | Unclassified | 1499 |
| 231 | Ga0207689_10001721 | 3300025942 | Bacteria | 20713 |
| 232 | Ga0207661_10001517 | 3300025944 | Bacteria | 15755 |
| 233 | Ga0207661_10482105 | 3300025944 | Bacteria | 1132 |
| 234 | Ga0207679_10001269 | 3300025945 | Bacteria | 15990 |
| 235 | Ga0207667_10081714 | 3300025949 | Bacteria | 3347 |
| 236 | Ga0207651_10046487 | 3300025960 | Bacteria | 2919 |
| 237 | Ga0207651_10090765 | 3300025960 | Bacteria | 2234 |
| 238 | Ga0207712_10349453 | 3300025961 | Bacteria | 1229 |
| 239 | Ga0207668_10760113 | 3300025972 | Unclassified | 856 |
| 240 | Ga0207668_10980676 | 3300025972 | Bacteria | 755 |
| 241 | Ga0207640_10323261 | 3300025981 | Bacteria | 1229 |
| 242 | Ga0207658_10022736 | 3300025986 | Bacteria | 4367 |
| 243 | Ga0207677_10025406 | 3300026023 | Unclassified | 3695 |
| 244 | Ga0207703_10491149 | 3300026035 | Unclassified | 1151 |
| 245 | Ga0207703_11711796 | 3300026035 | Bacteria | 605 |
| 246 | Ga0207639_10030286 | 3300026041 | Unclassified | 3968 |
| 247 | Ga0207639_10193836 | 3300026041 | Bacteria | 1737 |
| 248 | Ga0207678_10005634 | 3300026067 | Bacteria | 11194 |
| 249 | Ga0207678_10007353 | 3300026067 | Bacteria | 9752 |
| 250 | Ga0207678_11226727 | 3300026067 | Unclassified | 664 |
| 251 | Ga0207641_10000237 | 3300026088 | Bacteria | 71168 |
| 252 | Ga0207641_10058198 | 3300026088 | Bacteria | 3289 |
| 253 | Ga0207648_10002084 | 3300026089 | Bacteria | 21777 |
| 254 | Ga0207676_10000050 | 3300026095 | Bacteria | 133298 |
| 255 | Ga0207674_10000130 | 3300026116 | Bacteria | 88123 |
| 256 | Ga0207674_10000408 | 3300026116 | Bacteria | 55815 |
| 257 | Ga0207675_100020881 | 3300026118 | Bacteria | 6106 |
| 258 | Ga0207683_10009014 | 3300026121 | Bacteria | 8500 |
| 259 | Ga0207683_10491340 | 3300026121 | Bacteria | 1133 |
| 260 | Ga0207698_10123528 | 3300026142 | Bacteria | 2196 |
| 261 | Ga0209179_1000496 | 3300027512 | Bacteria | 4034 |
| 262 | Ga0209588_1025866 | 3300027671 | Bacteria | 1860 |
| 263 | Ga0268266_10033326 | 3300028379 | Bacteria | 4378 |
| 264 | Ga0268266_10033937 | 3300028379 | Bacteria | 4337 |
| 265 | Ga0268266_10405568 | 3300028379 | Bacteria | 1290 |
| 266 | Ga0268264_10680701 | 3300028381 | Bacteria | 1020 |
| 267 | Ga0265337_1000179 | 3300028556 | Bacteria | 33387 |
| 268 | Ga0265338_10000339 | 3300028800 | Bacteria | 85119 |
| 269 | Ga0265338_10448982 | 3300028800 | Unclassified | 913 |
| 270 | Ga0265324_10001995 | 3300029957 | Bacteria | 10897 |
| 271 | Ga0265320_10097711 | 3300031240 | Bacteria | 1354 |
| 272 | Ga0265340_10002081 | 3300031247 | Bacteria | 11461 |
| 273 | Ga0307408_100852196 | 3300031548 | Bacteria | 831 |
| 274 | Ga0265313_10000165 | 3300031595 | Bacteria | 69129 |
| 275 | Ga0265342_10003307 | 3300031712 | Bacteria | 13314 |
| 276 | Ga0307416_103454715 | 3300032002 | Unclassified | 529 |
| 277 | Ga0373923_0058194 | 3300035111 | Bacteria | 1636 |
| 278 | Ga0373943_0084626 | 3300035170 | Bacteria | 1632 |
| 279 | Ga0373946_0464362 | 3300035171 | Bacteria | 646 |
| 280 | Ga0373955_0253693 | 3300035172 | Bacteria | 1055 |
| 281 | Ga0373935_0221866 | 3300035692 | Bacteria | 1313 |
| 282 | Ga0373935_0297575 | 3300035692 | Bacteria | 1140 |
| 283 | Ga0373935_0358888 | 3300035692 | Unclassified | 1040 |
| 284 | Ga0373933_0122986 | 3300035724 | Bacteria | 1626 |
| 285 | Ga0373947_0033938 | 3300035725 | Bacteria | 3017 |
| 286 | Ga0373937_1132750 | 3300036401 | Bacteria | 731 |
| 287 | Ga0373925_0097263 | 3300037068 | Bacteria | 2258 |
| 288 | Ga0373925_0113349 | 3300037068 | Bacteria | 2097 |
| 289 | Ga0373925_0179341 | 3300037068 | Unclassified | 1676 |
| 290 | Ga0395905_1046863 | 3300037471 | Bacteria | 719 |
| 291 | Ga0436364_0046630 | 3300037853 | Unclassified | 1604 |
| 292 | Ga0436364_0540318 | 3300037853 | Bacteria | 6168 |
| 293 | Ga0436364_1365438 | 3300037853 | Unclassified | 3543 |
| 294 | Ga0436364_1406452 | 3300037853 | Bacteria | 10842 |
| 295 | Ga0436364_1416149 | 3300037853 | Bacteria | 1070 |
| 296 | Ga0395901_0219380 | 3300038443 | Bacteria | 1988 |
| 297 | Ga0436365_1863579 | 3300039437 | Bacteria | 54364 |
| 298 | Ga0436360_1058374 | 3300039438 | Bacteria | 2776 |
| 299 | Ga0436360_1116302 | 3300039438 | Bacteria | 1607 |
| 300 | Ga0436360_1199898 | 3300039438 | Bacteria | 5031 |
| 301 | Ga0436361_0262657 | 3300039447 | Bacteria | 1812 |
| 302 | Ga0436361_0374779 | 3300039447 | Bacteria | 5657 |
| 303 | Ga0436361_0610116 | 3300039447 | Bacteria | 176709 |
| 304 | Ga0436361_0870398 | 3300039447 | Unclassified | 642 |
| 305 | Ga0436361_0999445 | 3300039447 | Bacteria | 5586 |
| 306 | Ga0436363_0268987 | 3300039450 | Unclassified | 584 |
| 307 | Ga0436363_1436362 | 3300039450 | Bacteria | 10958 |
| 308 | Ga0436362_0156652 | 3300039453 | Bacteria | 2436 |
| 309 | Ga0439460_0028478 | 3300042461 | Bacteria | 1576 |
| 310 | Ga0466964_0238671 | 3300044706 | Bacteria | 891 |
| 311 | Ga0453684_0191495 | 3300044712 | Bacteria | 2392 |
| 312 | Ga0453684_1409067 | 3300044712 | Bacteria | 722 |
| 313 | Ga0466967_0319766 | 3300045976 | Bacteria | 1496 |
| 314 | Ga0466967_0361433 | 3300045976 | Unclassified | 1407 |
| 315 | Ga0495638_0000027 | 3300046460 | Bacteria | 337569 |
| 316 | Ga0495638_0061181 | 3300046460 | Bacteria | 2327 |
| 317 | Ga0495653_0325051 | 3300046463 | Bacteria | 996 |
| 318 | Ga0495650_0002685 | 3300046471 | Bacteria | 13820 |
| 319 | Ga0495580_0056158 | 3300046472 | Bacteria | 2773 |
| 320 | Ga0495580_0088262 | 3300046472 | Bacteria | 2160 |
| 321 | Ga0495605_0002378 | 3300046474 | Bacteria | 11676 |
| 322 | Ga0495605_0054246 | 3300046474 | Bacteria | 1942 |
| 323 | Ga0495639_0081276 | 3300046475 | Bacteria | 1510 |
| 324 | Ga0495664_0253735 | 3300046477 | Bacteria | 1064 |
| 325 | Ga0495585_0004923 | 3300046492 | Bacteria | 8541 |
| 326 | Ga0495585_0012917 | 3300046492 | Bacteria | 4908 |
