F444699

General Info

Members Datasets Scaffolds Average Seq Length
441 341 882 223

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0485195|Ga0436365_0485195_305_1087
Length 260
Sequence MGRLGCWRATGLGGSRRGGAARKNQQLRWERQEMGLVLNLLVQTVVWFGFMGAIIFVAAGTIDYAGGWLYLGEMVAISVVSGLHMVRVDPGLLKERLKLPVQKDQPLADKLVLIPFLVLVFGAIGFMAADAARWQWSMMSPAVQWAGCGLLLAAFLFISWTMRTNSFAAPVVKIQKERGQVVITTGPYAIVRHPLYFGALFYIAGTSLVLGSWWGLATVPVLALLLGIRIGIEEKALRMGLKGYDDYASRVRWRLIPLIW

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
154 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
155 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
156 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
157 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
158 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
159 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
160 2512875024
161 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
162 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
163 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
164 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
165 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
166 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
167 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
168 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
169 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
170 2818991467 Bosea vestrisii 3192 Isolate Unclassified
171 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
172 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
173 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
174 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
175 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
176 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
177 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
178 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
179 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
180 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
181 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
182 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
183 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
184 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
185 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
186 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
187 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
188 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
189 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
190 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
191 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
192 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
193 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
194 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
195 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
196 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
197 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
198 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
199 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
200 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
201 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
202 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
203 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
204 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
205 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
206 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
207 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
208 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
209 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
210 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
211 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
212 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
213 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
214 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
215 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
216 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
217 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
218 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
219 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
220 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
221 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
222 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
223 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
224 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
225 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
226 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
227 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
228 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
229 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
230 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
231 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
232 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
233 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
234 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
235 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
