F444722

General Info

Members Datasets Scaffolds Average Seq Length
441 264 882 115

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1037588|Ga0466967_1037588_365_715
Length 116
Sequence MTEIPGVDPAAGPSGSGCAECEAAGGWWFHLRRCAQCGHVGCCDSSPSQHASKHAAAEGHPVIRSFEPGEEWFWSYPAREFYDTGPTLAPPHNHPVDQPVPGPAGRVPADWQRHLH

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
165 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
166 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
249 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
250 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
264 2928142448 Prescottella equi DPS 2018 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 1.59
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0
Rhizoplane 6.35
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1037588 3300045976 Bacteria 817
2 Ga0070690_100290108 3300005330 Bacteria 1170
3 Ga0070666_10239311 3300005335 Bacteria 1283
4 Ga0070682_100115118 3300005337 Bacteria 1798
5 Ga0070682_100147807 3300005337 Bacteria 1609
6 Ga0068868_100156160 3300005338 Bacteria 1882
7 Ga0070689_102039039 3300005340 Bacteria 525
8 Ga0070691_10112061 3300005341 Bacteria 1366
9 Ga0070674_100056089 3300005356 Bacteria 2731
10 Ga0070709_10006122 3300005434 Bacteria 6545
11 Ga0070709_10009546 3300005434 Bacteria 5354
12 Ga0070709_10488379 3300005434 Bacteria 934
13 Ga0070714_100202733 3300005435 Bacteria 1815
14 Ga0070714_100510696 3300005435 Bacteria 1147
15 Ga0070714_100823658 3300005435 Bacteria 899
16 Ga0070714_100846257 3300005435 Bacteria 887
17 Ga0070713_100170174 3300005436 Bacteria 1951
18 Ga0070713_100843815 3300005436 Bacteria 879
19 Ga0070713_100899358 3300005436 Bacteria 851
20 Ga0070710_10124503 3300005437 Bacteria 1564
21 Ga0070710_10132490 3300005437 Bacteria 1521
22 Ga0070710_10420966 3300005437 Bacteria 899
23 Ga0070710_10563068 3300005437 Bacteria 788
24 Ga0070711_100048748 3300005439 Bacteria 2898
25 Ga0070711_100057747 3300005439 Bacteria 2688
26 Ga0070711_100994034 3300005439 Bacteria 719
27 Ga0070705_100409477 3300005440 Bacteria 1006
28 Ga0070700_100192442 3300005441 Bacteria 1427
29 Ga0070708_100329506 3300005445 Bacteria 1438
30 Ga0070708_100679287 3300005445 Bacteria 970
31 Ga0070708_100847426 3300005445 Bacteria 859
32 Ga0070678_100215288 3300005456 Bacteria 1594
33 Ga0070678_101081155 3300005456 Bacteria 740
34 Ga0070706_100014433 3300005467 Bacteria 7300
35 Ga0070706_100035981 3300005467 Bacteria 4572
36 Ga0070706_100065363 3300005467 Bacteria 3364
37 Ga0070706_100140926 3300005467 Bacteria 2251
38 Ga0070706_100838995 3300005467 Bacteria 850
39 Ga0070707_100179053 3300005468 Bacteria 2067
40 Ga0070707_101282868 3300005468 Bacteria 699
41 Ga0070698_100000057 3300005471 Bacteria 79148
42 Ga0070698_100069948 3300005471 Bacteria 3523
43 Ga0070698_100222980 3300005471 Bacteria 1819
44 Ga0070699_100001527 3300005518 Bacteria 21162
45 Ga0070684_100754198 3300005535 Bacteria 909
46 Ga0070697_100616660 3300005536 Bacteria 954
47 Ga0068853_100634766 3300005539 Bacteria 1016
48 Ga0070696_100210732 3300005546 Bacteria 1454
49 Ga0070693_100304271 3300005547 Bacteria 1076
50 Ga0070665_100560870 3300005548 Bacteria 1154
51 Ga0070665_101442408 3300005548 Bacteria 697
52 Ga0068855_100079158 3300005563 Bacteria 3812
53 Ga0068855_100294364 3300005563 Bacteria 1799
54 Ga0068855_100631913 3300005563 Bacteria 1152
55 Ga0068856_100029804 3300005614 Bacteria 5332
56 Ga0068856_100119772 3300005614 Bacteria 2633
57 Ga0068856_100122238 3300005614 Bacteria 2605
58 Ga0068856_100127519 3300005614 Bacteria 2548
59 Ga0068852_101350490 3300005616 Bacteria 735
60 Ga0068864_100243934 3300005618 Bacteria 1665
61 Ga0068864_100638152 3300005618 Bacteria 1036
62 Ga0068863_101075326 3300005841 Bacteria 809
63 Ga0068858_100037609 3300005842 Bacteria 4489
64 Ga0068860_100098996 3300005843 Bacteria 2781
65 Ga0081540_1004241 3300005983 Bacteria 11012
66 Ga0081539_10302693 3300005985 Bacteria 687
67 Ga0070717_10014673 3300006028 Bacteria 6029
68 Ga0070717_10148987 3300006028 Bacteria 2023
69 Ga0070717_10212138 3300006028 Bacteria 1699
70 Ga0070717_10802077 3300006028 Bacteria 856