| 327 | Ga0495607_0089425 | 3300046501 | Bacteria | 1672 |
| 328 | Ga0495607_0123316 | 3300046501 | Bacteria | 1357 |
| 329 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 330 | Ga0495583_0000396 | 3300046506 | Bacteria | 66329 |
| 331 | Ga0495583_0009228 | 3300046506 | Bacteria | 5916 |
| 332 | Ga0495606_0008861 | 3300046507 | Bacteria | 8623 |
| 333 | Ga0495608_0302633 | 3300046511 | Bacteria | 990 |
| 334 | Ga0495610_0011813 | 3300046512 | Bacteria | 5307 |
| 335 | Ga0495616_0013399 | 3300046513 | Bacteria | 4625 |
| 336 | Ga0495616_0137242 | 3300046513 | Bacteria | 1116 |
| 337 | Ga0495618_0305023 | 3300046514 | Bacteria | 989 |
| 338 | Ga0495628_0134641 | 3300046516 | Bacteria | 1889 |
| 339 | Ga0495630_0075744 | 3300046517 | Bacteria | 2535 |
| 340 | Ga0495643_0000117 | 3300046522 | Bacteria | 129698 |
| 341 | Ga0495643_0106577 | 3300046522 | Bacteria | 1430 |
| 342 | Ga0495644_0000647 | 3300046523 | Bacteria | 14574 |
| 343 | Ga0495648_0000078 | 3300046524 | Bacteria | 127397 |
| 344 | Ga0495648_0001243 | 3300046524 | Bacteria | 25500 |
| 345 | Ga0495642_0001450 | 3300046528 | Bacteria | 10625 |
| 346 | Ga0495642_0157862 | 3300046528 | Bacteria | 983 |
| 347 | Ga0495652_0192072 | 3300046529 | Bacteria | 1557 |
| 348 | Ga0495654_0125879 | 3300046530 | Bacteria | 1155 |
| 349 | Ga0495640_0073852 | 3300046533 | Bacteria | 2282 |
| 350 | Ga0495609_0002623 | 3300046538 | Bacteria | 10918 |
| 351 | Ga0495609_0026791 | 3300046538 | Bacteria | 2637 |
| 352 | Ga0495597_0002247 | 3300046542 | Bacteria | 12589 |
| 353 | Ga0495622_0000281 | 3300046557 | Bacteria | 38709 |
| 354 | Ga0495633_0000375 | 3300046558 | Bacteria | 47710 |
| 355 | Ga0495656_0025318 | 3300046615 | Bacteria | 2351 |
| 356 | Ga0495668_0009894 | 3300046616 | Bacteria | 5815 |
| 357 | Ga0495668_0113904 | 3300046616 | Bacteria | 1479 |
| 358 | Ga0495634_0093720 | 3300046642 | Bacteria | 1947 |
| 359 | Ga0495634_0259016 | 3300046642 | Bacteria | 1062 |
| 360 | Ga0495611_0007573 | 3300046648 | Bacteria | 4606 |
| 361 | Ga0495625_0000516 | 3300046660 | Bacteria | 56935 |
| 362 | Ga0495625_0004833 | 3300046660 | Bacteria | 12583 |
| 363 | Ga0495625_0052593 | 3300046660 | Bacteria | 2915 |
| 364 | Ga0495659_0001042 | 3300046664 | Bacteria | 9682 |
| 365 | Ga0495661_0015837 | 3300046665 | Bacteria | 5020 |
| 366 | Ga0495661_0500893 | 3300046665 | Bacteria | 579 |
| 367 | Ga0495613_0043935 | 3300046689 | Bacteria | 3307 |
| 368 | Ga0495624_0173368 | 3300046690 | Bacteria | 1316 |
| 369 | Ga0495624_0293465 | 3300046690 | Bacteria | 981 |
| 370 | Ga0495670_0002747 | 3300046691 | Bacteria | 8698 |
| 371 | Ga0495670_0024908 | 3300046691 | Bacteria | 2958 |
| 372 | Ga0495649_0175412 | 3300046694 | Bacteria | 1120 |
| 373 | Ga0495600_0617384 | 3300046809 | Bacteria | 658 |
| 374 | Ga0495660_0028483 | 3300046810 | Bacteria | 3156 |
| 375 | Ga0495636_0007579 | 3300047318 | Bacteria | 4272 |
| 376 | Ga0495636_0011888 | 3300047318 | Bacteria | 3448 |
| 377 | Ga0495674_0110274 | 3300047319 | Bacteria | 2334 |
| 378 | Ga0495674_0412734 | 3300047319 | Bacteria | 1089 |
| 379 | Ga0495672_0020129 | 3300047320 | Bacteria | 4381 |
| 380 | Ga0495683_0138362 | 3300047323 | Bacteria | 1143 |
| 381 | Ga0495687_000587 | 3300047443 | Bacteria | 42438 |
| 382 | Ga0495677_0036945 | 3300047445 | Bacteria | 1784 |
| 383 | Ga0495677_0055329 | 3300047445 | Bacteria | 1464 |
| 384 | Ga0495685_000078 | 3300047447 | Bacteria | 37109 |
| 385 | Ga0495684_0547817 | 3300047471 | Bacteria | 788 |
| 386 | Ga0496101_0253784 | 3300048904 | Bacteria | 1371 |
| 387 | Ga0496102_0017201 | 3300048905 | Bacteria | 6331 |
| 388 | Ga0496103_0165106 | 3300048906 | Bacteria | 1421 |
| 389 | Ga0496104_0120564 | 3300048907 | Bacteria | 2518 |
| 390 | Ga0496104_0872054 | 3300048907 | Bacteria | 805 |
| 391 | Ga0496107_0170109 | 3300048910 | Bacteria | 1617 |
| 392 | Ga0496108_0000106 | 3300048911 | Bacteria | 87028 |
| 393 | Ga0496109_0000133 | 3300048912 | Bacteria | 76299 |
| 394 | Ga0496109_0492491 | 3300048912 | Bacteria | 1157 |
| 395 | Ga0496110_0013287 | 3300048913 | Bacteria | 6801 |
| 396 | Ga0496111_0017707 | 3300048914 | Bacteria | 4927 |
| 397 | Ga0496112_0000028 | 3300048915 | Bacteria | 130942 |
| 398 | Ga0496112_0015337 | 3300048915 | Bacteria | 7146 |
| 399 | Ga0496112_0517896 | 3300048915 | Bacteria | 1127 |
| 400 | Ga0496112_1079627 | 3300048915 | Bacteria | 721 |
| 401 | Ga0496113_0000995 | 3300048916 | Bacteria | 15184 |
| 402 | Ga0496113_0557678 | 3300048916 | Bacteria | 919 |
| 403 | Ga0496115_0231379 | 3300048918 | Unclassified | 1524 |
| 404 | Ga0495678_010336 | 3300049459 | Bacteria | 4544 |
| 405 | Ga0495678_030279 | 3300049459 | Bacteria | 2265 |
| 406 | Ga0495682_0000618 | 3300049460 | Bacteria | 23926 |
| 407 | Ga0501034_0009998 | 3300049571 | Bacteria | 9911 |
| 408 | Ga0501040_0621062 | 3300049576 | Bacteria | 781 |
| 409 | Ga0501042_0738121 | 3300049578 | Unclassified | 716 |
| 410 | Ga0501043_0450665 | 3300049579 | Bacteria | 967 |
| 411 | Ga0501043_0600115 | 3300049579 | Bacteria | 813 |
| 412 | Ga0501076_1741263 | 3300049592 | Bacteria | 511 |
| 413 | Ga0501079_0569624 | 3300049741 | Bacteria | 891 |
| 414 | Ga0501080_0697057 | 3300049742 | Bacteria | 896 |
| 415 | Ga0501081_0847376 | 3300049743 | Unclassified | 688 |
| 416 | Ga0501035_0667677 | 3300049822 | Unclassified | 841 |
| 417 | Ga0501044_0001789 | 3300049823 | Bacteria | 25105 |
| 418 | Ga0501044_0038067 | 3300049823 | Bacteria | 5023 |
| 419 | nmdc:mga0yw44_1147799_c1 | 3300050492 | Bacteria | 524 |
| 420 | nmdc:mga0k408_590299_c1 | 3300050493 | Bacteria | 655 |
| 421 | nmdc:mga05p37_196485_c1 | 3300050507 | Unclassified | 2446 |
| 422 | nmdc:mga0qj67_158445_c1 | 3300050509 | Bacteria | 1838 |
| 423 | nmdc:mga06r32_580211_c1 | 3300050510 | Unclassified | 1093 |