236 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
237 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
238 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
239 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
240 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
241 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
242 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
243 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
244 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
245 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
246 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
247 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
248 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
249 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
250 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
251 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
252 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
253 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
254 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
255 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
256 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
257 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
258 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
259 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
260 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
261 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
262 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
263 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
264 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
265 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
266 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
267 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
268 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
269 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
270 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
271 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
272 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
273 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
274 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
275 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
276 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
277 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
278 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
279 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
280 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
281 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
282 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
283 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
284 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
285 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
286 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
287 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
288 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
289 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
290 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
291 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
292 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
293 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
294 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
295 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
296 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
297 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
298 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
299 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
300 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
301 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
302 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
303 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
304 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
305 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
306 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
307 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
308 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
309 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
310 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
311 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
312 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
313 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
314 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
315 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
316 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
317 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
318 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
319 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
320 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
321 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
322 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
323 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
324 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
325 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
326 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
327 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
328 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
329 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
330 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
331 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
332 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
333 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
334 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
335 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
336 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
337 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
338 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
339 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
340 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
341 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.82
Metatranscriptomes 0
Isolates 42.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.47
Nodule 38.32
Rhizoplane 1.59
Rhizosphere 36.28
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0485195 3300039437 Bacteria 1143
2 JGI25157J39369_1001549 3300002741 Bacteria 8294
3 JGI25165J46597_1000325 3300003214 Bacteria 57094
4 rootH1_10062730 3300003323 Bacteria 7544
5 JGI25160J50197_1000078 3300003354 Bacteria 102092
6 JGI25161J50226_1000059 3300003374 Bacteria 102092
7 Ga0055542_1000740 3300003762 Bacteria 25274
8 Ga0055543_1000058 3300004625 Bacteria 102130
9 Ga0065165_1000400 3300005262 Bacteria 69947
10 Ga0065715_10208228 3300005293 Bacteria 1327
11 Ga0065715_10231680 3300005293 Bacteria 1231
12 Ga0070660_100342707 3300005339 Bacteria 1230
13 Ga0070688_100180341 3300005365 Bacteria 1464
14 Ga0070688_100430486 3300005365 Bacteria 982
15 Ga0070659_100842152 3300005366 Bacteria 799
16 Ga0070667_100335925 3300005367 Bacteria 1366
17 Ga0070663_100015063 3300005455 Bacteria 4978
18 Ga0070663_100737526 3300005455 Bacteria 840
19 Ga0070681_10656688 3300005458 Bacteria 964
20 Ga0070685_10001142 3300005466 Bacteria 14183
21 Ga0068853_100075284 3300005539 Bacteria 2946
22 Ga0068853_100191583 3300005539 Bacteria 1858
23 Ga0068853_100573935 3300005539 Bacteria 1070
24 Ga0070672_100210379 3300005543 Bacteria 1629
25 Ga0070665_100000630 3300005548 Bacteria 47966
26 Ga0070665_100045802 3300005548 Bacteria 4393
27 Ga0070665_100062231 3300005548 Bacteria 3742
28 Ga0070665_100232967 3300005548 Bacteria 1842
29 Ga0068855_100252217 3300005563 Bacteria 1968
30 Ga0070664_100173562 3300005564 Bacteria 1913
31 Ga0068857_100397090 3300005577 Bacteria 1283
32 Ga0068854_100559714 3300005578 Bacteria 971
33 Ga0068856_100113178 3300005614 Bacteria 2712
34 Ga0068856_100430469 3300005614 Bacteria 1340
35 Ga0068852_100050999 3300005616 Bacteria 3549
36 Ga0068852_100296118 3300005616 Bacteria 1565
37 Ga0081455_10167978 3300005937 Bacteria 1674
38 Ga0075365_10035054 3300006038 Bacteria 3244
39 Ga0075365_10082064 3300006038 Bacteria 2185
40 Ga0075368_10013248 3300006042 Unclassified 3026
41 Ga0075363_100056803 3300006048 Bacteria 2099
42 Ga0075363_100102373 3300006048 Bacteria 1586
43 Ga0075364_10012401 3300006051 Bacteria 5211
44 Ga0075364_10177633 3300006051 Bacteria 1440
45 Ga0075364_10267334 3300006051 Bacteria 1163
46 Ga0075362_10147542 3300006177 Bacteria 1127
47 Ga0075367_10003481 3300006178 Bacteria 7511
48 Ga0075367_10092672 3300006178 Bacteria 1839
49 Ga0075367_10230658 3300006178 Unclassified 1159
50 Ga0075369_10013214 3300006186 Bacteria 3272
51 Ga0075369_10036602 3300006186 Bacteria 2088
52 Ga0075369_10204366 3300006186 Unclassified 912
53 Ga0075366_10094906 3300006195 Bacteria 1788
54 Ga0075370_10037132 3300006353 Bacteria 2738
55 Ga0075370_10073946 3300006353 Bacteria 1953
56 Ga0075370_10172659 3300006353 Bacteria 1271
57 Ga0075428_100012504 3300006844 Bacteria 9440
58 Ga0075428_100441681 3300006844 Bacteria 1393
59 Ga0075430_100346060 3300006846 Bacteria 1228
60 Ga0075431_100000781 3300006847 Bacteria 27706
61 Ga0075429_100000009 3300006880 Bacteria 85110
62 Ga0075429_100051264 3300006880 Bacteria 3591
63 Ga0105240_10006136 3300009093 Bacteria 17726
64 Ga0105240_10179337 3300009093 Bacteria 2501
65 Ga0105240_10547076 3300009093 Bacteria 1281
66 Ga0105240_10913192 3300009093 Bacteria 944
67 Ga0111539_10133315 3300009094 Bacteria 2909
68 Ga0111539_10566632 3300009094 Bacteria 1323
69 Ga0111539_11045902 3300009094 Unclassified 949
70 Ga0114129_10039159 3300009147 Bacteria 6684
71 Ga0114129_10081935 3300009147 Bacteria 4485
72 Ga0105243_10015603 3300009148 Bacteria 5743
73 Ga0105243_10604822 3300009148 Bacteria 1056
74 Ga0105241_10044735 3300009174 Bacteria 3356
75 Ga0105241_10170142 3300009174 Bacteria 1799
76 Ga0105248_10060658 3300009177 Bacteria 4247
77 Ga0105237_10039699 3300009545 Bacteria 4750
78 Ga0105237_10048070 3300009545 Bacteria 4289
79 Ga0105237_10241777 3300009545 Bacteria 1806
80 Ga0105237_10666844 3300009545 Bacteria 1047
81 Ga0105238_10002296 3300009551 Bacteria 19259
82 Ga0105238_10019029 3300009551 Bacteria 6994
83 Ga0105238_10093883 3300009551 Bacteria 2988
84 Ga0105238_10122033 3300009551 Bacteria 2585
85 Ga0105238_10125788 3300009551 Bacteria 2542
86 Ga0105249_10294573 3300009553 Bacteria 1625
87 Ga0105249_10625843 3300009553 Bacteria 1132
88 Ga0123342_1010287 3300009766 Bacteria 10792