71 Ga0070717_11123725 3300006028 Bacteria 715
72 Ga0075368_10002359 3300006042 Bacteria 6142
73 Ga0075368_10006141 3300006042 Bacteria 4179
74 Ga0075363_100277883 3300006048 Bacteria 968
75 Ga0075364_10032705 3300006051 Bacteria 3344
76 Ga0075364_10056134 3300006051 Bacteria 2578
77 Ga0070715_10056642 3300006163 Bacteria 1706
78 Ga0070716_100059523 3300006173 Bacteria 2202
79 Ga0070716_100111776 3300006173 Bacteria 1694
80 Ga0070712_100030349 3300006175 Bacteria 3631
81 Ga0070712_100131049 3300006175 Bacteria 1900
82 Ga0075367_10041320 3300006178 Bacteria 2695
83 Ga0097621_100073241 3300006237 Bacteria 2835
84 Ga0068871_100088921 3300006358 Bacteria 2571
85 Ga0075428_102309531 3300006844 Bacteria 553
86 Ga0075434_100053372 3300006871 Bacteria 4017
87 Ga0075435_100785076 3300007076 Bacteria 829
88 Ga0105240_11718639 3300009093 Bacteria 655
89 Ga0105245_10227290 3300009098 Bacteria 1803
90 Ga0105247_10160069 3300009101 Bacteria 1490
91 Ga0114129_12472665 3300009147 Bacteria 621
92 Ga0105243_10050709 3300009148 Bacteria 3280
93 Ga0105248_10238952 3300009177 Bacteria 2045
94 Ga0105237_10332902 3300009545 Bacteria 1522
95 Ga0105237_10889673 3300009545 Bacteria 897
96 Ga0105239_10248200 3300010375 Bacteria 1999
97 Ga0105246_10175990 3300011119 Bacteria 1643
98 Ga0105246_10364591 3300011119 Bacteria 1188
99 Ga0157370_10072397 3300013104 Bacteria 3252
100 Ga0157369_10187345 3300013105 Bacteria 2176
101 Ga0157369_10571782 3300013105 Bacteria 1167
102 Ga0157374_10111412 3300013296 Bacteria 2633
103 Ga0157378_11285538 3300013297 Bacteria 772
104 Ga0163162_10378287 3300013306 Bacteria 1549
105 Ga0157372_10740012 3300013307 Bacteria 1143
106 Ga0157375_10078732 3300013308 Bacteria 3330
107 Ga0157375_13052503 3300013308 Bacteria 559
108 Ga0163163_10006340 3300014325 Bacteria 10328
109 Ga0163163_12028832 3300014325 Bacteria 635
110 Ga0157380_10150558 3300014326 Bacteria 2011
111 Ga0157379_11089944 3300014968 Bacteria 764
112 Ga0157376_10124343 3300014969 Bacteria 2291
113 Ga0197907_11453839 3300020069 Bacteria 561
114 Ga0206350_10709292 3300020080 Bacteria 534
115 Ga0213875_10006978 3300021388 Bacteria 5878
116 Ga0224712_10207824 3300022467 Bacteria 892
117 Ga0224569_106018 3300022732 Bacteria 894
118 Ga0224572_1037233 3300024225 Bacteria 920
119 Ga0228598_1028341 3300024227 Bacteria 1102
120 Ga0207692_10004576 3300025898 Bacteria 5484
121 Ga0207692_10032670 3300025898 Bacteria 2503
122 Ga0207692_10083980 3300025898 Bacteria 1710
123 Ga0207692_10888274 3300025898 Bacteria 586
124 Ga0207692_11153611 3300025898 Bacteria 514
125 Ga0207699_10001793 3300025906 Bacteria 10086
126 Ga0207699_10146969 3300025906 Bacteria 1555
127 Ga0207699_10280683 3300025906 Bacteria 1157
128 Ga0207699_10301375 3300025906 Bacteria 1119
129 Ga0207684_10001977 3300025910 Bacteria 21160
130 Ga0207684_10006241 3300025910 Bacteria 10884
131 Ga0207684_10070624 3300025910 Bacteria 2968
132 Ga0207684_10511853 3300025910 Bacteria 1028
133 Ga0207684_10684362 3300025910 Bacteria 872
134 Ga0207654_10484190 3300025911 Bacteria 872
135 Ga0207695_10145113 3300025913 Bacteria 2318
136 Ga0207695_10345575 3300025913 Bacteria 1375
137 Ga0207671_10076668 3300025914 Bacteria 2502
138 Ga0207671_10103956 3300025914 Bacteria 2154
139 Ga0207693_10012167 3300025915 Bacteria 6952
140 Ga0207693_10655814 3300025915 Bacteria 815
141 Ga0207663_10070637 3300025916 Bacteria 2250
142 Ga0207663_10204182 3300025916 Bacteria 1428
143 Ga0207663_10492426 3300025916 Bacteria 951
144 Ga0207662_10011453 3300025918 Bacteria 4921
145 Ga0207646_11497539 3300025922 Bacteria 584
146 Ga0207700_10015013 3300025928 Bacteria 5092
147 Ga0207700_10700311 3300025928 Bacteria 904
148 Ga0207664_10029504 3300025929 Bacteria 4178
149 Ga0207664_10151493 3300025929 Bacteria 1970
150 Ga0207664_11057144 3300025929 Bacteria 727
151 Ga0207644_10330770 3300025931 Bacteria 1234
152 Ga0207706_10389069 3300025933 Bacteria 1209
153 Ga0207709_10032177 3300025935 Bacteria 3069
154 Ga0207670_10377957 3300025936 Bacteria 1128
155 Ga0207669_10035522 3300025937 Bacteria 2837
156 Ga0207704_11853965 3300025938 Bacteria 519
157 Ga0207665_10002507 3300025939 Bacteria 12351