| 424 | nmdc:mga0n895_1577688_c1 | 3300050512 | Unclassified | 621 |
| 425 | nmdc:mga0n895_871195_c1 | 3300050512 | Bacteria | 887 |
| 426 | nmdc:mga08x19_4_c1 | 3300050514 | Bacteria | 335979 |
| 427 | Ga0495601_0019536 | 3300053077 | Bacteria | 4133 |
| 428 | Ga0495601_0165505 | 3300053077 | Bacteria | 1445 |
| 429 | Ga0500610_0004362 | 3300053079 | Bacteria | 5604 |
| 430 | Ga0495595_0051669 | 3300053084 | Bacteria | 1905 |
| 431 | Ga0495619_0150534 | 3300053085 | Bacteria | 1605 |
| 432 | Ga0500646_0152729 | 3300053090 | Bacteria | 765 |
| 433 | Ga0500557_002820 | 3300053105 | Bacteria | 3296 |
| 434 | Ga0500569_001301 | 3300053109 | Bacteria | 4666 |
| 435 | Ga0500594_0001591 | 3300053118 | Bacteria | 4947 |
| 436 | Ga0500568_0001773 | 3300053139 | Bacteria | 13311 |
| 437 | Ga0500577_0103478 | 3300053142 | Bacteria | 1167 |
| 438 | Ga0500616_0006243 | 3300053153 | Bacteria | 7856 |
| 439 | Ga0500645_012720 | 3300053730 | Bacteria | 2716 |
| 440 | Ga0501082_0106472 | 3300060353 | Bacteria | 2426 |
| 441 | Ga0530510_0112621 | 3300061734 | Bacteria | 1994 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0231379 | Ga0496115_0231379_516_983 | 144 |
| 2 | 3300005445 | Ga0070708_100015673 | Ga0070708_1000156733 | 146 |
| 3 | 3300007265 | Ga0099794_10225163 | Ga0099794_102251632 | 146 |
| 4 | 3300027671 | Ga0209588_1025866 | Ga0209588_10258662 | 146 |
| 5 | 3300006844 | Ga0075428_100224357 | Ga0075428_1002243572 | 147 |
| 6 | 3300006847 | Ga0075431_100260686 | Ga0075431_1002606863 | 147 |
| 7 | 3300021361 | Ga0213872_10002098 | Ga0213872_100020987 | 147 |
| 8 | 3300039447 | Ga0436361_0610116 | Ga0436361_0610116_138197_138643 | 147 |
| 9 | 3300044712 | Ga0453684_0191495 | Ga0453684_0191495_683_1168 | 147 |
| 10 | 3300044712 | Ga0453684_1409067 | Ga0453684_1409067_206_652 | 147 |
| 11 | 3300046474 | Ga0495605_0002378 | Ga0495605_0002378_4490_4990 | 147 |
| 12 | 3300046492 | Ga0495585_0012917 | Ga0495585_0012917_522_1022 | 147 |
| 13 | 3300046501 | Ga0495607_0089425 | Ga0495607_0089425_52_552 | 147 |
| 14 | 3300046506 | Ga0495583_0009228 | Ga0495583_0009228_1201_1701 | 147 |
| 15 | 3300046513 | Ga0495616_0013399 | Ga0495616_0013399_179_679 | 147 |
| 16 | 3300046522 | Ga0495643_0106577 | Ga0495643_0106577_258_758 | 147 |
| 17 | 3300046530 | Ga0495654_0125879 | Ga0495654_0125879_47_547 | 147 |
| 18 | 3300046616 | Ga0495668_0009894 | Ga0495668_0009894_4317_4817 | 147 |
| 19 | 3300046660 | Ga0495625_0004833 | Ga0495625_0004833_4200_4700 | 147 |
| 20 | 3300046691 | Ga0495670_0024908 | Ga0495670_0024908_2364_2864 | 147 |
| 21 | 3300047318 | Ga0495636_0011888 | Ga0495636_0011888_2157_2657 | 147 |
| 22 | 3300047320 | Ga0495672_0020129 | Ga0495672_0020129_3326_3826 | 147 |
| 23 | 3300047323 | Ga0495683_0138362 | Ga0495683_0138362_379_879 | 147 |
| 24 | 3300049579 | Ga0501043_0450665 | Ga0501043_0450665_332_778 | 147 |
| 25 | 3300050510 | nmdc:mga06r32_580211_c1 | nmdc:mga06r32_580211_c1_140_583 | 147 |
| 26 | 3300053079 | Ga0500610_0004362 | Ga0500610_0004362_2180_2680 | 147 |
| 27 | 3300053090 | Ga0500646_0152729 | Ga0500646_0152729_105_548 | 147 |
| 28 | 3300053105 | Ga0500557_002820 | Ga0500557_002820_2131_2631 | 147 |
| 29 | 3300053109 | Ga0500569_001301 | Ga0500569_001301_318_818 | 147 |
| 30 | 3300053118 | Ga0500594_0001591 | Ga0500594_0001591_3630_4130 | 147 |
| 31 | 3300053139 | Ga0500568_0001773 | Ga0500568_0001773_4375_4875 | 147 |
| 32 | 3300053142 | Ga0500577_0103478 | Ga0500577_0103478_376_876 | 147 |
| 33 | 3300053153 | Ga0500616_0006243 | Ga0500616_0006243_2664_3164 | 147 |
| 34 | 3300053730 | Ga0500645_012720 | Ga0500645_012720_760_1260 | 147 |
| 35 | 3300005347 | Ga0070668_100916639 | Ga0070668_1009166392 | 148 |
| 36 | 3300005548 | Ga0070665_100413990 | Ga0070665_1004139903 | 148 |
| 37 | 3300006175 | Ga0070712_100359826 | Ga0070712_1003598263 | 148 |
| 38 | 3300006175 | Ga0070712_101368037 | Ga0070712_1013680371 | 148 |
| 39 | 3300011119 | Ga0105246_10434166 | Ga0105246_104341662 | 148 |
| 40 | 3300013105 | Ga0157369_10385870 | Ga0157369_103858702 | 148 |
| 41 | 3300025972 | Ga0207668_10980676 | Ga0207668_109806762 | 148 |
| 42 | 3300026121 | Ga0207683_10491340 | Ga0207683_104913402 | 148 |
| 43 | 3300028379 | Ga0268266_10405568 | Ga0268266_104055682 | 148 |
| 44 | 3300039450 | Ga0436363_1436362 | Ga0436363_1436362_6955_7401 | 148 |
| 45 | 3300045976 | Ga0466967_0319766 | Ga0466967_0319766_342_791 | 148 |
| 46 | 3300046460 | Ga0495638_0000027 | Ga0495638_0000027_298695_299141 | 148 |
| 47 | 3300046471 | Ga0495650_0002685 | Ga0495650_0002685_2743_3189 | 148 |
| 48 | 3300046475 | Ga0495639_0081276 | Ga0495639_0081276_91_537 | 148 |
| 49 | 3300046506 | Ga0495583_0000006 | Ga0495583_0000006_252354_252800 | 148 |
| 50 | 3300046512 | Ga0495610_0011813 | Ga0495610_0011813_4776_5246 | 148 |
| 51 | 3300046522 | Ga0495643_0000117 | Ga0495643_0000117_126362_126808 | 148 |
| 52 | 3300046524 | Ga0495648_0000078 | Ga0495648_0000078_29999_30445 | 148 |
| 53 | 3300046528 | Ga0495642_0001450 | Ga0495642_0001450_6819_7265 | 148 |
| 54 | 3300046538 | Ga0495609_0026791 | Ga0495609_0026791_2111_2557 | 148 |
| 55 | 3300046542 | Ga0495597_0002247 | Ga0495597_0002247_3575_4021 | 148 |
| 56 | 3300046557 | Ga0495622_0000281 | Ga0495622_0000281_34579_35025 | 148 |
| 57 | 3300046558 | Ga0495633_0000375 | Ga0495633_0000375_1646_2092 | 148 |
| 58 | 3300046660 | Ga0495625_0000516 | Ga0495625_0000516_2888_3334 | 148 |
| 59 | 3300046665 | Ga0495661_0500893 | Ga0495661_0500893_72_518 | 148 |
| 60 | 3300046694 | Ga0495649_0175412 | Ga0495649_0175412_365_811 | 148 |
| 61 | 3300046810 | Ga0495660_0028483 | Ga0495660_0028483_1786_2232 | 148 |
| 62 | 3300047445 | Ga0495677_0036945 | Ga0495677_0036945_184_630 | 148 |
| 63 | 3300049459 | Ga0495678_030279 | Ga0495678_030279_543_989 | 148 |
| 64 | 3300050492 | nmdc:mga0yw44_1147799_c1 | nmdc:mga0yw44_1147799_c1_54_500 | 148 |