89 Ga0105239_10064340 3300010375 Bacteria 4026
90 Ga0105239_10165284 3300010375 Bacteria 2474
91 Ga0105239_10219990 3300010375 Bacteria 2129
92 Ga0105239_10263016 3300010375 Bacteria 1939
93 Ga0105239_10336863 3300010375 Bacteria 1702
94 Ga0105246_10097092 3300011119 Bacteria 2137
95 Ga0157370_10321541 3300013104 Bacteria 1427
96 Ga0157369_10097792 3300013105 Bacteria 3131
97 Ga0157374_10207437 3300013296 Bacteria 1921
98 Ga0157374_10443607 3300013296 Bacteria 1299
99 Ga0163162_10208425 3300013306 Bacteria 2084
100 Ga0163162_10747866 3300013306 Bacteria 1097
101 Ga0163163_10109719 3300014325 Bacteria 2786
102 Ga0182008_10174239 3300014497 Bacteria 1087
103 Ga0157379_10358742 3300014968 Bacteria 1336
104 Ga0157376_10528607 3300014969 Bacteria 1164
105 Ga0182006_1043326 3300015261 Bacteria 1760
106 Ga0213876_10400400 3300021384 Bacteria 730
107 Ga0213875_10002153 3300021388 Bacteria 12022
108 Ga0213875_10009431 3300021388 Bacteria 4943
109 Ga0209026_1000024 3300025250 Bacteria 355839
110 Ga0209148_1000050 3300025254 Bacteria 413178
111 Ga0209759_1000302 3300025256 Bacteria 67678
112 Ga0209233_1000027 3300025261 Bacteria 652089
113 Ga0209233_1000902 3300025261 Bacteria 12986
114 Ga0209233_1004429 3300025261 Bacteria 4778
115 Ga0209233_1010301 3300025261 Bacteria 2808
116 Ga0209455_1002271 3300025272 Bacteria 7561
117 Ga0209455_1014032 3300025272 Bacteria 1830
118 Ga0209130_1000221 3300025284 Bacteria 74712
119 Ga0209758_1004620 3300025297 Bacteria 11297
120 Ga0207426_1000083 3300025302 Bacteria 298770
121 Ga0207647_10010440 3300025904 Bacteria 6560
122 Ga0207647_10015543 3300025904 Bacteria 5215
123 Ga0207707_10034560 3300025912 Bacteria 4423
124 Ga0207695_10000487 3300025913 Bacteria 84845
125 Ga0207695_10095335 3300025913 Bacteria 2980
126 Ga0207671_10012218 3300025914 Bacteria 6922
127 Ga0207671_10132123 3300025914 Bacteria 1917
128 Ga0207671_10347718 3300025914 Bacteria 1175
129 Ga0207693_10550622 3300025915 Bacteria 899
130 Ga0207657_10073982 3300025919 Bacteria 2878
131 Ga0207652_10201678 3300025921 Unclassified 1790
132 Ga0207694_10001683 3300025924 Bacteria 18534
133 Ga0207694_10045391 3300025924 Bacteria 3395
134 Ga0207687_10224732 3300025927 Bacteria 1480
135 Ga0207644_10125511 3300025931 Bacteria 1959
136 Ga0207706_10152420 3300025933 Bacteria 2033
137 Ga0207709_10766412 3300025935 Bacteria 777
138 Ga0207669_10366488 3300025937 Bacteria 1118
139 Ga0207667_10389824 3300025949 Bacteria 1419
140 Ga0207712_10761018 3300025961 Bacteria 849
141 Ga0207658_10289966 3300025986 Bacteria 1406
142 Ga0207703_10429054 3300026035 Bacteria 1231
143 Ga0207639_10012861 3300026041 Bacteria 5839
144 Ga0207639_10207789 3300026041 Bacteria 1683
145 Ga0207639_10408751 3300026041 Bacteria 1224
146 Ga0207678_10020638 3300026067 Bacteria 5775
147 Ga0207702_10386206 3300026078 Bacteria 1347
148 Ga0207674_10181837 3300026116 Bacteria 2054
149 Ga0207674_10228501 3300026116 Bacteria 1809
150 Ga0207698_10010000 3300026142 Bacteria 6073
151 Ga0207698_10070005 3300026142 Bacteria 2777
152 Ga0207698_10213799 3300026142 Bacteria 1737
153 Ga0268266_10001019 3300028379 Bacteria 35295
154 Ga0268266_10227109 3300028379 Bacteria 1718
155 Ga0268266_10237892 3300028379 Bacteria 1679
156 Ga0268266_10309921 3300028379 Bacteria 1475
157 Ga0265338_10001292 3300028800 Bacteria 41039
158 Ga0373927_0337429 3300035695 Bacteria 993
159 Ga0373937_0452684 3300036401 Unclassified 1219
160 Ga0395900_0022209 3300037418 Bacteria 6491
161 Ga0395898_0493227 3300037466 Bacteria 1165
162 Ga0395905_0009224 3300037471 Bacteria 9661
163 Ga0395905_0548178 3300037471 Bacteria 1058
164 Ga0436364_0183978 3300037853 Bacteria 2662
165 Ga0436364_0226381 3300037853 Bacteria 2805
166 Ga0436364_0358205 3300037853 Bacteria 23269
167 Ga0436364_0527661 3300037853 Bacteria 1567
168 Ga0436364_1098415 3300037853 Bacteria 1612
169 Ga0436364_1130678 3300037853 Bacteria 1802
170 Ga0436364_1524866 3300037853 Bacteria 2010
171 Ga0436365_1556165 3300039437 Bacteria 1037
172 Ga0436365_1792826 3300039437 Bacteria 2565
173 Ga0436360_0371721 3300039438 Bacteria 1224
174 Ga0436360_0610855 3300039438 Bacteria 5232
175 Ga0436360_0968805 3300039438 Bacteria 1188
176 Ga0436361_0518054 3300039447 Bacteria 1701
177 Ga0436361_0687117 3300039447 Bacteria 1848
178 Ga0436361_1184170 3300039447 Bacteria 1362
179 Ga0436363_0376588 3300039450 Bacteria 879
180 Ga0436363_0401940 3300039450 Bacteria 957
181 Ga0436363_1090873 3300039450 Bacteria 5826
182 Ga0436363_1236509 3300039450 Bacteria 2113
183 Ga0436362_0011336 3300039453 Unclassified 928
184 Ga0436362_0294503 3300039453 Bacteria 971
185 Ga0436362_0633419 3300039453 Bacteria 941
186 Ga0466972_0007406 3300044658 Bacteria 5516
187 Ga0453684_0011829 3300044712 Bacteria 14544
188 Ga0451576_0012443 3300045051 Bacteria 9557
189 Ga0466967_0961876 3300045976 Bacteria 850
190 Ga0495662_0021283 3300046476 Bacteria 3135
191 Ga0495583_0024076 3300046506 Bacteria 3066
192 Ga0495606_0000995 3300046507 Bacteria 41346
193 Ga0495606_0221458 3300046507 Bacteria 1066
194 Ga0495610_0063823 3300046512 Bacteria 1743
195 Ga0495632_0101473 3300046519 Bacteria 1356
196 Ga0495643_0015065 3300046522 Bacteria 4581
197 Ga0495597_0060617 3300046542 Bacteria 1650
198 Ga0495635_0053234 3300046663 Bacteria 2789