158 Ga0207665_10023700 3300025939 Bacteria 4042
159 Ga0207665_10559275 3300025939 Bacteria 889
160 Ga0207711_10097408 3300025941 Bacteria 2597
161 Ga0207667_10010815 3300025949 Bacteria 10641
162 Ga0207667_10082111 3300025949 Bacteria 3339
163 Ga0207667_10753872 3300025949 Bacteria 973
164 Ga0207667_12058431 3300025949 Bacteria 530
165 Ga0207677_10162135 3300026023 Bacteria 1738
166 Ga0207703_10035111 3300026035 Bacteria 3984
167 Ga0207708_10084030 3300026075 Bacteria 2447
168 Ga0207702_10038548 3300026078 Bacteria 4002
169 Ga0207702_10076332 3300026078 Bacteria 2896
170 Ga0207702_10454616 3300026078 Bacteria 1243
171 Ga0207702_10675239 3300026078 Bacteria 1017
172 Ga0207674_10027469 3300026116 Bacteria 6019
173 Ga0207675_102474322 3300026118 Bacteria 530
174 Ga0207683_10364997 3300026121 Bacteria 1326
175 Ga0207683_11036513 3300026121 Bacteria 761
176 Ga0209813_10001772 3300027866 Bacteria 4862
177 Ga0209813_10003803 3300027866 Bacteria 3565
178 Ga0207428_10756147 3300027907 Bacteria 692
179 Ga0268264_10180066 3300028381 Bacteria 1919
180 Ga0268264_11578695 3300028381 Bacteria 667
181 Ga0265319_1066043 3300028563 Bacteria 1166
182 Ga0265318_10103442 3300028577 Bacteria 1048
183 Ga0265336_10004345 3300028666 Bacteria 5370
184 Ga0265336_10019768 3300028666 Bacteria 2170
185 Ga0265338_10007086 3300028800 Bacteria 14053
186 Ga0265762_1028641 3300030760 Bacteria 1050
187 Ga0265769_102812 3300030888 Bacteria 934
188 Ga0265760_10037761 3300031090 Bacteria 1434
189 Ga0265760_10377444 3300031090 Bacteria 510
190 Ga0265329_10276110 3300031242 Bacteria 564
191 Ga0307408_100090454 3300031548 Bacteria 2310
192 Ga0307408_101156100 3300031548 Bacteria 720
193 Ga0265313_10223426 3300031595 Bacteria 776
194 Ga0307405_10555920 3300031731 Bacteria 929
195 Ga0307413_10310914 3300031824 Bacteria 1199
196 Ga0307413_11073336 3300031824 Bacteria 694
197 Ga0307413_11160227 3300031824 Bacteria 670
198 Ga0307413_11277465 3300031824 Bacteria 641
199 Ga0307413_11321311 3300031824 Bacteria 631
200 Ga0307410_10024744 3300031852 Bacteria 3756
201 Ga0307410_10399814 3300031852 Bacteria 1110
202 Ga0307410_10446936 3300031852 Bacteria 1054
203 Ga0307406_10177805 3300031901 Bacteria 1546
204 Ga0307406_10329984 3300031901 Bacteria 1184
205 Ga0307407_10035911 3300031903 Bacteria 2726
206 Ga0307407_10176036 3300031903 Bacteria 1414
207 Ga0307407_10268932 3300031903 Bacteria 1176
208 Ga0307412_10028277 3300031911 Bacteria 3506
209 Ga0307412_10047086 3300031911 Bacteria 2830
210 Ga0307409_100020378 3300031995 Bacteria 4517
211 Ga0307409_100116368 3300031995 Bacteria 2253
212 Ga0307409_100167176 3300031995 Bacteria 1932
213 Ga0307409_100220025 3300031995 Bacteria 1713
214 Ga0307409_100250933 3300031995 Bacteria 1618
215 Ga0307409_100430256 3300031995 Bacteria 1268
216 Ga0307409_100798270 3300031995 Bacteria 951
217 Ga0307409_101606661 3300031995 Bacteria 678
218 Ga0307416_100109651 3300032002 Bacteria 2428
219 Ga0307416_100253977 3300032002 Bacteria 1713
220 Ga0307416_101297932 3300032002 Bacteria 834
221 Ga0307416_101321492 3300032002 Bacteria 827
222 Ga0307416_101503899 3300032002 Bacteria 779
223 Ga0307416_102216799 3300032002 Bacteria 650
224 Ga0307414_10081123 3300032004 Bacteria 2374
225 Ga0307414_10098366 3300032004 Bacteria 2195
226 Ga0307414_10132827 3300032004 Bacteria 1935
227 Ga0307414_11551018 3300032004 Bacteria 617
228 Ga0307411_10105619 3300032005 Bacteria 2003
229 Ga0307411_10143216 3300032005 Bacteria 1765
230 Ga0307415_100087522 3300032126 Bacteria 2245
231 Ga0307415_100157459 3300032126 Bacteria 1756
232 Ga0307415_100172875 3300032126 Bacteria 1686
233 Ga0307415_100438048 3300032126 Bacteria 1126
234 Ga0307415_100929639 3300032126 Bacteria 804
235 Ga0373948_0197140 3300034817 Bacteria 524
236 Ga0373926_0312250 3300035083 Bacteria 614
237 Ga0373928_0032817 3300035084 Bacteria 1159
238 Ga0373934_0168345 3300035086 Bacteria 899
239 Ga0373923_0698731 3300035111 Bacteria 503
240 Ga0373936_0204457 3300035113 Bacteria 872
241 Ga0373936_0330519 3300035113 Bacteria 692
242 Ga0373941_0507002 3300035115 Bacteria 514
243 Ga0373945_0104512 3300035116 Bacteria 1112