| 65 | 3300050493 | nmdc:mga0k408_590299_c1 | nmdc:mga0k408_590299_c1_54_500 | 148 |
| 66 | 3300005444 | Ga0070694_100293331 | Ga0070694_1002933312 | 149 |
| 67 | 3300005468 | Ga0070707_100068411 | Ga0070707_1000684113 | 149 |
| 68 | 3300005471 | Ga0070698_100512194 | Ga0070698_1005121942 | 149 |
| 69 | 3300005549 | Ga0070704_100199300 | Ga0070704_1001993003 | 149 |
| 70 | 3300005983 | Ga0081540_1003469 | Ga0081540_10034698 | 149 |
| 71 | 3300013296 | Ga0157374_10669765 | Ga0157374_106697652 | 149 |
| 72 | 3300025922 | Ga0207646_10061740 | Ga0207646_100617404 | 149 |
| 73 | 3300025927 | Ga0207687_10958481 | Ga0207687_109584812 | 149 |
| 74 | 3300026067 | Ga0207678_11226727 | Ga0207678_112267272 | 149 |
| 75 | 3300032002 | Ga0307416_103454715 | Ga0307416_1034547151 | 149 |
| 76 | 3300002459 | JGI24751J29686_10005084 | JGI24751J29686_100050846 | 150 |
| 77 | 3300002459 | JGI24751J29686_10014465 | JGI24751J29686_100144652 | 150 |
| 78 | 3300005295 | Ga0065707_10257162 | Ga0065707_102571621 | 150 |
| 79 | 3300005328 | Ga0070676_10009166 | Ga0070676_100091662 | 150 |
| 80 | 3300005329 | Ga0070683_100009510 | Ga0070683_1000095106 | 150 |
| 81 | 3300005329 | Ga0070683_100030032 | Ga0070683_1000300324 | 150 |
| 82 | 3300005331 | Ga0070670_100044700 | Ga0070670_1000447004 | 150 |
| 83 | 3300005333 | Ga0070677_10004905 | Ga0070677_100049053 | 150 |
| 84 | 3300005335 | Ga0070666_10038869 | Ga0070666_100388694 | 150 |
| 85 | 3300005336 | Ga0070680_100063564 | Ga0070680_1000635641 | 150 |
| 86 | 3300005337 | Ga0070682_100018425 | Ga0070682_1000184252 | 150 |
| 87 | 3300005338 | Ga0068868_100040845 | Ga0068868_1000408456 | 150 |
| 88 | 3300005339 | Ga0070660_100006201 | Ga0070660_1000062017 | 150 |
| 89 | 3300005339 | Ga0070660_100019860 | Ga0070660_1000198602 | 150 |
| 90 | 3300005340 | Ga0070689_100046796 | Ga0070689_1000467966 | 150 |
| 91 | 3300005340 | Ga0070689_100060016 | Ga0070689_1000600166 | 150 |
| 92 | 3300005344 | Ga0070661_100001498 | Ga0070661_10000149811 | 150 |
| 93 | 3300005347 | Ga0070668_100010882 | Ga0070668_1000108826 | 150 |
| 94 | 3300005347 | Ga0070668_101090624 | Ga0070668_1010906241 | 150 |
| 95 | 3300005354 | Ga0070675_100186470 | Ga0070675_1001864702 | 150 |
| 96 | 3300005354 | Ga0070675_100587538 | Ga0070675_1005875381 | 150 |
| 97 | 3300005355 | Ga0070671_100024164 | Ga0070671_1000241646 | 150 |
| 98 | 3300005356 | Ga0070674_100145632 | Ga0070674_1001456322 | 150 |
| 99 | 3300005364 | Ga0070673_100001087 | Ga0070673_10000108714 | 150 |
| 100 | 3300005364 | Ga0070673_100248514 | Ga0070673_1002485141 | 150 |
| 101 | 3300005365 | Ga0070688_100007808 | Ga0070688_1000078087 | 150 |
| 102 | 3300005366 | Ga0070659_100002865 | Ga0070659_10000286512 | 150 |
| 103 | 3300005366 | Ga0070659_100007686 | Ga0070659_1000076866 | 150 |
| 104 | 3300005367 | Ga0070667_100072920 | Ga0070667_1000729201 | 150 |
| 105 | 3300005436 | Ga0070713_100040155 | Ga0070713_1000401556 | 150 |
| 106 | 3300005436 | Ga0070713_100060843 | Ga0070713_1000608431 | 150 |
| 107 | 3300005436 | Ga0070713_100169028 | Ga0070713_1001690282 | 150 |
| 108 | 3300005436 | Ga0070713_100332795 | Ga0070713_1003327953 | 150 |
| 109 | 3300005436 | Ga0070713_100453578 | Ga0070713_1004535782 | 150 |
| 110 | 3300005436 | Ga0070713_100556899 | Ga0070713_1005568991 | 150 |
| 111 | 3300005436 | Ga0070713_101620079 | Ga0070713_1016200791 | 150 |
| 112 | 3300005436 | Ga0070713_101650956 | Ga0070713_1016509561 | 150 |
| 113 | 3300005437 | Ga0070710_10004818 | Ga0070710_100048186 | 150 |
| 114 | 3300005437 | Ga0070710_10082774 | Ga0070710_100827743 | 150 |
| 115 | 3300005437 | Ga0070710_10293952 | Ga0070710_102939521 | 150 |
| 116 | 3300005439 | Ga0070711_100003446 | Ga0070711_1000034462 | 150 |
| 117 | 3300005439 | Ga0070711_100040604 | Ga0070711_1000406042 | 150 |
| 118 | 3300005439 | Ga0070711_100284307 | Ga0070711_1002843072 | 150 |
| 119 | 3300005441 | Ga0070700_100050107 | Ga0070700_1000501076 | 150 |
| 120 | 3300005445 | Ga0070708_100016628 | Ga0070708_1000166286 | 150 |
| 121 | 3300005455 | Ga0070663_100009736 | Ga0070663_1000097367 | 150 |
| 122 | 3300005455 | Ga0070663_100049907 | Ga0070663_1000499073 | 150 |
| 123 | 3300005457 | Ga0070662_100417385 | Ga0070662_1004173852 | 150 |
| 124 | 3300005459 | Ga0068867_100751228 | Ga0068867_1007512282 | 150 |
| 125 | 3300005467 | Ga0070706_100143206 | Ga0070706_1001432064 | 150 |
| 126 | 3300005467 | Ga0070706_101275022 | Ga0070706_1012750221 | 150 |
| 127 | 3300005468 | Ga0070707_100338886 | Ga0070707_1003388862 | 150 |
| 128 | 3300005468 | Ga0070707_100968455 | Ga0070707_1009684551 | 150 |
| 129 | 3300005471 | Ga0070698_100048074 | Ga0070698_1000480749 | 150 |
| 130 | 3300005518 | Ga0070699_100182210 | Ga0070699_1001822104 | 150 |
| 131 | 3300005518 | Ga0070699_101178146 | Ga0070699_1011781461 | 150 |
| 132 | 3300005530 | Ga0070679_100027842 | Ga0070679_1000278423 | 150 |
| 133 | 3300005530 | Ga0070679_100784427 | Ga0070679_1007844271 | 150 |
| 134 | 3300005535 | Ga0070684_100002226 | Ga0070684_10000222610 | 150 |
| 135 | 3300005536 | Ga0070697_100001384 | Ga0070697_10000138417 | 150 |
| 136 | 3300005536 | Ga0070697_100009949 | Ga0070697_1000099494 | 150 |
| 137 | 3300005536 | Ga0070697_100063082 | Ga0070697_1000630822 | 150 |
| 138 | 3300005536 | Ga0070697_100254926 | Ga0070697_1002549263 | 150 |
| 139 | 3300005536 | Ga0070697_100263616 | Ga0070697_1002636162 | 150 |
| 140 | 3300005536 | Ga0070697_100356344 | Ga0070697_1003563442 | 150 |
| 141 | 3300005539 | Ga0068853_100015249 | Ga0068853_1000152495 | 150 |
| 142 | 3300005539 | Ga0068853_100259953 | Ga0068853_1002599532 | 150 |
| 143 | 3300005543 | Ga0070672_100095863 | Ga0070672_1000958634 | 150 |
| 144 | 3300005546 | Ga0070696_100939849 | Ga0070696_1009398492 | 150 |
| 145 | 3300005548 | Ga0070665_100073264 | Ga0070665_1000732645 | 150 |