199 Ga0495588_0001055 3300046674 Bacteria 11982
200 Ga0495649_0199700 3300046694 Bacteria 1039
201 Ga0495600_0099124 3300046809 Bacteria 1899
202 Ga0495604_0004068 3300047317 Bacteria 11623
203 Ga0495683_0036316 3300047323 Bacteria 2502
204 Ga0496102_0099870 3300048905 Bacteria 2694
205 Ga0496102_1030264 3300048905 Bacteria 743
206 Ga0496105_0164279 3300048908 Bacteria 1822
207 Ga0496109_0209038 3300048912 Bacteria 1835
208 Ga0496110_0772752 3300048913 Bacteria 864
209 Ga0496115_0033568 3300048918 Bacteria 4052
210 Ga0496116_0081658 3300048919 Bacteria 2003
211 Ga0496117_0241583 3300048920 Bacteria 991
212 Ga0496118_0275345 3300048921 Bacteria 940
213 Ga0496119_0030066 3300048922 Bacteria 3669
214 Ga0496120_0006790 3300048923 Bacteria 8678
215 Ga0496120_0018676 3300048923 Bacteria 4460
216 Ga0496121_0007858 3300048924 Bacteria 12756
217 Ga0496121_0032825 3300048924 Bacteria 4710
218 Ga0496121_0113749 3300048924 Bacteria 2059
219 Ga0496121_0375843 3300048924 Bacteria 939
220 Ga0496122_0014494 3300048925 Bacteria 7611
221 Ga0496123_0052198 3300048926 Bacteria 2715
222 Ga0496124_0025579 3300048927 Bacteria 5345
223 Ga0496125_0066345 3300048928 Bacteria 2853
224 Ga0496125_0410870 3300048928 Bacteria 788
225 Ga0495682_0180706 3300049460 Bacteria 750
226 nmdc:mga03n38_93660_c1 3300050490 Bacteria 1435
227 nmdc:mga00v17_97575_c1 3300050491 Bacteria 1852
228 nmdc:mga0yw44_21757_c1 3300050492 Bacteria 3584
229 nmdc:mga0yw44_224908_c1 3300050492 Bacteria 1245
230 nmdc:mga0yw44_2757_c1 3300050492 Bacteria 7601
231 nmdc:mga0yw44_64224_c1 3300050492 Bacteria 2259
232 nmdc:mga0k408_106446_c1 3300050493 Bacteria 1657
233 nmdc:mga06z11_127217_c1 3300050494 Bacteria 1427
234 nmdc:mga06z11_17463_c1 3300050494 Bacteria 3257
235 nmdc:mga06z11_94495_c1 3300050494 Bacteria 1629
236 nmdc:mga06z11_95388_c1 3300050494 Bacteria 1623
237 nmdc:mga04h51_46337_c1 3300050495 Bacteria 1441
238 nmdc:mga07m45_154516_c1 3300050496 Bacteria 1331
239 nmdc:mga07m45_55245_c1 3300050496 Bacteria 2244
240 nmdc:mga05p37_103_c1 3300050507 Bacteria 76610
241 nmdc:mga05p37_176367_c1 3300050507 Bacteria 2603
242 nmdc:mga09592_287424_c2 3300050508 Bacteria 1113
243 nmdc:mga09592_9_c1 3300050508 Bacteria 108110
244 nmdc:mga0qj67_53141_c1 3300050509 Bacteria 3206
245 nmdc:mga06r32_2368_c2 3300050510 Bacteria 15697
246 nmdc:mga08y16_1491_c1 3300050511 Bacteria 23546
247 nmdc:mga08y16_491937_c1 3300050511 Bacteria 1247
248 nmdc:mga08y16_802187_c1 3300050511 Unclassified 934
249 nmdc:mga0sz30_30717_c1 3300050516 Bacteria 1772
250 nmdc:mga0sz30_9406_c2 3300050516 Bacteria 3297
251 Ga0495619_0183978 3300053085 Bacteria 1446
252 Ga0500578_0211417 3300053086 Bacteria 1183
253 Ga0500595_055389 3300053119 Bacteria 1215
254 Ga0500590_000501 3300053148 Bacteria 13503
255 Ga0500622_0000863 3300053156 Bacteria 25812
256 2503202099 2503198000 Bacteria 6884444
257 2511182884 2510917028 Bacteria 6185411
258 2512931005 2512875016 Bacteria 6529530
259 2512958735 2512875024 Bacteria 7195110
260 2513611052 2513237090 Bacteria 7096802
261 2513645621 2513237095 Bacteria 8976980
262 2514034850 2513237164 Bacteria 7563725
263 2514418524 2513237305 Bacteria 7293571
264 2588516692 2588253730 Bacteria 6881675
265 2599940464 2599185301 Bacteria 6161860
266 2694636378 2693429784 Bacteria 7241525
267 2723575856 2721755686 Bacteria 7343952
268 2818238666 2816332527 Bacteria 8933356
269 2819717993 2818991467 Bacteria 5893227
270 2844006313 2844002411 Bacteria 7168230
271 2856334069 2856328259 Bacteria 6528202
272 2856341209 2856334872 Bacteria 7037011
273 2856354493 2856349417 Bacteria 6230045
274 2856370607 2856364286 Bacteria 6939991
275 2857350561 2857349434 Bacteria 7926032
276 2857374564 2857367948 Bacteria 6965560
277 2869245722 2869242130 Bacteria 6609239
278 2869264333 2869264136 Bacteria 6880765
279 2869276801 2869271264 Bacteria 6908218
280 2869291665 2869285874 Bacteria 6901219
281 2871434875 2871429161 Bacteria 6547891
282 2871461087 2871459585 Bacteria 6866887
283 2871470875 2871466892 Bacteria 6923287
284 2871485185 2871481445 Bacteria 6700002
285 2871495497 2871488783 Bacteria 6929816
286 2871502767 2871495908 Bacteria 6935695
287 2874120258 2874116593 Bacteria 6674494
288 2874135058 2874131515 Bacteria 6820270
289 2874149264 2874146452 Bacteria 7533118
290 2874157529 2874155637 Bacteria 6724144
291 2874165547 2874162495 Bacteria 6174670
292 2876365844 2876363079 Bacteria 6544991
293 2876391684 2876386047 Bacteria 6698674
294 2876394697 2876392853 Bacteria 6660880
295 2876402193 2876399893 Bacteria 6927900
296 2876410870 2876406927 Bacteria 6191900
297 2876415731 2876413966 Bacteria 6831344
298 2876424803 2876420981 Bacteria 6687741
299 2878752009 2878745973 Bacteria 6867388
300 2878757879 2878753008 Bacteria 6922523
301 2878766659 2878760144 Bacteria 6823465
302 2878773856 2878767105 Bacteria 6898628
303 2878777368 2878774303 Bacteria 6108671
304 2878783415 2878781027 Bacteria 6834456
305 2881152049 2881147464 Bacteria 7779814
306 2881155771 2881155292 Bacteria 6461656
307 2881168026 2881161766 Bacteria 7127907
308 2881851104 2881845957 Bacteria 6611900
309 2881860704 2881853255 Bacteria 6698367
310 2881862297 2881861095 Bacteria 7128710
311 2882637106 2882632389 Bacteria 8154593
312 2882913761 2882912400 Bacteria 6801539