244 Ga0373945_0138121 3300035116 Bacteria 981
245 Ga0373953_0344627 3300035117 Bacteria 652
246 Ga0373954_0559031 3300035118 Bacteria 567
247 Ga0373956_0083478 3300035119 Bacteria 1468
248 Ga0373957_0132886 3300035120 Bacteria 1014
249 Ga0373960_0385686 3300035121 Bacteria 538
250 Ga0373943_0078887 3300035170 Bacteria 1684
251 Ga0373943_0120989 3300035170 Bacteria 1391
252 Ga0373943_0189335 3300035170 Bacteria 1134
253 Ga0373946_0110896 3300035171 Bacteria 1241
254 Ga0373946_0177897 3300035171 Bacteria 1008
255 Ga0373955_0077952 3300035172 Bacteria 1866
256 Ga0373931_0473587 3300035691 Bacteria 804
257 Ga0373931_0815866 3300035691 Bacteria 623
258 Ga0373935_0173483 3300035692 Bacteria 1476
259 Ga0373927_0114431 3300035695 Bacteria 1758
260 Ga0373927_0247500 3300035695 Bacteria 1172
261 Ga0373927_1039073 3300035695 Bacteria 540
262 Ga0373933_0343930 3300035724 Bacteria 968
263 Ga0373947_0117378 3300035725 Bacteria 1688
264 Ga0373947_0467620 3300035725 Bacteria 855
265 Ga0373947_0576375 3300035725 Bacteria 766
266 Ga0373937_0566919 3300036401 Bacteria 1078
267 Ga0395899_0047469 3300037312 Bacteria 3197
268 Ga0395900_0216302 3300037418 Bacteria 1933
269 Ga0395898_0062625 3300037466 Bacteria 3612
270 Ga0395898_0253769 3300037466 Bacteria 1677
271 Ga0395905_0030516 3300037471 Bacteria 5079
272 Ga0395905_0454538 3300037471 Bacteria 1179
273 Ga0436364_1433762 3300037853 Bacteria 4756
274 Ga0395901_0175850 3300038443 Bacteria 2245
275 Ga0436365_0233884 3300039437 Bacteria 2085
276 Ga0436361_0086927 3300039447 Bacteria 906
277 Ga0436363_1090496 3300039450 Bacteria 589
278 Ga0436362_0075897 3300039453 Bacteria 563
279 Ga0451791_1288624 3300041451 Bacteria 515
280 Ga0451797_0673465 3300041453 Bacteria 607
281 Ga0451807_2613182 3300041486 Bacteria 1067
282 Ga0439443_034822 3300042003 Bacteria 842
283 Ga0439451_120939 3300042009 Bacteria 533
284 Ga0439454_006194 3300042011 Bacteria 1461
285 Ga0439455_0201723 3300042012 Bacteria 576
286 Ga0439463_035763 3300042016 Bacteria 1257
287 Ga0439444_0007538 3300042437 Bacteria 1675
288 Ga0439460_0006713 3300042461 Bacteria 2861
289 Ga0439440_0013941 3300042993 Bacteria 1730
290 Ga0439440_0018636 3300042993 Bacteria 1539
291 Ga0466969_0152056 3300044656 Bacteria 1066
292 Ga0466972_0022503 3300044658 Bacteria 3138
293 Ga0466965_0001156 3300044683 Bacteria 10376
294 Ga0466965_0085947 3300044683 Bacteria 1595
295 Ga0466966_0102077 3300044684 Bacteria 1773
296 Ga0466961_0075469 3300044693 Bacteria 2137
297 Ga0466961_0445616 3300044693 Bacteria 784
298 Ga0466963_0095482 3300044694 Bacteria 2029
299 Ga0466963_0190695 3300044694 Bacteria 1432
300 Ga0466963_0307659 3300044694 Bacteria 1115
301 Ga0466963_0586019 3300044694 Bacteria 788
302 Ga0466971_0061619 3300044719 Bacteria 1696
303 Ga0466968_0206646 3300044735 Bacteria 921
304 Ga0466970_0009113 3300044765 Bacteria 5008
305 Ga0466957_0047662 3300044842 Bacteria 2604
306 Ga0466957_0134985 3300044842 Bacteria 1585
307 Ga0466960_0045052 3300044901 Bacteria 2106
308 Ga0466960_0340413 3300044901 Bacteria 853
309 Ga0466959_0731365 3300045049 Bacteria 663
310 Ga0466959_1063056 3300045049 Bacteria 538
311 Ga0466958_0293327 3300045836 Bacteria 1043
312 Ga0466967_0045416 3300045976 Bacteria 3817
313 Ga0466967_0302030 3300045976 Bacteria 1540
314 Ga0466967_0845891 3300045976 Bacteria 909
315 Ga0466967_0846448 3300045976 Bacteria 909
316 Ga0495592_0005531 3300046454 Bacteria 9346
317 Ga0495592_0261069 3300046454 Bacteria 1141
318 Ga0495629_0241450 3300046459 Bacteria 1244
319 Ga0495629_0765898 3300046459 Bacteria 638
320 Ga0495641_0110701 3300046461 Bacteria 1225
321 Ga0495651_0078472 3300046462 Bacteria 2497
322 Ga0495653_0051791 3300046463 Bacteria 3149
323 Ga0495653_0112879 3300046463 Bacteria 1950
324 Ga0495653_0169941 3300046463 Bacteria 1505
325 Ga0495650_0325735 3300046471 Bacteria 511
326 Ga0495580_0274332 3300046472 Bacteria 1151
327 Ga0495639_0152825 3300046475 Bacteria 1114
328 Ga0495639_0498210 3300046475 Bacteria 622
329 Ga0495662_0022609 3300046476 Bacteria 3036
330 Ga0495596_0194135 3300046500 Bacteria 789
331 Ga0495608_0008367 3300046511 Bacteria 7251
332 Ga0495628_0049627 3300046516 Bacteria 3322