| 146 | 3300005549 | Ga0070704_100045073 | Ga0070704_1000450731 | 150 |
| 147 | 3300005564 | Ga0070664_100082092 | Ga0070664_1000820923 | 150 |
| 148 | 3300005564 | Ga0070664_100219070 | Ga0070664_1002190702 | 150 |
| 149 | 3300005577 | Ga0068857_100009135 | Ga0068857_1000091356 | 150 |
| 150 | 3300005577 | Ga0068857_100069490 | Ga0068857_1000694903 | 150 |
| 151 | 3300005578 | Ga0068854_100175959 | Ga0068854_1001759592 | 150 |
| 152 | 3300005614 | Ga0068856_100067957 | Ga0068856_1000679571 | 150 |
| 153 | 3300005618 | Ga0068864_100036188 | Ga0068864_1000361882 | 150 |
| 154 | 3300005618 | Ga0068864_101077040 | Ga0068864_1010770402 | 150 |
| 155 | 3300005719 | Ga0068861_100446075 | Ga0068861_1004460752 | 150 |
| 156 | 3300005840 | Ga0068870_10000755 | Ga0068870_100007554 | 150 |
| 157 | 3300005841 | Ga0068863_100044634 | Ga0068863_1000446342 | 150 |
| 158 | 3300005842 | Ga0068858_100026991 | Ga0068858_1000269911 | 150 |
| 159 | 3300005844 | Ga0068862_100064421 | Ga0068862_1000644216 | 150 |
| 160 | 3300005937 | Ga0081455_10036738 | Ga0081455_100367385 | 150 |
| 161 | 3300006028 | Ga0070717_10014993 | Ga0070717_100149938 | 150 |
| 162 | 3300006028 | Ga0070717_10031233 | Ga0070717_100312332 | 150 |
| 163 | 3300006028 | Ga0070717_10187352 | Ga0070717_101873521 | 150 |
| 164 | 3300006028 | Ga0070717_10609569 | Ga0070717_106095692 | 150 |
| 165 | 3300006028 | Ga0070717_12019967 | Ga0070717_120199671 | 150 |
| 166 | 3300006163 | Ga0070715_10133740 | Ga0070715_101337401 | 150 |
| 167 | 3300006175 | Ga0070712_100005454 | Ga0070712_1000054548 | 150 |
| 168 | 3300006175 | Ga0070712_100017935 | Ga0070712_1000179356 | 150 |
| 169 | 3300006175 | Ga0070712_100072116 | Ga0070712_1000721165 | 150 |
| 170 | 3300006358 | Ga0068871_100282919 | Ga0068871_1002829191 | 150 |
| 171 | 3300006844 | Ga0075428_100814256 | Ga0075428_1008142562 | 150 |
| 172 | 3300006846 | Ga0075430_100091596 | Ga0075430_1000915962 | 150 |
| 173 | 3300006847 | Ga0075431_100077120 | Ga0075431_1000771205 | 150 |
| 174 | 3300006871 | Ga0075434_101011235 | Ga0075434_1010112352 | 150 |
| 175 | 3300006871 | Ga0075434_102118194 | Ga0075434_1021181941 | 150 |
| 176 | 3300006880 | Ga0075429_100092627 | Ga0075429_1000926273 | 150 |
| 177 | 3300006914 | Ga0075436_100000321 | Ga0075436_1000003215 | 150 |
| 178 | 3300006914 | Ga0075436_100668413 | Ga0075436_1006684131 | 150 |
| 179 | 3300007788 | Ga0099795_10030663 | Ga0099795_100306633 | 150 |
| 180 | 3300007788 | Ga0099795_10097459 | Ga0099795_100974592 | 150 |
| 181 | 3300009011 | Ga0105251_10238950 | Ga0105251_102389502 | 150 |
| 182 | 3300009092 | Ga0105250_10024956 | Ga0105250_100249562 | 150 |
| 183 | 3300009093 | Ga0105240_10070392 | Ga0105240_100703925 | 150 |
| 184 | 3300009098 | Ga0105245_10034123 | Ga0105245_100341232 | 150 |
| 185 | 3300009101 | Ga0105247_10003532 | Ga0105247_100035325 | 150 |
| 186 | 3300009101 | Ga0105247_10481916 | Ga0105247_104819162 | 150 |
| 187 | 3300009147 | Ga0114129_10117356 | Ga0114129_101173562 | 150 |
| 188 | 3300009147 | Ga0114129_10121514 | Ga0114129_101215142 | 150 |
| 189 | 3300009174 | Ga0105241_10006132 | Ga0105241_100061325 | 150 |
| 190 | 3300009174 | Ga0105241_10630258 | Ga0105241_106302582 | 150 |
| 191 | 3300009176 | Ga0105242_10008370 | Ga0105242_100083708 | 150 |
| 192 | 3300009176 | Ga0105242_12160180 | Ga0105242_121601801 | 150 |
| 193 | 3300009177 | Ga0105248_10195090 | Ga0105248_101950903 | 150 |
| 194 | 3300009177 | Ga0105248_10736007 | Ga0105248_107360072 | 150 |
| 195 | 3300009545 | Ga0105237_10014537 | Ga0105237_100145378 | 150 |
| 196 | 3300009551 | Ga0105238_10053880 | Ga0105238_100538803 | 150 |
| 197 | 3300009553 | Ga0105249_10019268 | Ga0105249_100192684 | 150 |
| 198 | 3300010159 | Ga0099796_10130796 | Ga0099796_101307962 | 150 |
| 199 | 3300010375 | Ga0105239_10095401 | Ga0105239_100954012 | 150 |
| 200 | 3300010375 | Ga0105239_10270785 | Ga0105239_102707853 | 150 |
| 201 | 3300011119 | Ga0105246_10006758 | Ga0105246_100067587 | 150 |
| 202 | 3300011119 | Ga0105246_10943746 | Ga0105246_109437461 | 150 |
| 203 | 3300013100 | Ga0157373_10181883 | Ga0157373_101818832 | 150 |
| 204 | 3300013102 | Ga0157371_10547879 | Ga0157371_105478792 | 150 |
| 205 | 3300013104 | Ga0157370_10027606 | Ga0157370_100276066 | 150 |
| 206 | 3300013104 | Ga0157370_10888772 | Ga0157370_108887722 | 150 |
| 207 | 3300013105 | Ga0157369_10019003 | Ga0157369_100190037 | 150 |
| 208 | 3300013105 | Ga0157369_10023099 | Ga0157369_100230995 | 150 |
| 209 | 3300013105 | Ga0157369_10098030 | Ga0157369_100980303 | 150 |
| 210 | 3300013306 | Ga0163162_11181364 | Ga0163162_111813642 | 150 |
| 211 | 3300013307 | Ga0157372_10044713 | Ga0157372_100447134 | 150 |
| 212 | 3300014325 | Ga0163163_10520975 | Ga0163163_105209752 | 150 |
| 213 | 3300014325 | Ga0163163_12295052 | Ga0163163_122950521 | 150 |
| 214 | 3300014325 | Ga0163163_12295054 | Ga0163163_122950541 | 150 |
| 215 | 3300014968 | Ga0157379_10131451 | Ga0157379_101314515 | 150 |
| 216 | 3300014968 | Ga0157379_10404800 | Ga0157379_104048001 | 150 |
| 217 | 3300014969 | Ga0157376_10033432 | Ga0157376_100334324 | 150 |
| 218 | 3300014969 | Ga0157376_12160791 | Ga0157376_121607911 | 150 |
| 219 | 3300017792 | Ga0163161_10098096 | Ga0163161_100980961 | 150 |
| 220 | 3300021361 | Ga0213872_10059704 | Ga0213872_100597043 | 150 |
| 221 | 3300021384 | Ga0213876_10014903 | Ga0213876_100149032 | 150 |
| 222 | 3300021388 | Ga0213875_10000033 | Ga0213875_1000003390 | 150 |
| 223 | 3300021441 | Ga0213871_10012232 | Ga0213871_100122321 | 150 |
| 224 | 3300022732 | Ga0224569_100743 | Ga0224569_1007431 | 150 |
| 225 | 3300022734 | Ga0224571_100336 | Ga0224571_1003363 | 150 |
| 226 | 3300024225 | Ga0224572_1011182 | Ga0224572_10111822 | 150 |
| 227 | 3300024227 | Ga0228598_1001241 | Ga0228598_10012413 | 150 |