313 2885309910 2885305155 Bacteria 7348390
314 2885323851 2885318864 Bacteria 6729568
315 2885331821 2885326080 Bacteria 7134805
316 2885341663 2885334103 Bacteria 7216818
317 2885342972 2885342637 Bacteria 7011821
318 2885356101 2885350715 Bacteria 6787678
319 2888356274 2888350351 Bacteria 7372807
320 2889011199 2889010040 Bacteria 6749192
321 2889017076 2889016732 Bacteria 6700763
322 2903455532 2903448605 Bacteria 7357801
323 2903493432 2903492973 Bacteria 13473544
324 2903506625 2903492973 Bacteria 13473544
325 2903523832 2903521522 Bacteria 6525694
326 2903534307 2903528002 Bacteria 6586099
327 2903547906 2903540706 Bacteria 7062119
328 2904661329 2904659560 Bacteria 6685615
329 2906314403 2906308376 Bacteria 6841989
330 2906327572 2906321335 Bacteria 6579571
331 2906359828 2906354277 Bacteria 6991324
332 2906363733 2906363423 Bacteria 6856682
333 2906373572 2906370794 Bacteria 6881062
334 2906391432 2906386501 Bacteria 5977019
335 2906397415 2906393657 Bacteria 6790866
336 2906407120 2906401398 Bacteria 6693206
337 2906410676 2906408224 Bacteria 6162342
338 2906429177 2906427513 Bacteria 6375796
339 2922131746 2922130491 Bacteria 7173936
340 2922154352 2922151315 Bacteria 6902399
341 2922175976 2922172374 Bacteria 6167644
342 2922188751 2922185730 Bacteria 7113964
343 2922389235 2922386360 Bacteria 7017218
344 2923560265 2923556063 Bacteria 6793593
345 2924739532 2924733363 Bacteria 7574837
346 2924744978 2924741084 Bacteria 6661321
347 2924749564 2924748358 Bacteria 6154725
348 2924784593 2924784321 Bacteria 7416538
349 2937816293 2937813078 Bacteria 7783518
350 2937854988 2937848649 Bacteria 6983481
351 2937863647 2937861824 Bacteria 6660327
352 2937873517 2937868953 Bacteria 6639878
353 2937987453 2937980651 Bacteria 6517427
354 2938001784 2937994558 Bacteria 7036190
355 2958056299 2958041894 Bacteria 13082850
356 2958067888 2958064165 Bacteria 7158582
357 2958101517 2958100919 Bacteria 6800575
358 2958114921 2958108152 Bacteria 6681128
359 2958129269 2958122699 Bacteria 7280457
360 2958136065 2958130278 Bacteria 6897202
361 2958137857 2958137437 Bacteria 6050276
362 2958164848 2958158011 Bacteria 6058449
363 2958171839 2958165035 Bacteria 6906348
364 2958175088 2958172287 Bacteria 6716688
365 2958185532 2958179912 Bacteria 6874908
366 2961083910 2961077736 Bacteria 7079850
367 2961116483 2961114664 Bacteria 6680456
368 2961128709 2961127735 Bacteria 7196641
369 2961142254 2961136820 Bacteria 6775228
370 2961170285 2961163497 Bacteria 6901077
371 2961174423 2961170736 Bacteria 7072258
372 2961185437 2961183825 Bacteria 6688536
373 2963648219 2963644680 Bacteria 6530403
374 2965025031 2965018300 Bacteria 6883036
375 2965027788 2965025482 Bacteria 6532201
376 2965037780 2965032056 Bacteria 6887443
377 2965042246 2965040258 Bacteria 6855979
378 2965052923 2965047637 Bacteria 6623551
379 2965089604 2965089291 Bacteria 6866420
380 2965107692 2965102966 Bacteria 6800987
381 2965115658 2965110997 Bacteria 6693150
382 2965122300 2965119406 Bacteria 6956431
383 2968000414 2967996073 Bacteria 6787468
384 2968003675 2968003550 Bacteria 6929263
385 2968091042 2968083720 Bacteria 7351627
386 2968112389 2968110612 Bacteria 6814636
387 2968121183 2968117919 Bacteria 6536078
388 2968145135 2968138860 Bacteria 6605449
389 2968178672 2968171901 Bacteria 6894245
390 2970507010 2970503327 Bacteria 7099517
391 2970513018 2970510686 Bacteria 7006402
392 2970537725 2970532167 Bacteria 6553173
393 2970549440 2970547951 Bacteria 6931819
394 2970561517 2970554993 Bacteria 6814252
395 2970624189 2970619444 Bacteria 6986144
396 2970633734 2970627176 Bacteria 6680862
397 2977822412 2977821940 Bacteria 6906439
398 2977833481 2977828996 Bacteria 7007971
399 2977846527 2977843712 Bacteria 6753583
400 2977855479 2977851361 Bacteria 6694324
401 2977874085 2977872689 Bacteria 7270173
402 2977907957 2977907340 Bacteria 6577984
403 2977920883 2977915119 Bacteria 6829656
404 2977929341 2977922695 Bacteria 6956781
405 2977936891 2977935797 Bacteria 6252826
406 2977947726 2977942078 Bacteria 7570577
407 2977955476 2977950692 Bacteria 6893264
408 2977959624 2977957713 Bacteria 6877875
409 2977978202 2977971508 Bacteria 7472917
410 2977987491 2977986579 Bacteria 6581278
411 2979714429 2979710463 Bacteria 6785254
412 2979770556 2979764755 Bacteria 6610066
413 2979774839 2979772303 Bacteria 6618277
414 2979793318 2979793036 Bacteria 6808957
415 2979812205 2979808191 Bacteria 7179355
416 2987637745 2987636660 Bacteria 8088555
417 2987646173 2987645492 Bacteria 6117018
418 2987658586 2987652177 Bacteria 6969023
419 2987666526 2987659509 Bacteria 6966464
420 2987673543 2987673487 Bacteria 6884027
421 3004195528 3004188549 Bacteria 6952365
422 3004196628 3004195979 Bacteria 6776956
423 3004205933 3004203850 Bacteria 7307914
424 3004211801 3004211236 Bacteria 7417683
425 3004219048 3004218560 Bacteria 7421728
426 3004246881 3004239961 Bacteria 6892290
427 3004251024 3004248173 Bacteria 6563236
428 3004274609 3004268573 Bacteria 7043476
429 3004341155 3004334049 Bacteria 8449246
430 637074046 637000159 Bacteria 7596297
431 649874054 649633066 Bacteria 6690028
432 8004305826 8004300914 Bacteria 6132239
433 8004320982 8004312739 Bacteria 7444653
434 8004365897 8004361976 Bacteria 6858373
435 8004379391 8004374579 Bacteria 6898112
436 8004394608 8004387939 Bacteria 7049250
437 8004640234 8004640170 Bacteria 6723001
438 8004698265 8004695233 Bacteria 6731676
439 8004720666 8004714634 Bacteria 6776161
440 8004727699 8004727605 Bacteria 6643904
441 8057582315 8057575449 Bacteria 7367519
442 Ga0436365_0485195
443 JGI25157J39369_1001549
444 JGI25165J46597_1000325
445 rootH1_10062730
446 JGI25160J50197_1000078
447 JGI25161J50226_1000059
448 Ga0055542_1000740
449 Ga0055543_1000058
450 Ga0065165_1000400
451 Ga0065715_10208228
452 Ga0065715_10231680
453 Ga0070660_100342707
454 Ga0070688_100180341
455 Ga0070688_100430486
456 Ga0070659_100842152
457 Ga0070667_100335925
458 Ga0070663_100015063
459 Ga0070663_100737526
460 Ga0070681_10656688
461 Ga0070685_10001142
462 Ga0068853_100075284
463 Ga0068853_100191583
464 Ga0068853_100573935
465 Ga0070672_100210379
466 Ga0070665_100000630
467 Ga0070665_100045802
468 Ga0070665_100062231
469 Ga0070665_100232967
470 Ga0068855_100252217
471 Ga0070664_100173562
472 Ga0068857_100397090
473 Ga0068854_100559714
474 Ga0068856_100113178
475 Ga0068856_100430469
476 Ga0068852_100050999
477 Ga0068852_100296118
478 Ga0081455_10167978
479 Ga0075365_10035054
480 Ga0075365_10082064
481 Ga0075368_10013248
482 Ga0075363_100056803
483 Ga0075363_100102373
484 Ga0075364_10012401
485 Ga0075364_10177633
486 Ga0075364_10267334
487 Ga0075362_10147542
488 Ga0075367_10003481
489 Ga0075367_10092672
490 Ga0075367_10230658
491 Ga0075369_10013214
492 Ga0075369_10036602
493 Ga0075369_10204366
494 Ga0075366_10094906
495 Ga0075370_10037132
496 Ga0075370_10073946
497 Ga0075370_10172659
498 Ga0075428_100012504
499 Ga0075428_100441681
500 Ga0075430_100346060
501 Ga0075431_100000781
502 Ga0075429_100000009
503 Ga0075429_100051264
504 Ga0105240_10006136
505 Ga0105240_10179337
506 Ga0105240_10547076
507 Ga0105240_10913192
508 Ga0111539_10133315
509 Ga0111539_10566632
510 Ga0111539_11045902
511 Ga0114129_10039159
512 Ga0114129_10081935
513 Ga0105243_10015603
514 Ga0105243_10604822
515 Ga0105241_10044735
516 Ga0105241_10170142
517 Ga0105248_10060658
518 Ga0105237_10039699
519 Ga0105237_10048070
520 Ga0105237_10241777
521 Ga0105237_10666844
522 Ga0105238_10002296
523 Ga0105238_10019029
524 Ga0105238_10093883
525 Ga0105238_10122033
526 Ga0105238_10125788
527 Ga0105249_10294573
528 Ga0105249_10625843
529 Ga0123342_1010287
530 Ga0105239_10064340
531 Ga0105239_10165284
532 Ga0105239_10219990
533 Ga0105239_10263016
534 Ga0105239_10336863
535 Ga0105246_10097092
536 Ga0157370_10321541
537 Ga0157369_10097792
538 Ga0157374_10207437
539 Ga0157374_10443607
540 Ga0163162_10208425
541 Ga0163162_10747866
542 Ga0163163_10109719
543 Ga0182008_10174239
544 Ga0157379_10358742
545 Ga0157376_10528607
546 Ga0182006_1043326
547 Ga0213876_10400400
548 Ga0213875_10002153
549 Ga0213875_10009431
550 Ga0209026_1000024
551 Ga0209148_1000050
552 Ga0209759_1000302
553 Ga0209233_1000027
554 Ga0209233_1000902
555 Ga0209233_1004429
556 Ga0209233_1010301
557 Ga0209455_1002271
558 Ga0209455_1014032
559 Ga0209130_1000221
560 Ga0209758_1004620
561 Ga0207426_1000083
562 Ga0207647_10010440
563 Ga0207647_10015543
564 Ga0207707_10034560
565 Ga0207695_10000487
566 Ga0207695_10095335
567 Ga0207671_10012218
568 Ga0207671_10132123
569 Ga0207671_10347718
570 Ga0207693_10550622
571 Ga0207657_10073982
572 Ga0207652_10201678
573 Ga0207694_10001683
574 Ga0207694_10045391
575 Ga0207687_10224732
576 Ga0207644_10125511
577 Ga0207706_10152420
578 Ga0207709_10766412
579 Ga0207669_10366488
580 Ga0207667_10389824
581 Ga0207712_10761018
582 Ga0207658_10289966
583 Ga0207703_10429054
584 Ga0207639_10012861
585 Ga0207639_10207789
586 Ga0207639_10408751
587 Ga0207678_10020638
588 Ga0207702_10386206
589 Ga0207674_10181837
590 Ga0207674_10228501
591 Ga0207698_10010000
592 Ga0207698_10070005
593 Ga0207698_10213799
594 Ga0268266_10001019
595 Ga0268266_10227109
596 Ga0268266_10237892
597 Ga0268266_10309921
598 Ga0265338_10001292
599 Ga0373927_0337429
600 Ga0373937_0452684
601 Ga0395900_0022209
602 Ga0395898_0493227
603 Ga0395905_0009224
604 Ga0395905_0548178
605 Ga0436364_0183978
606 Ga0436364_0226381
607 Ga0436364_0358205
608 Ga0436364_0527661
609 Ga0436364_1098415
610 Ga0436364_1130678
611 Ga0436364_1524866
612 Ga0436365_1556165
613 Ga0436365_1792826
614 Ga0436360_0371721
615 Ga0436360_0610855
616 Ga0436360_0968805
617 Ga0436361_0518054
618 Ga0436361_0687117
619 Ga0436361_1184170
620 Ga0436363_0376588
621 Ga0436363_0401940
622 Ga0436363_1090873
623 Ga0436363_1236509
624 Ga0436362_0011336
625 Ga0436362_0294503
626 Ga0436362_0633419
627 Ga0466972_0007406
628 Ga0453684_0011829
629 Ga0451576_0012443
630 Ga0466967_0961876
631 Ga0495662_0021283
632 Ga0495583_0024076
633 Ga0495606_0000995
634 Ga0495606_0221458
635 Ga0495610_0063823
636 Ga0495632_0101473
637 Ga0495643_0015065
638 Ga0495597_0060617
639 Ga0495635_0053234
640 Ga0495588_0001055
641 Ga0495649_0199700
642 Ga0495600_0099124
643 Ga0495604_0004068
644 Ga0495683_0036316
645 Ga0496102_0099870
646 Ga0496102_1030264
647 Ga0496105_0164279
648 Ga0496109_0209038
649 Ga0496110_0772752
650 Ga0496115_0033568
651 Ga0496116_0081658
652 Ga0496117_0241583
653 Ga0496118_0275345
654 Ga0496119_0030066
655 Ga0496120_0006790
656 Ga0496120_0018676
657 Ga0496121_0007858
658 Ga0496121_0032825
659 Ga0496121_0113749
660 Ga0496121_0375843
661 Ga0496122_0014494
662 Ga0496123_0052198
663 Ga0496124_0025579
664 Ga0496125_0066345
665 Ga0496125_0410870
666 Ga0495682_0180706
667 nmdc:mga03n38_93660_c1
668 nmdc:mga00v17_97575_c1
669 nmdc:mga0yw44_21757_c1
670 nmdc:mga0yw44_224908_c1
671 nmdc:mga0yw44_2757_c1
672 nmdc:mga0yw44_64224_c1
673 nmdc:mga0k408_106446_c1
674 nmdc:mga06z11_127217_c1
675 nmdc:mga06z11_17463_c1
676 nmdc:mga06z11_94495_c1
677 nmdc:mga06z11_95388_c1
678 nmdc:mga04h51_46337_c1
679 nmdc:mga07m45_154516_c1
680 nmdc:mga07m45_55245_c1
681 nmdc:mga05p37_103_c1
682 nmdc:mga05p37_176367_c1
683 nmdc:mga09592_287424_c2
684 nmdc:mga09592_9_c1
685 nmdc:mga0qj67_53141_c1
686 nmdc:mga06r32_2368_c2
687 nmdc:mga08y16_1491_c1
688 nmdc:mga08y16_491937_c1
689 nmdc:mga08y16_802187_c1
690 nmdc:mga0sz30_30717_c1
691 nmdc:mga0sz30_9406_c2
692 Ga0495619_0183978
693 Ga0500578_0211417
694 Ga0500595_055389
695 Ga0500590_000501
696 Ga0500622_0000863
697 2503202099
698 2511182884
699 2512931005
700 2512958735
701 2513611052
702 2513645621
703 2514034850
704 2514418524
705 2588516692
706 2599940464
707 2694636378
708 2723575856
709 2818238666
710 2819717993
711 2844006313
712 2856334069
713 2856341209
714 2856354493
715 2856370607
716 2857350561
717 2857374564
718 2869245722
719 2869264333
720 2869276801
721 2869291665
722 2871434875
723 2871461087
724 2871470875
725 2871485185
726 2871495497
727 2871502767
728 2874120258
729 2874135058
730 2874149264
731 2874157529
732 2874165547
733 2876365844
734 2876391684
735 2876394697
736 2876402193
737 2876410870
738 2876415731
739 2876424803
740 2878752009
741 2878757879
742 2878766659
743 2878773856
744 2878777368
745 2878783415
746 2881152049
747 2881155771
748 2881168026
749 2881851104
750 2881860704
751 2881862297
752 2882637106
753 2882913761
754 2885309910
755 2885323851
756 2885331821
757 2885341663
758 2885342972
759 2885356101
760 2888356274
761 2889011199
762 2889017076
763 2903455532
764 2903493432
765 2903506625
766 2903523832
767 2903534307
768 2903547906
769 2904661329
770 2906314403
771 2906327572
772 2906359828
773 2906363733
774 2906373572
775 2906391432
776 2906397415
777 2906407120
778 2906410676
779 2906429177
780 2922131746
781 2922154352
782 2922175976
783 2922188751
784 2922389235
785 2923560265
786 2924739532
787 2924744978
788 2924749564
789 2924784593
790 2937816293
791 2937854988
792 2937863647
793 2937873517
794 2937987453
795 2938001784
796 2958056299
797 2958067888
798 2958101517
799 2958114921
800 2958129269
801 2958136065
802 2958137857
803 2958164848
804 2958171839
805 2958175088
806 2958185532
807 2961083910
808 2961116483
809 2961128709
810 2961142254
811 2961170285
812 2961174423
813 2961185437
814 2963648219
815 2965025031
816 2965027788
817 2965037780
818 2965042246
819 2965052923
820 2965089604
821 2965107692
822 2965115658
823 2965122300
824 2968000414
825 2968003675
826 2968091042
827 2968112389
828 2968121183
829 2968145135
830 2968178672
831 2970507010
832 2970513018
833 2970537725
834 2970549440
835 2970561517
836 2970624189
837 2970633734
838 2977822412
839 2977833481
840 2977846527
841 2977855479
842 2977874085
843 2977907957
844 2977920883
845 2977929341
846 2977936891
847 2977947726
848 2977955476
849 2977959624
850 2977978202
851 2977987491
852 2979714429
853 2979770556
854 2979774839
855 2979793318
856 2979812205
857 2987637745
858 2987646173
859 2987658586
860 2987666526
861 2987673543
862 3004195528
863 3004196628
864 3004205933
865 3004211801
866 3004219048
867 3004246881
868 3004251024
869 3004274609
870 3004341155
871 637074046
872 649874054
873 8004305826
874 8004320982
875 8004365897
876 8004379391
877 8004394608
878 8004640234
879 8004698265
880 8004720666
881 8004727699
882 8057582315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

142

242

0.84

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

145

239

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.5989 34 223
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.5987 27 223
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.5536 38 224
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.5241 27 223
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.5153 38 224
ID Description Score Start End Superfamily
af_O05317_28_223_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9181 26 222 1.20.120.1630
af_O05317_28_223_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9093 26 222 1.20.120.1630
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7588 101 222 1.20.120.1630
af_A0A1D6HSQ2_108_253_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7095 70 224 1.20.120.550
af_Q9SAH5_68_159_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7067 111 198 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A531M5F0-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9777 1 131 GO:0008168
GO:0016020
GO:0032259
AF-A0A531M5F0-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9633 1 131 GO:0008168
GO:0016020
GO:0032259
AF-Q98LR8-F1-model_v4 Mll0909 protein 0.961 2 224 GO:0012505
GO:0016020
AF-A0A2U0TZK7-F1-model_v4 deleted 0.9553 1 177
AF-A0A560DXJ0-F1-model_v4 Protein-S-isoprenylcysteine O-methyltransferase Ste14 0.9546 1 224 GO:0008168
GO:0012505
GO:0016020
GO:0032259

Map