333 Ga0495628_0187289 3300046516 Bacteria 1564
334 Ga0495628_0228200 3300046516 Bacteria 1396
335 Ga0495630_0146470 3300046517 Bacteria 1796
336 Ga0495630_0215207 3300046517 Bacteria 1466
337 Ga0495663_0029511 3300046525 Bacteria 1620
338 Ga0495663_0334205 3300046525 Bacteria 550
339 Ga0495652_0023505 3300046529 Bacteria 5464
340 Ga0495652_0059357 3300046529 Bacteria 3236
341 Ga0495652_0258964 3300046529 Bacteria 1285
342 Ga0495640_0008802 3300046533 Bacteria 7897
343 Ga0495640_0171413 3300046533 Bacteria 1386
344 Ga0495586_0072354 3300046535 Bacteria 1885
345 Ga0495587_0000986 3300046536 Bacteria 18675
346 Ga0495587_0484597 3300046536 Bacteria 684
347 Ga0495621_0222367 3300046539 Bacteria 765
348 Ga0495645_0010695 3300046543 Bacteria 6442
349 Ga0495645_0164690 3300046543 Bacteria 1530
350 Ga0495645_0406470 3300046543 Bacteria 866
351 Ga0495667_0029483 3300046559 Bacteria 3693
352 Ga0495656_0058696 3300046615 Bacteria 1671
353 Ga0495656_0164352 3300046615 Bacteria 1081
354 Ga0495634_0210299 3300046642 Bacteria 1204
355 Ga0495634_0464860 3300046642 Bacteria 745
356 Ga0495635_0010399 3300046663 Bacteria 6508
357 Ga0495635_0062362 3300046663 Bacteria 2560
358 Ga0495635_0336658 3300046663 Bacteria 1008
359 Ga0495588_0623464 3300046674 Bacteria 565
360 Ga0495657_0010483 3300046675 Bacteria 6973
361 Ga0495599_0020642 3300046678 Bacteria 4104
362 Ga0495599_0031389 3300046678 Bacteria 3334
363 Ga0495623_0053980 3300046679 Bacteria 2536
364 Ga0495646_0042925 3300046680 Bacteria 2773
365 Ga0495646_0150916 3300046680 Bacteria 1292
366 Ga0495647_0077150 3300046681 Bacteria 1345
367 Ga0495613_0209149 3300046689 Bacteria 1373
368 Ga0495624_0096869 3300046690 Bacteria 1817
369 Ga0495600_0075434 3300046809 Bacteria 2202
370 Ga0495600_0205518 3300046809 Bacteria 1263
371 Ga0495581_0160055 3300047315 Bacteria 1316
372 Ga0495604_0067099 3300047317 Bacteria 2727
373 Ga0495604_0188992 3300047317 Bacteria 1436
374 Ga0495674_0256557 3300047319 Bacteria 1437
375 Ga0495674_0395460 3300047319 Bacteria 1116
376 Ga0495676_0520574 3300047321 Bacteria 779
377 Ga0495680_0013220 3300047322 Bacteria 7211
378 Ga0495680_0230315 3300047322 Bacteria 1319
379 Ga0495675_0016784 3300047444 Bacteria 4630
380 Ga0495685_121090 3300047447 Bacteria 859
381 Ga0495684_0009442 3300047471 Bacteria 7530
382 Ga0495684_0057262 3300047471 Bacteria 2971
383 Ga0495684_0526300 3300047471 Bacteria 809
384 Ga0495686_0021298 3300047472 Bacteria 4308
385 Ga0495593_0186082 3300047673 Bacteria 1046
386 Ga0495602_0045191 3300048088 Bacteria 3987
387 Ga0495602_1091095 3300048088 Bacteria 523
388 Ga0495614_0138531 3300048089 Bacteria 1081
389 Ga0496100_0183125 3300048903 Bacteria 1516
390 Ga0496100_1602115 3300048903 Bacteria 515
391 Ga0496103_0336822 3300048906 Bacteria 970
392 Ga0496104_0003894 3300048907 Bacteria 12922
393 Ga0496104_0043341 3300048907 Bacteria 4226
394 Ga0496105_0009130 3300048908 Bacteria 7737
395 Ga0496105_0039061 3300048908 Bacteria 3911
396 Ga0496105_0381539 3300048908 Bacteria 1121
397 Ga0496106_0057468 3300048909 Bacteria 2942
398 Ga0496106_0124314 3300048909 Bacteria 2019
399 Ga0496108_0004450 3300048911 Bacteria 11283
400 Ga0496108_0005414 3300048911 Bacteria 10321
401 Ga0496109_0015186 3300048912 Bacteria 6704
402 Ga0496109_0023338 3300048912 Bacteria 5490
403 Ga0496110_0043054 3300048913 Bacteria 3942
404 Ga0496110_0066219 3300048913 Bacteria 3195
405 Ga0496111_0083465 3300048914 Bacteria 2334
406 Ga0496111_0105804 3300048914 Bacteria 2071
407 Ga0496112_0001113 3300048915 Bacteria 19963
408 Ga0496113_0020453 3300048916 Bacteria 4653
409 Ga0496114_0095101 3300048917 Bacteria 2535
410 Ga0496114_0173036 3300048917 Bacteria 1883
411 Ga0496114_0319611 3300048917 Bacteria 1371
412 Ga0496115_0017799 3300048918 Bacteria 5441
413 Ga0496115_0219039 3300048918 Bacteria 1571
414 Ga0496123_0097160 3300048926 Bacteria 1727
415 Ga0496126_0033947 3300048929 Bacteria 4798
416 Ga0496126_0603973 3300048929 Bacteria 864
417 Ga0501034_0123432 3300049571 Bacteria 2576
418 Ga0501068_0231606 3300049584 Bacteria 1175
419 Ga0501070_0081735 3300049586 Bacteria 2673
420 Ga0501070_0321079 3300049586 Bacteria 1259