| 228 | 3300024227 | Ga0228598_1013386 | Ga0228598_10133863 | 150 |
| 229 | 3300025315 | Ga0207697_10022941 | Ga0207697_100229412 | 150 |
| 230 | 3300025321 | Ga0207656_10013992 | Ga0207656_100139922 | 150 |
| 231 | 3300025893 | Ga0207682_10003265 | Ga0207682_100032655 | 150 |
| 232 | 3300025898 | Ga0207692_10039509 | Ga0207692_100395093 | 150 |
| 233 | 3300025898 | Ga0207692_10069329 | Ga0207692_100693292 | 150 |
| 234 | 3300025898 | Ga0207692_10545451 | Ga0207692_105454511 | 150 |
| 235 | 3300025899 | Ga0207642_10134641 | Ga0207642_101346412 | 150 |
| 236 | 3300025900 | Ga0207710_10065493 | Ga0207710_100654931 | 150 |
| 237 | 3300025901 | Ga0207688_10002862 | Ga0207688_100028628 | 150 |
| 238 | 3300025904 | Ga0207647_10008037 | Ga0207647_100080374 | 150 |
| 239 | 3300025906 | Ga0207699_10092593 | Ga0207699_100925932 | 150 |
| 240 | 3300025906 | Ga0207699_10171097 | Ga0207699_101710971 | 150 |
| 241 | 3300025907 | Ga0207645_10000892 | Ga0207645_1000089212 | 150 |
| 242 | 3300025908 | Ga0207643_10000476 | Ga0207643_1000047612 | 150 |
| 243 | 3300025909 | Ga0207705_10001124 | Ga0207705_1000112413 | 150 |
| 244 | 3300025910 | Ga0207684_10003341 | Ga0207684_1000334115 | 150 |
| 245 | 3300025910 | Ga0207684_10077844 | Ga0207684_100778441 | 150 |
| 246 | 3300025913 | Ga0207695_10491094 | Ga0207695_104910942 | 150 |
| 247 | 3300025914 | Ga0207671_10161045 | Ga0207671_101610452 | 150 |
| 248 | 3300025915 | Ga0207693_10000039 | Ga0207693_1000003944 | 150 |
| 249 | 3300025915 | Ga0207693_10013298 | Ga0207693_100132986 | 150 |
| 250 | 3300025915 | Ga0207693_10033413 | Ga0207693_100334133 | 150 |
| 251 | 3300025915 | Ga0207693_10117615 | Ga0207693_101176151 | 150 |
| 252 | 3300025916 | Ga0207663_10012145 | Ga0207663_100121454 | 150 |
| 253 | 3300025916 | Ga0207663_10085447 | Ga0207663_100854472 | 150 |
| 254 | 3300025916 | Ga0207663_10185369 | Ga0207663_101853694 | 150 |
| 255 | 3300025916 | Ga0207663_10216457 | Ga0207663_102164571 | 150 |
| 256 | 3300025917 | Ga0207660_10327095 | Ga0207660_103270953 | 150 |
| 257 | 3300025918 | Ga0207662_10008767 | Ga0207662_100087672 | 150 |
| 258 | 3300025919 | Ga0207657_10002508 | Ga0207657_1000250810 | 150 |
| 259 | 3300025919 | Ga0207657_10003733 | Ga0207657_100037337 | 150 |
| 260 | 3300025920 | Ga0207649_10001149 | Ga0207649_100011499 | 150 |
| 261 | 3300025921 | Ga0207652_10010031 | Ga0207652_100100313 | 150 |
| 262 | 3300025922 | Ga0207646_10285282 | Ga0207646_102852821 | 150 |
| 263 | 3300025923 | Ga0207681_10419850 | Ga0207681_104198502 | 150 |
| 264 | 3300025925 | Ga0207650_10000072 | Ga0207650_10000072103 | 150 |
| 265 | 3300025925 | Ga0207650_10000078 | Ga0207650_1000007815 | 150 |
| 266 | 3300025925 | Ga0207650_10006965 | Ga0207650_100069659 | 150 |
| 267 | 3300025926 | Ga0207659_10050481 | Ga0207659_100504812 | 150 |
| 268 | 3300025926 | Ga0207659_10271213 | Ga0207659_102712132 | 150 |
| 269 | 3300025927 | Ga0207687_10038254 | Ga0207687_100382543 | 150 |
| 270 | 3300025928 | Ga0207700_10322430 | Ga0207700_103224302 | 150 |
| 271 | 3300025928 | Ga0207700_10580697 | Ga0207700_105806971 | 150 |
| 272 | 3300025928 | Ga0207700_11795537 | Ga0207700_117955371 | 150 |
| 273 | 3300025929 | Ga0207664_10046447 | Ga0207664_100464475 | 150 |
| 274 | 3300025931 | Ga0207644_10027302 | Ga0207644_100273026 | 150 |
| 275 | 3300025932 | Ga0207690_10049040 | Ga0207690_100490401 | 150 |
| 276 | 3300025932 | Ga0207690_11861343 | Ga0207690_118613431 | 150 |
| 277 | 3300025933 | Ga0207706_10011756 | Ga0207706_100117562 | 150 |
| 278 | 3300025934 | Ga0207686_11668847 | Ga0207686_116688471 | 150 |
| 279 | 3300025936 | Ga0207670_10026176 | Ga0207670_100261763 | 150 |
| 280 | 3300025936 | Ga0207670_10030833 | Ga0207670_100308331 | 150 |
| 281 | 3300025937 | Ga0207669_10865814 | Ga0207669_108658141 | 150 |
| 282 | 3300025938 | Ga0207704_10598809 | Ga0207704_105988091 | 150 |
| 283 | 3300025939 | Ga0207665_10251126 | Ga0207665_102511263 | 150 |
| 284 | 3300025940 | Ga0207691_10002536 | Ga0207691_100025363 | 150 |
| 285 | 3300025940 | Ga0207691_10014478 | Ga0207691_100144782 | 150 |
| 286 | 3300025941 | Ga0207711_10293395 | Ga0207711_102933952 | 150 |
| 287 | 3300025942 | Ga0207689_10001721 | Ga0207689_1000172113 | 150 |
| 288 | 3300025944 | Ga0207661_10001517 | Ga0207661_100015175 | 150 |
| 289 | 3300025944 | Ga0207661_10482105 | Ga0207661_104821051 | 150 |
| 290 | 3300025945 | Ga0207679_10001269 | Ga0207679_1000126915 | 150 |
| 291 | 3300025949 | Ga0207667_10081714 | Ga0207667_100817142 | 150 |
| 292 | 3300025960 | Ga0207651_10046487 | Ga0207651_100464873 | 150 |
| 293 | 3300025960 | Ga0207651_10090765 | Ga0207651_100907655 | 150 |
| 294 | 3300025961 | Ga0207712_10349453 | Ga0207712_103494532 | 150 |
| 295 | 3300025972 | Ga0207668_10760113 | Ga0207668_107601131 | 150 |
| 296 | 3300025981 | Ga0207640_10323261 | Ga0207640_103232611 | 150 |
| 297 | 3300025986 | Ga0207658_10022736 | Ga0207658_100227361 | 150 |
| 298 | 3300026023 | Ga0207677_10025406 | Ga0207677_100254063 | 150 |
| 299 | 3300026035 | Ga0207703_10491149 | Ga0207703_104911493 | 150 |
| 300 | 3300026035 | Ga0207703_11711796 | Ga0207703_117117961 | 150 |
| 301 | 3300026041 | Ga0207639_10030286 | Ga0207639_100302862 | 150 |
| 302 | 3300026041 | Ga0207639_10193836 | Ga0207639_101938363 | 150 |
| 303 | 3300026067 | Ga0207678_10005634 | Ga0207678_100056342 | 150 |
| 304 | 3300026067 | Ga0207678_10007353 | Ga0207678_100073539 | 150 |
| 305 | 3300026088 | Ga0207641_10000237 | Ga0207641_1000023760 | 150 |
| 306 | 3300026088 | Ga0207641_10058198 | Ga0207641_100581982 | 150 |
| 307 | 3300026089 | Ga0207648_10002084 | Ga0207648_1000208416 | 150 |
| 308 | 3300026095 | Ga0207676_10000050 | Ga0207676_10000050103 | 150 |
| 309 | 3300026116 | Ga0207674_10000130 | Ga0207674_1000013074 | 150 |
| 310 | 3300026116 | Ga0207674_10000408 | Ga0207674_100004086 | 150 |
| 311 | 3300026118 | Ga0207675_100020881 | Ga0207675_1000208815 | 150 |
| 312 | 3300026121 | Ga0207683_10009014 | Ga0207683_100090143 | 150 |
| 313 | 3300026142 | Ga0207698_10123528 | Ga0207698_101235285 | 150 |
| 314 | 3300027512 | Ga0209179_1000496 | Ga0209179_10004966 | 150 |
| 315 | 3300028379 | Ga0268266_10033326 | Ga0268266_100333262 | 150 |
| 316 | 3300028379 | Ga0268266_10033937 | Ga0268266_100339375 | 150 |
| 317 | 3300028381 | Ga0268264_10680701 | Ga0268264_106807012 | 150 |
| 318 | 3300028556 | Ga0265337_1000179 | Ga0265337_10001798 | 150 |
| 319 | 3300028800 | Ga0265338_10000339 | Ga0265338_1000033966 | 150 |
| 320 | 3300028800 | Ga0265338_10448982 | Ga0265338_104489822 | 150 |
| 321 | 3300029957 | Ga0265324_10001995 | Ga0265324_100019958 | 150 |
| 322 | 3300031240 | Ga0265320_10097711 | Ga0265320_100977112 | 150 |
| 323 | 3300031247 | Ga0265340_10002081 | Ga0265340_100020816 | 150 |
| 324 | 3300031548 | Ga0307408_100852196 | Ga0307408_1008521961 | 150 |
| 325 | 3300031595 | Ga0265313_10000165 | Ga0265313_1000016566 | 150 |
| 326 | 3300031712 | Ga0265342_10003307 | Ga0265342_100033072 | 150 |
| 327 | 3300035111 | Ga0373923_0058194 | Ga0373923_0058194_822_1328 | 150 |
| 328 | 3300035170 | Ga0373943_0084626 | Ga0373943_0084626_973_1434 | 150 |
| 329 | 3300035171 | Ga0373946_0464362 | Ga0373946_0464362_170_622 | 150 |
| 330 | 3300035172 | Ga0373955_0253693 | Ga0373955_0253693_592_1044 | 150 |
| 331 | 3300035692 | Ga0373935_0221866 | Ga0373935_0221866_532_984 | 150 |
| 332 | 3300035692 | Ga0373935_0297575 | Ga0373935_0297575_644_1105 | 150 |
| 333 | 3300035692 | Ga0373935_0358888 | Ga0373935_0358888_458_994 | 150 |
| 334 | 3300035724 | Ga0373933_0122986 | Ga0373933_0122986_1068_1520 | 150 |
| 335 | 3300035725 | Ga0373947_0033938 | Ga0373947_0033938_318_779 | 150 |
| 336 | 3300036401 | Ga0373937_1132750 | Ga0373937_1132750_38_490 | 150 |
| 337 | 3300037068 | Ga0373925_0097263 | Ga0373925_0097263_1377_1838 | 150 |
| 338 | 3300037068 | Ga0373925_0113349 | Ga0373925_0113349_766_1218 | 150 |
| 339 | 3300037068 | Ga0373925_0179341 | Ga0373925_0179341_850_1302 | 150 |
| 340 | 3300037471 | Ga0395905_1046863 | Ga0395905_1046863_197_649 | 150 |
| 341 | 3300037853 | Ga0436364_0046630 | Ga0436364_0046630_814_1266 | 150 |
| 342 | 3300037853 | Ga0436364_0540318 | Ga0436364_0540318_3880_4332 | 150 |
| 343 | 3300037853 | Ga0436364_1365438 | Ga0436364_1365438_936_1388 | 150 |
| 344 | 3300037853 | Ga0436364_1406452 | Ga0436364_1406452_6416_6868 | 150 |
| 345 | 3300037853 | Ga0436364_1416149 | Ga0436364_1416149_295_747 | 150 |
| 346 | 3300038443 | Ga0395901_0219380 | Ga0395901_0219380_1061_1513 | 150 |
| 347 | 3300039437 | Ga0436365_1863579 | Ga0436365_1863579_50332_50784 | 150 |
| 348 | 3300039438 | Ga0436360_1058374 | Ga0436360_1058374_1989_2441 | 150 |
| 349 | 3300039438 | Ga0436360_1116302 | Ga0436360_1116302_620_1072 | 150 |
| 350 | 3300039438 | Ga0436360_1199898 | Ga0436360_1199898_1429_1881 | 150 |
| 351 | 3300039447 | Ga0436361_0262657 | Ga0436361_0262657_335_787 | 150 |
| 352 | 3300039447 | Ga0436361_0374779 | Ga0436361_0374779_2022_2474 | 150 |
| 353 | 3300039447 | Ga0436361_0870398 | Ga0436361_0870398_43_495 | 150 |
| 354 | 3300039447 | Ga0436361_0999445 | Ga0436361_0999445_3126_3578 | 150 |
| 355 | 3300039450 | Ga0436363_0268987 | Ga0436363_0268987_24_485 | 150 |
| 356 | 3300039453 | Ga0436362_0156652 | Ga0436362_0156652_1686_2138 | 150 |
| 357 | 3300042461 | Ga0439460_0028478 | Ga0439460_0028478_646_1098 | 150 |
| 358 | 3300044706 | Ga0466964_0238671 | Ga0466964_0238671_167_619 | 150 |
| 359 | 3300045976 | Ga0466967_0361433 | Ga0466967_0361433_760_1212 | 150 |
| 360 | 3300046460 | Ga0495638_0061181 | Ga0495638_0061181_1471_1923 | 150 |
| 361 | 3300046463 | Ga0495653_0325051 | Ga0495653_0325051_493_975 | 150 |
| 362 | 3300046472 | Ga0495580_0056158 | Ga0495580_0056158_294_746 | 150 |
| 363 | 3300046472 | Ga0495580_0088262 | Ga0495580_0088262_624_1085 | 150 |
| 364 | 3300046474 | Ga0495605_0054246 | Ga0495605_0054246_496_948 | 150 |
| 365 | 3300046477 | Ga0495664_0253735 | Ga0495664_0253735_85_537 | 150 |
| 366 | 3300046492 | Ga0495585_0004923 | Ga0495585_0004923_5495_5947 | 150 |
| 367 | 3300046501 | Ga0495607_0123316 | Ga0495607_0123316_514_966 | 150 |
| 368 | 3300046506 | Ga0495583_0000396 | Ga0495583_0000396_41380_41832 | 150 |
| 369 | 3300046507 | Ga0495606_0008861 | Ga0495606_0008861_4323_4799 | 150 |
| 370 | 3300046511 | Ga0495608_0302633 | Ga0495608_0302633_210_716 | 150 |
| 371 | 3300046513 | Ga0495616_0137242 | Ga0495616_0137242_398_850 | 150 |
| 372 | 3300046514 | Ga0495618_0305023 | Ga0495618_0305023_192_653 | 150 |
| 373 | 3300046516 | Ga0495628_0134641 | Ga0495628_0134641_623_1162 | 150 |
| 374 | 3300046517 | Ga0495630_0075744 | Ga0495630_0075744_493_954 | 150 |
| 375 | 3300046523 | Ga0495644_0000647 | Ga0495644_0000647_12154_12606 | 150 |
| 376 | 3300046524 | Ga0495648_0001243 | Ga0495648_0001243_21564_22016 | 150 |
| 377 | 3300046528 | Ga0495642_0157862 | Ga0495642_0157862_281_748 | 150 |
| 378 | 3300046529 | Ga0495652_0192072 | Ga0495652_0192072_192_731 | 150 |
| 379 | 3300046533 | Ga0495640_0073852 | Ga0495640_0073852_810_1271 | 150 |
| 380 | 3300046538 | Ga0495609_0002623 | Ga0495609_0002623_5242_5694 | 150 |
| 381 | 3300046615 | Ga0495656_0025318 | Ga0495656_0025318_180_632 | 150 |
| 382 | 3300046616 | Ga0495668_0113904 | Ga0495668_0113904_595_1047 | 150 |
| 383 | 3300046642 | Ga0495634_0093720 | Ga0495634_0093720_916_1377 | 150 |
| 384 | 3300046642 | Ga0495634_0259016 | Ga0495634_0259016_513_1019 | 150 |
| 385 | 3300046648 | Ga0495611_0007573 | Ga0495611_0007573_2379_2831 | 150 |
| 386 | 3300046660 | Ga0495625_0052593 | Ga0495625_0052593_1574_2026 | 150 |
| 387 | 3300046664 | Ga0495659_0001042 | Ga0495659_0001042_3327_3779 | 150 |