421 Ga0501202_082183 3300049652 Bacteria 759
422 Ga0501202_120836 3300049652 Bacteria 658
423 Ga0501243_137702 3300049675 Bacteria 514
424 Ga0501252_078071 3300049682 Bacteria 544
425 Ga0501080_0009086 3300049742 Bacteria 9043
426 Ga0501044_0294865 3300049823 Bacteria 1552
427 Ga0501212_055811 3300049851 Bacteria 676
428 nmdc:mga00v17_35491_c1 3300050491 Bacteria 2968
429 nmdc:mga0yw44_198181_c1 3300050492 Bacteria 1325
430 nmdc:mga06z11_418503_c1 3300050494 Bacteria 808
431 nmdc:mga04h51_29290_c1 3300050495 Bacteria 1724
432 Ga0495601_0371019 3300053077 Bacteria 929
433 Ga0495612_0074546 3300053078 Bacteria 1419
434 Ga0495612_0115030 3300053078 Bacteria 1154
435 Ga0495595_0085331 3300053084 Bacteria 1509
436 Ga0495619_0069425 3300053085 Bacteria 2355
437 Ga0495619_0070836 3300053085 Bacteria 2332
438 Ga0495619_0723126 3300053085 Bacteria 676
439 Ga0466962_0119634 3300061719 Bacteria 1270
440 2644136487 2643221624 Bacteria 4384879
441 2928144035 2928142448 Bacteria 5288925
442 Ga0466967_1037588
443 Ga0070690_100290108
444 Ga0070666_10239311
445 Ga0070682_100115118
446 Ga0070682_100147807
447 Ga0068868_100156160
448 Ga0070689_102039039
449 Ga0070691_10112061
450 Ga0070674_100056089
451 Ga0070709_10006122
452 Ga0070709_10009546
453 Ga0070709_10488379
454 Ga0070714_100202733
455 Ga0070714_100510696
456 Ga0070714_100823658
457 Ga0070714_100846257
458 Ga0070713_100170174
459 Ga0070713_100843815
460 Ga0070713_100899358
461 Ga0070710_10124503
462 Ga0070710_10132490
463 Ga0070710_10420966
464 Ga0070710_10563068
465 Ga0070711_100048748
466 Ga0070711_100057747
467 Ga0070711_100994034
468 Ga0070705_100409477
469 Ga0070700_100192442
470 Ga0070708_100329506
471 Ga0070708_100679287
472 Ga0070708_100847426
473 Ga0070678_100215288
474 Ga0070678_101081155
475 Ga0070706_100014433
476 Ga0070706_100035981
477 Ga0070706_100065363
478 Ga0070706_100140926
479 Ga0070706_100838995
480 Ga0070707_100179053
481 Ga0070707_101282868
482 Ga0070698_100000057
483 Ga0070698_100069948
484 Ga0070698_100222980
485 Ga0070699_100001527
486 Ga0070684_100754198
487 Ga0070697_100616660
488 Ga0068853_100634766
489 Ga0070696_100210732
490 Ga0070693_100304271
491 Ga0070665_100560870
492 Ga0070665_101442408
493 Ga0068855_100079158
494 Ga0068855_100294364
495 Ga0068855_100631913
496 Ga0068856_100029804
497 Ga0068856_100119772
498 Ga0068856_100122238
499 Ga0068856_100127519
500 Ga0068852_101350490
501 Ga0068864_100243934
502 Ga0068864_100638152
503 Ga0068863_101075326
504 Ga0068858_100037609
505 Ga0068860_100098996
506 Ga0081540_1004241
507 Ga0081539_10302693
508 Ga0070717_10014673
509 Ga0070717_10148987
510 Ga0070717_10212138
511 Ga0070717_10802077
512 Ga0070717_11123725
513 Ga0075368_10002359
514 Ga0075368_10006141
515 Ga0075363_100277883
516 Ga0075364_10032705
517 Ga0075364_10056134
518 Ga0070715_10056642
519 Ga0070716_100059523
520 Ga0070716_100111776
521 Ga0070712_100030349
522 Ga0070712_100131049
523 Ga0075367_10041320
524 Ga0097621_100073241
525 Ga0068871_100088921
526 Ga0075428_102309531
527 Ga0075434_100053372
528 Ga0075435_100785076
529 Ga0105240_11718639
530 Ga0105245_10227290
531 Ga0105247_10160069
532 Ga0114129_12472665
533 Ga0105243_10050709
534 Ga0105248_10238952
535 Ga0105237_10332902
536 Ga0105237_10889673
537 Ga0105239_10248200
538 Ga0105246_10175990
539 Ga0105246_10364591
540 Ga0157370_10072397
541 Ga0157369_10187345
542 Ga0157369_10571782
543 Ga0157374_10111412
544 Ga0157378_11285538
545 Ga0163162_10378287
546 Ga0157372_10740012
547 Ga0157375_10078732
548 Ga0157375_13052503
549 Ga0163163_10006340
550 Ga0163163_12028832
551 Ga0157380_10150558
552 Ga0157379_11089944
553 Ga0157376_10124343
554 Ga0197907_11453839
555 Ga0206350_10709292
556 Ga0213875_10006978
557 Ga0224712_10207824
558 Ga0224569_106018
559 Ga0224572_1037233
560 Ga0228598_1028341
561 Ga0207692_10004576
562 Ga0207692_10032670
563 Ga0207692_10083980
564 Ga0207692_10888274
565 Ga0207692_11153611
566 Ga0207699_10001793
567 Ga0207699_10146969
568 Ga0207699_10280683
569 Ga0207699_10301375
570 Ga0207684_10001977
571 Ga0207684_10006241
572 Ga0207684_10070624
573 Ga0207684_10511853
574 Ga0207684_10684362
575 Ga0207654_10484190
576 Ga0207695_10145113
577 Ga0207695_10345575
578 Ga0207671_10076668
579 Ga0207671_10103956
580 Ga0207693_10012167
581 Ga0207693_10655814
582 Ga0207663_10070637
583 Ga0207663_10204182
584 Ga0207663_10492426
585 Ga0207662_10011453
586 Ga0207646_11497539
587 Ga0207700_10015013
588 Ga0207700_10700311
589 Ga0207664_10029504
590 Ga0207664_10151493
591 Ga0207664_11057144
592 Ga0207644_10330770
593 Ga0207706_10389069
594 Ga0207709_10032177
595 Ga0207670_10377957
596 Ga0207669_10035522
597 Ga0207704_11853965
598 Ga0207665_10002507
599 Ga0207665_10023700
600 Ga0207665_10559275
601 Ga0207711_10097408
602 Ga0207667_10010815
603 Ga0207667_10082111
604 Ga0207667_10753872
605 Ga0207667_12058431
606 Ga0207677_10162135
607 Ga0207703_10035111
608 Ga0207708_10084030
609 Ga0207702_10038548
610 Ga0207702_10076332
611 Ga0207702_10454616
612 Ga0207702_10675239
613 Ga0207674_10027469
614 Ga0207675_102474322
615 Ga0207683_10364997
616 Ga0207683_11036513
617 Ga0209813_10001772
618 Ga0209813_10003803
619 Ga0207428_10756147
620 Ga0268264_10180066
621 Ga0268264_11578695
622 Ga0265319_1066043
623 Ga0265318_10103442
624 Ga0265336_10004345
625 Ga0265336_10019768
626 Ga0265338_10007086
627 Ga0265762_1028641
628 Ga0265769_102812
629 Ga0265760_10037761
630 Ga0265760_10377444
631 Ga0265329_10276110
632 Ga0307408_100090454
633 Ga0307408_101156100
634 Ga0265313_10223426
635 Ga0307405_10555920
636 Ga0307413_10310914
637 Ga0307413_11073336
638 Ga0307413_11160227
639 Ga0307413_11277465
640 Ga0307413_11321311
641 Ga0307410_10024744
642 Ga0307410_10399814
643 Ga0307410_10446936
644 Ga0307406_10177805
645 Ga0307406_10329984
646 Ga0307407_10035911
647 Ga0307407_10176036
648 Ga0307407_10268932
649 Ga0307412_10028277
650 Ga0307412_10047086
651 Ga0307409_100020378
652 Ga0307409_100116368
653 Ga0307409_100167176
654 Ga0307409_100220025
655 Ga0307409_100250933
656 Ga0307409_100430256
657 Ga0307409_100798270
658 Ga0307409_101606661
659 Ga0307416_100109651
660 Ga0307416_100253977
661 Ga0307416_101297932
662 Ga0307416_101321492
663 Ga0307416_101503899
664 Ga0307416_102216799
665 Ga0307414_10081123
666 Ga0307414_10098366
667 Ga0307414_10132827
668 Ga0307414_11551018
669 Ga0307411_10105619
670 Ga0307411_10143216
671 Ga0307415_100087522
672 Ga0307415_100157459
673 Ga0307415_100172875
674 Ga0307415_100438048
675 Ga0307415_100929639
676 Ga0373948_0197140
677 Ga0373926_0312250
678 Ga0373928_0032817
679 Ga0373934_0168345
680 Ga0373923_0698731
681 Ga0373936_0204457
682 Ga0373936_0330519
683 Ga0373941_0507002
684 Ga0373945_0104512
685 Ga0373945_0138121
686 Ga0373953_0344627
687 Ga0373954_0559031
688 Ga0373956_0083478
689 Ga0373957_0132886
690 Ga0373960_0385686
691 Ga0373943_0078887
692 Ga0373943_0120989
693 Ga0373943_0189335
694 Ga0373946_0110896
695 Ga0373946_0177897
696 Ga0373955_0077952
697 Ga0373931_0473587
698 Ga0373931_0815866
699 Ga0373935_0173483
700 Ga0373927_0114431
701 Ga0373927_0247500
702 Ga0373927_1039073
703 Ga0373933_0343930
704 Ga0373947_0117378
705 Ga0373947_0467620
706 Ga0373947_0576375
707 Ga0373937_0566919
708 Ga0395899_0047469
709 Ga0395900_0216302
710 Ga0395898_0062625
711 Ga0395898_0253769
712 Ga0395905_0030516
713 Ga0395905_0454538
714 Ga0436364_1433762
715 Ga0395901_0175850
716 Ga0436365_0233884
717 Ga0436361_0086927
718 Ga0436363_1090496
719 Ga0436362_0075897
720 Ga0451791_1288624
721 Ga0451797_0673465
722 Ga0451807_2613182
723 Ga0439443_034822
724 Ga0439451_120939
725 Ga0439454_006194
726 Ga0439455_0201723
727 Ga0439463_035763
728 Ga0439444_0007538
729 Ga0439460_0006713
730 Ga0439440_0013941
731 Ga0439440_0018636
732 Ga0466969_0152056
733 Ga0466972_0022503
734 Ga0466965_0001156
735 Ga0466965_0085947
736 Ga0466966_0102077
737 Ga0466961_0075469
738 Ga0466961_0445616
739 Ga0466963_0095482
740 Ga0466963_0190695
741 Ga0466963_0307659
742 Ga0466963_0586019
743 Ga0466971_0061619
744 Ga0466968_0206646
745 Ga0466970_0009113
746 Ga0466957_0047662
747 Ga0466957_0134985
748 Ga0466960_0045052
749 Ga0466960_0340413
750 Ga0466959_0731365
751 Ga0466959_1063056
752 Ga0466958_0293327
753 Ga0466967_0045416
754 Ga0466967_0302030
755 Ga0466967_0845891
756 Ga0466967_0846448
757 Ga0495592_0005531
758 Ga0495592_0261069
759 Ga0495629_0241450
760 Ga0495629_0765898
761 Ga0495641_0110701
762 Ga0495651_0078472
763 Ga0495653_0051791
764 Ga0495653_0112879
765 Ga0495653_0169941
766 Ga0495650_0325735
767 Ga0495580_0274332
768 Ga0495639_0152825
769 Ga0495639_0498210
770 Ga0495662_0022609
771 Ga0495596_0194135
772 Ga0495608_0008367
773 Ga0495628_0049627
774 Ga0495628_0187289
775 Ga0495628_0228200
776 Ga0495630_0146470
777 Ga0495630_0215207
778 Ga0495663_0029511
779 Ga0495663_0334205
780 Ga0495652_0023505
781 Ga0495652_0059357
782 Ga0495652_0258964
783 Ga0495640_0008802
784 Ga0495640_0171413
785 Ga0495586_0072354
786 Ga0495587_0000986
787 Ga0495587_0484597
788 Ga0495621_0222367
789 Ga0495645_0010695
790 Ga0495645_0164690
791 Ga0495645_0406470
792 Ga0495667_0029483
793 Ga0495656_0058696
794 Ga0495656_0164352
795 Ga0495634_0210299
796 Ga0495634_0464860
797 Ga0495635_0010399
798 Ga0495635_0062362
799 Ga0495635_0336658
800 Ga0495588_0623464
801 Ga0495657_0010483
802 Ga0495599_0020642
803 Ga0495599_0031389
804 Ga0495623_0053980
805 Ga0495646_0042925
806 Ga0495646_0150916
807 Ga0495647_0077150
808 Ga0495613_0209149
809 Ga0495624_0096869
810 Ga0495600_0075434
811 Ga0495600_0205518
812 Ga0495581_0160055
813 Ga0495604_0067099
814 Ga0495604_0188992
815 Ga0495674_0256557
816 Ga0495674_0395460
817 Ga0495676_0520574
818 Ga0495680_0013220
819 Ga0495680_0230315
820 Ga0495675_0016784
821 Ga0495685_121090
822 Ga0495684_0009442
823 Ga0495684_0057262
824 Ga0495684_0526300
825 Ga0495686_0021298
826 Ga0495593_0186082
827 Ga0495602_0045191
828 Ga0495602_1091095
829 Ga0495614_0138531
830 Ga0496100_0183125
831 Ga0496100_1602115
832 Ga0496103_0336822
833 Ga0496104_0003894
834 Ga0496104_0043341
835 Ga0496105_0009130
836 Ga0496105_0039061
837 Ga0496105_0381539
838 Ga0496106_0057468
839 Ga0496106_0124314
840 Ga0496108_0004450
841 Ga0496108_0005414
842 Ga0496109_0015186
843 Ga0496109_0023338
844 Ga0496110_0043054
845 Ga0496110_0066219
846 Ga0496111_0083465
847 Ga0496111_0105804
848 Ga0496112_0001113
849 Ga0496113_0020453
850 Ga0496114_0095101
851 Ga0496114_0173036
852 Ga0496114_0319611
853 Ga0496115_0017799
854 Ga0496115_0219039
855 Ga0496123_0097160
856 Ga0496126_0033947
857 Ga0496126_0603973
858 Ga0501034_0123432
859 Ga0501068_0231606
860 Ga0501070_0081735
861 Ga0501070_0321079
862 Ga0501202_082183
863 Ga0501202_120836
864 Ga0501243_137702
865 Ga0501252_078071
866 Ga0501080_0009086
867 Ga0501044_0294865
868 Ga0501212_055811
869 nmdc:mga00v17_35491_c1
870 nmdc:mga0yw44_198181_c1
871 nmdc:mga06z11_418503_c1
872 nmdc:mga04h51_29290_c1
873 Ga0495601_0371019
874 Ga0495612_0074546
875 Ga0495612_0115030
876 Ga0495595_0085331
877 Ga0495619_0069425
878 Ga0495619_0070836
879 Ga0495619_0723126
880 Ga0466962_0119634
881 2644136487
882 2928144035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

18

86

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.869 30 84
6kcz-assembly1.cif.gz_A solution structure of the znf-ubp domain of usp20/vdu2 0.8397 31 81
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7705 11 101
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.7594 1 81
5g0f-assembly1.cif.gz_A crystal structure of danio rerio hdac6 znf-ubp domain 0.7502 1 81
ID Description Score Start End Superfamily
af_Q7Z569_302_376_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9137 31 84 3.30.40.10
af_Q9GRV2_34_127_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8805 28 83 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.874 11 88 3.30.40.10
af_Q54QE6_6_116_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.863 16 84 3.30.40.10
af_Q55EJ1_913_1015_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8622 16 84 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A7W1GCI9-F1-model_v4 UBP-type zinc finger domain-containing protein 0.965 13 82 GO:0008270
AF-A0A1Q7VFD7-F1-model_v4 UBP-type domain-containing protein 0.9605 7 64 GO:0008270
AF-A0A7W1W9J3-F1-model_v4 NAD-binding protein 0.9585 13 82 GO:0006813
GO:0008270
GO:0008324
GO:0016020
AF-A0A160T6M6-F1-model_v4 Zinc finger UBP-type protein (Modular protein) 0.956 13 81 GO:0008270
AF-A0A4R1IKI1-F1-model_v4 deleted 0.9546 18 81

Map