| 388 | 3300046665 | Ga0495661_0015837 | Ga0495661_0015837_1738_2190 | 150 |
| 389 | 3300046689 | Ga0495613_0043935 | Ga0495613_0043935_40_501 | 150 |
| 390 | 3300046690 | Ga0495624_0173368 | Ga0495624_0173368_317_826 | 150 |
| 391 | 3300046690 | Ga0495624_0293465 | Ga0495624_0293465_248_709 | 150 |
| 392 | 3300046691 | Ga0495670_0002747 | Ga0495670_0002747_3329_3781 | 150 |
| 393 | 3300046809 | Ga0495600_0617384 | Ga0495600_0617384_27_533 | 150 |
| 394 | 3300047318 | Ga0495636_0007579 | Ga0495636_0007579_425_877 | 150 |
| 395 | 3300047319 | Ga0495674_0110274 | Ga0495674_0110274_978_1439 | 150 |
| 396 | 3300047319 | Ga0495674_0412734 | Ga0495674_0412734_215_754 | 150 |
| 397 | 3300047443 | Ga0495687_000587 | Ga0495687_000587_41463_41915 | 150 |
| 398 | 3300047445 | Ga0495677_0055329 | Ga0495677_0055329_489_941 | 150 |
| 399 | 3300047447 | Ga0495685_000078 | Ga0495685_000078_3611_4063 | 150 |
| 400 | 3300047471 | Ga0495684_0547817 | Ga0495684_0547817_16_498 | 150 |
| 401 | 3300048904 | Ga0496101_0253784 | Ga0496101_0253784_285_770 | 150 |
| 402 | 3300048905 | Ga0496102_0017201 | Ga0496102_0017201_1941_2402 | 150 |
| 403 | 3300048906 | Ga0496103_0165106 | Ga0496103_0165106_313_798 | 150 |
| 404 | 3300048907 | Ga0496104_0120564 | Ga0496104_0120564_1241_1702 | 150 |
| 405 | 3300048907 | Ga0496104_0872054 | Ga0496104_0872054_248_733 | 150 |
| 406 | 3300048910 | Ga0496107_0170109 | Ga0496107_0170109_687_1172 | 150 |
| 407 | 3300048911 | Ga0496108_0000106 | Ga0496108_0000106_7530_7991 | 150 |
| 408 | 3300048912 | Ga0496109_0000133 | Ga0496109_0000133_9399_9860 | 150 |
| 409 | 3300048912 | Ga0496109_0492491 | Ga0496109_0492491_88_573 | 150 |
| 410 | 3300048913 | Ga0496110_0013287 | Ga0496110_0013287_1583_2044 | 150 |
| 411 | 3300048914 | Ga0496111_0017707 | Ga0496111_0017707_1961_2422 | 150 |
| 412 | 3300048915 | Ga0496112_0000028 | Ga0496112_0000028_118148_118609 | 150 |
| 413 | 3300048915 | Ga0496112_0015337 | Ga0496112_0015337_1239_1724 | 150 |
| 414 | 3300048915 | Ga0496112_0517896 | Ga0496112_0517896_321_806 | 150 |
| 415 | 3300048915 | Ga0496112_1079627 | Ga0496112_1079627_170_703 | 150 |
| 416 | 3300048916 | Ga0496113_0000995 | Ga0496113_0000995_5325_5786 | 150 |
| 417 | 3300048916 | Ga0496113_0557678 | Ga0496113_0557678_44_496 | 150 |
| 418 | 3300049459 | Ga0495678_010336 | Ga0495678_010336_476_928 | 150 |
| 419 | 3300049460 | Ga0495682_0000618 | Ga0495682_0000618_1912_2364 | 150 |
| 420 | 3300049571 | Ga0501034_0009998 | Ga0501034_0009998_6195_6647 | 150 |
| 421 | 3300049576 | Ga0501040_0621062 | Ga0501040_0621062_257_709 | 150 |
| 422 | 3300049578 | Ga0501042_0738121 | Ga0501042_0738121_103_555 | 150 |
| 423 | 3300049579 | Ga0501043_0600115 | Ga0501043_0600115_166_618 | 150 |
| 424 | 3300049592 | Ga0501076_1741263 | Ga0501076_1741263_13_465 | 150 |
| 425 | 3300049741 | Ga0501079_0569624 | Ga0501079_0569624_201_653 | 150 |
| 426 | 3300049742 | Ga0501080_0697057 | Ga0501080_0697057_242_694 | 150 |
| 427 | 3300049743 | Ga0501081_0847376 | Ga0501081_0847376_212_667 | 150 |
| 428 | 3300049822 | Ga0501035_0667677 | Ga0501035_0667677_256_708 | 150 |
| 429 | 3300049823 | Ga0501044_0001789 | Ga0501044_0001789_17938_18390 | 150 |
| 430 | 3300049823 | Ga0501044_0038067 | Ga0501044_0038067_1581_2033 | 150 |
| 431 | 3300050507 | nmdc:mga05p37_196485_c1 | nmdc:mga05p37_196485_c1_462_914 | 150 |
| 432 | 3300050509 | nmdc:mga0qj67_158445_c1 | nmdc:mga0qj67_158445_c1_303_755 | 150 |
| 433 | 3300050512 | nmdc:mga0n895_1577688_c1 | nmdc:mga0n895_1577688_c1_119_571 | 150 |
| 434 | 3300050512 | nmdc:mga0n895_871195_c1 | nmdc:mga0n895_871195_c1_215_667 | 150 |
| 435 | 3300050514 | nmdc:mga08x19_4_c1 | nmdc:mga08x19_4_c1_119579_120031 | 150 |
| 436 | 3300053077 | Ga0495601_0019536 | Ga0495601_0019536_2423_2884 | 150 |
| 437 | 3300053077 | Ga0495601_0165505 | Ga0495601_0165505_236_775 | 150 |
| 438 | 3300053084 | Ga0495595_0051669 | Ga0495595_0051669_1177_1683 | 150 |
| 439 | 3300053085 | Ga0495619_0150534 | Ga0495619_0150534_263_715 | 150 |
| 440 | 3300060353 | Ga0501082_0106472 | Ga0501082_0106472_1554_2006 | 150 |
| 441 | 3300061734 | Ga0530510_0112621 | Ga0530510_0112621_719_1171 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6v04-assembly1.cif.gz_A | dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus | 0.8669 | 1 | 150 |
| 3q63-assembly2.cif.gz_D | x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. | 0.8635 | 4 | 150 |
| 8es5-assembly1.cif.gz_B | aha1 domain protein from pseudomonas aeruginosa | 0.8513 | 4 | 150 |
| 3q63-assembly2.cif.gz_D | x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. | 0.8462 | 4 | 150 |
| 3q6a-assembly1.cif.gz_D | x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 | 0.8455 | 4 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q63F00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8245 | 4 | 150 | 3.30.530.20 |
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8078 | 4 | 146 | 3.30.530.20 |
| 2luzA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8074 | 4 | 146 | 3.30.530.20 |
| af_O53773_104_241_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8001 | 6 | 149 | 3.30.530.20 |
| af_Q8BK64_207_336_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7999 | 4 | 148 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y1TVD1-F1-model_v4 | Vanillate O-demethylase oxidoreductase VanB | 0.9885 | 2 | 79 |
GO:0008168
GO:0032259 |
| AF-A0A1H8NFQ3-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 0.9879 | 1 | 147 |
|
| AF-C4WF00-F1-model_v4 | Activator of Hsp90 ATPase 1 family protein | 0.9864 | 1 | 146 |
|
| AF-A0A6L5FIU4-F1-model_v4 | Vanillate O-demethylase oxidoreductase VanB | 0.9847 | 1 | 150 |
GO:0008168
GO:0032259 |
| AF-A0A2K4G3G9-F1-model_v4 | Vanillate O-demethylase oxidoreductase VanB | 0.9847 | 3 | 148 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar