F444534

General Info

Members Datasets Scaffolds Average Seq Length
440 281 400 238

Family's Representative Sequence

Representative Sequence 3300053154|Ga0500619_000040|Ga0500619_000040_18770_19561
Length 263
Sequence MSLLELHGVTKRFGGLTANQDVSFNVEAGQIVGLIGPNGAGKTTAFNCVAGFYAPTSGRIELDGKTISGLSPEACARAGVGRTFQVARTFTSMTACENVMAAAMLHQRRVPAARTTALKWLGFVNLAHFADKPAGSMTISEQRRLAVARALATAPKLLLMDEVMAGLNPSEVREMVKVVQAIRDTGIACLIVEHVLEGIMPIADKIVVLDRGIKIADGPPAEVSRNPAVIAAYLGPPDDEELSSPPEGVQKPWGGPAVFTGDE

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
11 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
12 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
13 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
14 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
15 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
16 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
17 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
18 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
19 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
20 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
21 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
22 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
23 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
24 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
25 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
26 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
27 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
28 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
29 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
30 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
31 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
32 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
33 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
34 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
35 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
36 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
37 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
38 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
39 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
40 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
41 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
42 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
268 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
269 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
278 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
281 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.68
Metatranscriptomes 0.23
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.14
Nodule 5.23
Rhizoplane 4.32
Rhizosphere 54.09
Stem 0
Stem Tuber 0
Unclassified 20.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1001038 3300002704 Bacteria 2962
2 JGI25155J39150_1001040 3300002704 Bacteria 2949
3 JGI25156J39149_1000158 3300002705 Bacteria 49923
4 JGI25156J39149_1000164 3300002705 Bacteria 48491
5 JGI25162J39368_1006794 3300002737 Bacteria 1894
6 JGI25154J39366_1000074 3300002738 Bacteria 92481
7 JGI25154J39366_1000114 3300002738 Bacteria 68169
8 JGI25154J39366_1000175 3300002738 Bacteria 49923
9 JGI25157J39369_1000335 3300002741 Bacteria 33363
10 JGI25152J39213_1002477 3300002773 Bacteria 6992
11 JGI25153J46596_10002270 3300003215 Bacteria 11209
12 JGI25153J46596_10003693 3300003215 Bacteria 8459
13 rootH1_10019386 3300003316 Bacteria 1442
14 rootL2_10064870 3300003322 Unclassified 12348
15 rootH1_10082242 3300003323 Bacteria 2570
16 Ga0055532_1000080 3300003758 Bacteria 120879
17 Ga0055535_1000056 3300003761 Bacteria 128204
18 Ga0055535_1003152 3300003761 Bacteria 4926
19 Ga0055529_1000165 3300003763 Bacteria 91442
20 Ga0055526_1002150 3300003771 Bacteria 13519
21 Ga0055524_1000027 3300003775 Bacteria 213655
22 Ga0055530_10017021 3300003791 Bacteria 2291
23 Ga0065165_1000832 3300005262 Bacteria 40569
24 Ga0070658_10251947 3300005327 Bacteria 1498
25 Ga0070658_10296983 3300005327 Bacteria 1377
26 Ga0070670_100083039 3300005331 Bacteria 2753
27 Ga0068869_100044130 3300005334 Bacteria 3206
28 Ga0068868_100008596 3300005338 Bacteria 7314
29 Ga0070661_100000893 3300005344 Bacteria 21405
30 Ga0070661_100101521 3300005344 Bacteria 2140
31 Ga0070675_100009253 3300005354 Bacteria 7654
32 Ga0070659_100004831 3300005366 Bacteria 9631
33 Ga0070659_100310788 3300005366 Bacteria 1316
34 Ga0070667_100018165 3300005367 Bacteria 5831
35 Ga0070667_100264293 3300005367 Bacteria 1541
36 Ga0070708_100414037 3300005445 Bacteria 1271
37 Ga0070663_100258089 3300005455 Bacteria 1382
38 Ga0070662_100000931 3300005457 Bacteria 17917
39 Ga0070662_100725795 3300005457 Bacteria 842
40 Ga0068867_100000018 3300005459 Bacteria 102056
41 Ga0068867_100004640 3300005459 Bacteria 9669
42 Ga0070706_100132758 3300005467 Bacteria 2324
43 Ga0070672_100009637 3300005543 Bacteria 6666
44 Ga0068855_100040000 3300005563 Bacteria 5565
45 Ga0068855_101157616 3300005563 Bacteria 806
46 Ga0070664_100002509 3300005564 Bacteria 14796
47 Ga0070664_100065471 3300005564 Bacteria 3101
48 Ga0070664_100113132 3300005564 Bacteria 2371
49 Ga0068857_100080602 3300005577 Bacteria 2906
50 Ga0068857_100127728 3300005577 Bacteria 2291
51 Ga0068854_100066767 3300005578 Bacteria 2618
52 Ga0068856_100018591 3300005614 Bacteria 6735
53 Ga0068852_100006807 3300005616 Bacteria 8298
54 Ga0068852_100025699 3300005616 Bacteria 4775
55 Ga0068863_100698632 3300005841 Bacteria 1008
56 Ga0075365_10031551 3300006038 Bacteria 3400
57 Ga0075365_10353476 3300006038 Bacteria 1036
58 Ga0075363_100080666 3300006048 Bacteria 1779
59 Ga0075363_100163118 3300006048 Bacteria 1262
60 Ga0075364_10158072 3300006051 Bacteria 1529
61 Ga0075362_10020128 3300006177 Bacteria 2785
62 Ga0075362_10023088 3300006177 Bacteria 2627
63 Ga0075367_10047429 3300006178 Bacteria 2527
64 Ga0075367_10097664 3300006178 Bacteria 1792
65 Ga0075366_10024864 3300006195 Bacteria 3493
66 Ga0075366_10076207 3300006195 Bacteria 2001
67 Ga0097621_100156233 3300006237 Bacteria 1958
68 Ga0097621_100169873 3300006237 Bacteria 1879
69 Ga0075370_10001985 3300006353 Bacteria 9273
70 Ga0075370_10062522 3300006353 Bacteria 2122
71 Ga0075370_10063322 3300006353 Bacteria 2108
72 Ga0075434_100080372 3300006871 Bacteria 3257
73 Ga0079104_1004958 3300006946 Bacteria 5482
74 Ga0099794_10000585 3300007265 Bacteria 12212
75 Ga0105240_10000809 3300009093 Bacteria 56801
76 Ga0105240_10010334 3300009093 Bacteria 13132
77 Ga0105240_10167965 3300009093 Bacteria 2601
78 Ga0105245_10137905 3300009098 Bacteria 2294
79 Ga0114129_10356465 3300009147 Bacteria 1936
80 Ga0105243_10031481 3300009148 Bacteria 4090
81 Ga0105243_10130285 3300009148 Bacteria 2133
82 Ga0105243_10285397 3300009148 Bacteria 1489
83 Ga0105242_10266071 3300009176 Bacteria 1551
84 Ga0105237_10233927 3300009545 Bacteria 1838
85 Ga0105237_10300002 3300009545 Bacteria 1610
86 Ga0105239_10075487 3300010375 Bacteria 3706
87 Ga0105239_10491575 3300010375 Bacteria 1395
88 Ga0163163_10127428 3300014325 Bacteria 2584
89 Ga0163163_10613255 3300014325 Bacteria 1151
90 Ga0157380_11003351 3300014326 Bacteria 868
91 Ga0182008_10020675 3300014497 Bacteria 3385
92 Ga0157377_10000051 3300014745 Bacteria 90204
93 Ga0157379_10112628 3300014968 Bacteria 2445
94 Ga0157376_10075142 3300014969 Bacteria 2883
95 Ga0157376_10573588 3300014969 Bacteria 1119
96 Ga0182006_1020942 3300015261 Bacteria 2733
97 Ga0213874_10074047 3300021377 Bacteria 1092
98 Ga0213875_10180639 3300021388 Bacteria 991
99 Ga0209435_100018 3300025206 Bacteria 274625
100 Ga0209435_100138 3300025206 Bacteria 24452
101 Ga0209147_100051 3300025229 Bacteria 274605
102 Ga0209437_100145 3300025233 Bacteria 163138
103 Ga0209258_100071 3300025242 Bacteria 278319
104 Ga0209258_100244 3300025242 Bacteria 100255
105 Ga0209646_1000081 3300025246 Bacteria 201708
106 Ga0209646_1000090 3300025246 Bacteria 189912
107 Ga0209026_1000042 3300025250 Bacteria 273111
108 Ga0209026_1007538 3300025250 Bacteria 2432
109 Ga0209759_1000098 3300025256 Bacteria 157516
110 Ga0209759_1000109 3300025256 Bacteria 145042
111 Ga0209759_1000936 3300025256 Bacteria 21031
112 Ga0209129_1000075 3300025258 Bacteria 201273
113 Ga0209565_1010168 3300025263 Bacteria 2345
114 Ga0209455_1000030 3300025272 Bacteria 533479
115 Ga0209455_1028487 3300025272 Bacteria 976
116 Ga0209025_1032271 3300025294 Bacteria 2453
117 Ga0209564_1000046 3300025295 Bacteria 373787
118 Ga0209758_1000045 3300025297 Bacteria 369174
119 Ga0209758_1000052 3300025297 Bacteria 338962
120 Ga0209050_1000257 3300025298 Bacteria 114186
121 Ga0209256_1000013 3300025299 Bacteria 689442
122 Ga0209051_1003673 3300025303 Bacteria 9927
123 Ga0209051_1014608 3300025303 Bacteria 3653
124 Ga0209257_1038287 3300025304 Bacteria 1455
125 Ga0207697_10055271 3300025315 Bacteria 1646
126 Ga0207645_10001304 3300025907 Bacteria 20534
127 Ga0207645_10160947 3300025907 Bacteria 1469
128 Ga0207705_10256874 3300025909 Bacteria 1333
129 Ga0207705_10281201 3300025909 Bacteria 1274
130 Ga0207684_10124424 3300025910 Bacteria 2212
131 Ga0207684_10447590 3300025910 Bacteria 1109
132 Ga0207695_10001196 3300025913 Bacteria 44626
133 Ga0207695_10008186 3300025913 Bacteria 13134
134 Ga0207671_10217853 3300025914 Bacteria 1495
135 Ga0207649_10077692 3300025920 Bacteria 2140
136 Ga0207650_10057935 3300025925 Bacteria 2883
137 Ga0207659_10071735 3300025926 Bacteria 2530
138 Ga0207644_10103523 3300025931 Bacteria 2142
139 Ga0207690_10062549 3300025932 Bacteria 2534
140 Ga0207706_10001218 3300025933 Bacteria 26011
141 Ga0207706_10105094 3300025933 Bacteria 2485
142 Ga0207686_10491269 3300025934 Bacteria 951
143 Ga0207709_10016442 3300025935 Bacteria 4113
144 Ga0207691_10006518 3300025940 Bacteria 11267
145 Ga0207711_10236578 3300025941 Bacteria 1674
146 Ga0207689_10031804 3300025942 Bacteria 4389
147 Ga0207689_10117317 3300025942 Bacteria 2189
148 Ga0207679_10000056 3300025945 Bacteria 108254
149 Ga0207679_10445463 3300025945 Bacteria 1147
150 Ga0207667_10007680 3300025949 Bacteria 12908
151 Ga0207667_10209921 3300025949 Bacteria 1996
152 Ga0207651_10048131 3300025960 Bacteria 2880
153 Ga0207668_10925790 3300025972 Bacteria 777
154 Ga0207640_10014346 3300025981 Bacteria 4559
155 Ga0207702_10034341 3300026078 Bacteria 4239
156 Ga0207641_10722678 3300026088 Bacteria 982
157 Ga0207648_10000060 3300026089 Bacteria 102225
158 Ga0207648_10002312 3300026089 Bacteria 20575
159 Ga0207648_10192197 3300026089 Bacteria 1809
160 Ga0207674_10071423 3300026116 Bacteria 3487
161 Ga0207674_10127555 3300026116 Bacteria 2509
162 Ga0207674_10486756 3300026116 Bacteria 1192
163 Ga0207675_100173706 3300026118 Bacteria 2061
164 Ga0207683_10155100 3300026121 Bacteria 2068
165 Ga0207698_10020491 3300026142 Bacteria 4553
166 Ga0207698_10120826 3300026142 Bacteria 2217
167 Ga0209588_1000022 3300027671 Bacteria 92210
168 Ga0268264_10797293 3300028381 Bacteria 943
169 Ga0307517_10000499 3300028786 Bacteria 67326
170 Ga0307517_10115266 3300028786 Bacteria 2018
171 Ga0307515_10000366 3300028794 Bacteria 111195
172 Ga0307515_10001653 3300028794 Bacteria 49625
173 Ga0307515_10001755 3300028794 Bacteria 48316
174 Ga0307515_10076802 3300028794 Bacteria 4422
175 Ga0307515_10089438 3300028794 Bacteria 3877
176 Ga0307512_10112726 3300030522 Bacteria 1783
177 Ga0307512_10252708 3300030522 Bacteria 876
178 Ga0265325_10076271 3300031241 Bacteria 1673
179 Ga0307513_10018139 3300031456 Bacteria 8421
180 Ga0307513_10020950 3300031456 Bacteria 7733
181 Ga0307513_10039320 3300031456 Bacteria 5245
182 Ga0307513_10051731 3300031456 Bacteria 4429
183 Ga0307513_10107739 3300031456 Bacteria 2789
184 Ga0307513_10199739 3300031456 Bacteria 1842
185 Ga0307509_10002631 3300031507 Bacteria 28728
186 Ga0307509_10006190 3300031507 Bacteria 16213
187 Ga0307509_10008010 3300031507 Bacteria 13596
188 Ga0307509_10020942 3300031507 Bacteria 7409
189 Ga0307509_10035192 3300031507 Bacteria 5498
190 Ga0307509_10184443 3300031507 Bacteria 1946
191 Ga0307508_10000194 3300031616 Bacteria 73425
192 Ga0307508_10001847 3300031616 Bacteria 23394
193 Ga0307508_10006981 3300031616 Bacteria 10530
194 Ga0307514_10009816 3300031649 Bacteria 8027
195 Ga0307514_10036410 3300031649 Bacteria 3911
196 Ga0307516_10002103 3300031730 Bacteria 27039
197 Ga0307516_10002796 3300031730 Bacteria 23020
198 Ga0307516_10019944 3300031730 Bacteria 6931
199 Ga0307516_10055371 3300031730 Bacteria 3871
200 Ga0307516_10080561 3300031730 Bacteria 3100
201 Ga0307516_10166431 3300031730 Bacteria 1949
202 Ga0307516_10182048 3300031730 Bacteria 1834
203 Ga0307516_10270959 3300031730 Bacteria 1384
204 Ga0307516_10306829 3300031730 Bacteria 1261
205 Ga0307507_10063323 3300033179 Bacteria 3425
206 Ga0307507_10089503 3300033179 Bacteria 2648
207 Ga0307510_10002130 3300033180 Bacteria 22354
208 Ga0307510_10130976 3300033180 Bacteria 2181
209 Ga0307510_10229799 3300033180 Bacteria 1358
210 Ga0373930_0018110 3300034816 Bacteria 1350
211 Ga0373932_0020437 3300035112 Bacteria 1736
212 Ga0373931_0036659 3300035691 Bacteria 2557
213 Ga0373931_0072833 3300035691 Bacteria 1879
214 Ga0395899_0002403 3300037312 Bacteria 15207
215 Ga0395900_0022594 3300037418 Bacteria 6436
216 Ga0395900_0029616 3300037418 Bacteria 5617
217 Ga0395900_0063521 3300037418 Bacteria 3795
218 Ga0395900_0570933 3300037418 Bacteria 1074
219 Ga0395900_0642283 3300037418 Bacteria 998
220 Ga0395898_0059445 3300037466 Bacteria 3718
221 Ga0395905_0000531 3300037471 Bacteria 52244
222 Ga0395905_0001953 3300037471 Bacteria 23590
223 Ga0395905_0008345 3300037471 Bacteria 10216
224 Ga0395905_0052191 3300037471 Bacteria 3828
225 Ga0395905_0344553 3300037471 Bacteria 1381
226 Ga0395905_0438026 3300037471 Bacteria 1204
227 Ga0395905_0508827 3300037471 Bacteria 1104
228 Ga0436364_0361338 3300037853 Bacteria 1948
229 Ga0395901_0015495 3300038443 Bacteria 7761
230 Ga0395901_0054940 3300038443 Bacteria 4140
231 Ga0395901_0087920 3300038443 Bacteria 3249
232 Ga0395901_0279889 3300038443 Bacteria 1733
233 Ga0436365_1525646 3300039437 Bacteria 1068
234 Ga0451849_0545189 3300041505 Bacteria 1072
235 Ga0451851_0370427 3300041507 Bacteria 1150
236 Ga0451853_1153607 3300041512 Bacteria 1621
237 Ga0450919_002275 3300042121 Bacteria 2488
238 Ga0450923_005975 3300042125 Bacteria 1992
239 Ga0450918_000456 3300042531 Bacteria 8730
240 Ga0451577_0203625 3300042876 Bacteria 1787
241 Ga0466969_0005620 3300044656 Bacteria 6666
242 Ga0466969_0010501 3300044656 Bacteria 4909
243 Ga0466972_0000353 3300044658 Bacteria 24981
244 Ga0453683_0205248 3300044673 Bacteria 1251
245 Ga0466965_0003147 3300044683 Bacteria 7198
246 Ga0466965_0099755 3300044683 Bacteria 1484
247 Ga0466965_0181611 3300044683 Bacteria 1110
248 Ga0466966_0003743 3300044684 Bacteria 10029
249 Ga0466966_0003937 3300044684 Bacteria 9805
250 Ga0466966_0083421 3300044684 Bacteria 1988
251 Ga0466961_0006996 3300044693 Bacteria 7178
252 Ga0466961_0009341 3300044693 Bacteria 6246
253 Ga0466961_0084724 3300044693 Bacteria 2004
254 Ga0466963_0048876 3300044694 Bacteria 2797
255 Ga0466964_0006734 3300044706 Bacteria 4284
256 Ga0466964_0035089 3300044706 Bacteria 2004
257 Ga0466964_0037619 3300044706 Bacteria 1944
258 Ga0466964_0084004 3300044706 Bacteria 1372
259 Ga0453684_0001576 3300044712 Bacteria 63117
260 Ga0453684_0023623 3300044712 Bacteria 9036
261 Ga0453684_0028538 3300044712 Bacteria 7957
262 Ga0453684_0042842 3300044712 Bacteria 6093
263 Ga0453684_0052876 3300044712 Bacteria 5306
264 Ga0453684_0108672 3300044712 Bacteria 3375
265 Ga0466971_0004238 3300044719 Bacteria 6182
266 Ga0466971_0024785 3300044719 Bacteria 2677
267 Ga0466968_0109490 3300044735 Bacteria 1241
268 Ga0466970_0088968 3300044765 Bacteria 1674
269 Ga0466957_0011075 3300044842 Bacteria 5190
270 Ga0466957_0035421 3300044842 Bacteria 2995
271 Ga0466957_0130472 3300044842 Bacteria 1610
272 Ga0466960_0065242 3300044901 Bacteria 1798
273 Ga0466959_0000519 3300045049 Bacteria 22368
274 Ga0466959_0031327 3300045049 Bacteria 3935
275 Ga0466959_0033580 3300045049 Bacteria 3794
276 Ga0466959_0052823 3300045049 Bacteria 2975
277 Ga0451576_0158250 3300045051 Bacteria 2363
278 Ga0451576_0452118 3300045051 Bacteria 1348
279 Ga0466958_0078756 3300045836 Bacteria 2025
280 Ga0466958_0112778 3300045836 Bacteria 1698
281 Ga0466958_0275667 3300045836 Bacteria 1077
282 Ga0466958_0489419 3300045836 Bacteria 798
283 Ga0466967_0062542 3300045976 Bacteria 3304
284 Ga0466967_0070711 3300045976 Bacteria 3122
285 Ga0466967_0322317 3300045976 Bacteria 1490
286 Ga0466967_0363097 3300045976 Bacteria 1403
287 Ga0495592_0000237 3300046454 Bacteria 47510
288 Ga0495590_0032102 3300046457 Bacteria 1837
289 Ga0495605_0074541 3300046474 Bacteria 1597
290 Ga0495662_0101413 3300046476 Bacteria 1408
291 Ga0495607_0044221 3300046501 Bacteria 2627
292 Ga0495583_0145996 3300046506 Bacteria 983
293 Ga0495606_0104738 3300046507 Bacteria 1716
294 Ga0495608_0132161 3300046511 Bacteria 1597
295 Ga0495610_0036768 3300046512 Bacteria 2499
296 Ga0495610_0083191 3300046512 Bacteria 1465
297 Ga0495618_0257298 3300046514 Bacteria 1094
298 Ga0495632_0000179 3300046519 Bacteria 64710
299 Ga0495632_0007246 3300046519 Bacteria 7000
300 Ga0495632_0050828 3300046519 Bacteria 2042
301 Ga0495643_0010850 3300046522 Bacteria 5584
302 Ga0495643_0032688 3300046522 Bacteria 2885
303 Ga0495648_0031103 3300046524 Bacteria 3520
304 Ga0495642_0003544 3300046528 Bacteria 6149
305 Ga0495642_0044251 3300046528 Unclassified 1817
306 Ga0495642_0154027 3300046528 Unclassified 995
307 Ga0495597_0007276 3300046542 Bacteria 5640
308 Ga0495597_0042758 3300046542 Bacteria 2019
309 Ga0495622_0029968 3300046557 Bacteria 2542
310 Ga0495622_0137284 3300046557 Bacteria 1111
311 Ga0495668_0017470 3300046616 Bacteria 4159
312 Ga0495611_0048337 3300046648 Bacteria 1912
313 Ga0495625_0000673 3300046660 Bacteria 48716
314 Ga0495625_0026166 3300046660 Bacteria 4412
315 Ga0495661_0012220 3300046665 Bacteria 5799
316 Ga0495661_0021567 3300046665 Bacteria 4199
317 Ga0495588_0051116 3300046674 Bacteria 2128
318 Ga0495646_0305569 3300046680 Bacteria 840
319 Ga0495658_0039692 3300046683 Bacteria 2613
320 Ga0495624_0119333 3300046690 Bacteria 1620
321 Ga0495671_0068433 3300046692 Bacteria 1746
322 Ga0495660_0018201 3300046810 Bacteria 4039
323 Ga0495636_0154734 3300047318 Bacteria 1030
324 Ga0495674_0173742 3300047319 Bacteria 1797
325 Ga0495672_0000036 3300047320 Bacteria 279648
326 Ga0495676_0037039 3300047321 Bacteria 4066
327 Ga0495687_003725 3300047443 Bacteria 10815
328 Ga0495687_005772 3300047443 Bacteria 7771
329 Ga0495687_005773 3300047443 Bacteria 7771
330 Ga0495687_012330 3300047443 Bacteria 4525
331 Ga0495687_025960 3300047443 Bacteria 2762
332 Ga0495626_0104219 3300048091 Bacteria 1234
333 Ga0496100_0323903 3300048903 Bacteria 1158
334 Ga0496101_0208792 3300048904 Bacteria 1512
335 Ga0496101_0214504 3300048904 Bacteria 1492
336 Ga0496102_0182924 3300048905 Bacteria 1975
337 Ga0496103_0013398 3300048906 Bacteria 4861
338 Ga0496104_0363993 3300048907 Bacteria 1359
339 Ga0496105_0049307 3300048908 Bacteria 3476
340 Ga0496106_0103948 3300048909 Bacteria 2205
341 Ga0496107_0128386 3300048910 Bacteria 1871
342 Ga0496107_0149481 3300048910 Bacteria 1727
343 Ga0496107_0288281 3300048910 Bacteria 1222
344 Ga0496108_0469815 3300048911 Bacteria 1099
345 Ga0496109_0154412 3300048912 Bacteria 2150
346 Ga0496109_0645031 3300048912 Bacteria 996
347 Ga0496110_0108228 3300048913 Bacteria 2496
348 Ga0496111_0191375 3300048914 Bacteria 1521
349 Ga0496113_0506410 3300048916 Bacteria 969
350 Ga0496114_0102842 3300048917 Bacteria 2441
351 Ga0496115_0301209 3300048918 Bacteria 1314
352 Ga0496116_0004558 3300048919 Bacteria 13143
353 Ga0496116_0065553 3300048919 Bacteria 2329
354 Ga0496118_0081780 3300048921 Bacteria 2266
355 Ga0496119_0111924 3300048922 Bacteria 1514
356 Ga0496121_0006855 3300048924 Bacteria 13926
357 Ga0496121_0345715 3300048924 Bacteria 992
358 Ga0496122_0000801 3300048925 Bacteria 60312
359 Ga0496123_0000528 3300048926 Bacteria 65747
360 Ga0496125_0004529 3300048928 Bacteria 15964
361 Ga0501037_0023442 3300049573 Bacteria 4563
362 Ga0501043_0000243 3300049579 Bacteria 49191
363 Ga0501046_0000137 3300049580 Bacteria 78496
364 Ga0501047_0000050 3300049581 Bacteria 155628
365 Ga0501048_0017987 3300049582 Bacteria 5200
366 Ga0501045_0006004 3300049824 Bacteria 8405
367 nmdc:mga03683_107837_c1 3300050489 Bacteria 1229
368 nmdc:mga0yw44_285693_c1 3300050492 Bacteria 1103
369 nmdc:mga0yw44_908_c1 3300050492 Bacteria 7682
370 nmdc:mga0k408_160648_c1 3300050493 Bacteria 1339
371 nmdc:mga0k408_1828_c2 3300050493 Bacteria 8233
372 nmdc:mga0k408_2521_c1 3300050493 Bacteria 9425
373 nmdc:mga0k408_40885_c1 3300050493 Bacteria 2669
374 nmdc:mga06z11_207521_c1 3300050494 Bacteria 1140
375 nmdc:mga07m45_1471_c1 3300050496 Bacteria 10818
376 nmdc:mga07m45_43057_c1 3300050496 Bacteria 2531
377 nmdc:mga07m45_67182_c2 3300050496 Bacteria 1571
378 nmdc:mga07m45_8963_c1 3300050496 Bacteria 5167
379 nmdc:mga05p37_399618_c1 3300050507 Bacteria 1605
380 nmdc:mga0sz30_56789_c1 3300050516 Bacteria 1668
381 Ga0495601_0055337 3300053077 Bacteria 2512
382 Ga0500578_0000437 3300053086 Bacteria 51031
383 Ga0500646_0025448 3300053090 Bacteria 1598
384 Ga0500651_0027776 3300053093 Bacteria 3558
385 Ga0500651_0042097 3300053093 Bacteria 2878
386 Ga0500594_0007781 3300053118 Bacteria 2430
387 Ga0500618_000922 3300053125 Bacteria 15179
388 Ga0500618_002393 3300053125 Bacteria 7148
389 Ga0500642_0004416 3300053130 Bacteria 4398
390 Ga0500652_000312 3300053131 Bacteria 17547
391 Ga0500559_0000602 3300053136 Bacteria 24517
392 Ga0500568_0022336 3300053139 Bacteria 2707
393 Ga0500619_000040 3300053154 Bacteria 40525
394 Ga0500622_0000164 3300053156 Bacteria 70630
395 Ga0500636_0080448 3300053177 Bacteria 1878
396 Ga0500584_088842 3300053726 Bacteria 1303
397 Ga0587082_000257 3300059504 Bacteria 3878
398 Ga0466962_0009870 3300061719 Bacteria 4579
399 Ga0466962_0164083 3300061719 Bacteria 1080
400 Ga0466962_0287063 3300061719 Bacteria 813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035112 Ga0373932_0020437 Ga0373932_0020437_1061_1726 221
2 3300053090 Ga0500646_0025448 Ga0500646_0025448_915_1580 221
3 3300031730 Ga0307516_10182048 Ga0307516_101820482 223
4 3300044656 Ga0466969_0005620 Ga0466969_0005620_4273_4956 227
5 3300044683 Ga0466965_0003147 Ga0466965_0003147_5964_6647 227
6 3300044684 Ga0466966_0003937 Ga0466966_0003937_4925_5608 227
7 3300044693 Ga0466961_0006996 Ga0466961_0006996_1839_2522 227
8 3300044706 Ga0466964_0006734 Ga0466964_0006734_179_862 227
9 3300044719 Ga0466971_0004238 Ga0466971_0004238_1042_1725 227
10 3300044735 Ga0466968_0109490 Ga0466968_0109490_405_1088 227
11 3300044842 Ga0466957_0011075 Ga0466957_0011075_423_1106 227
12 3300045049 Ga0466959_0033580 Ga0466959_0033580_548_1231 227
13 3300045836 Ga0466958_0078756 Ga0466958_0078756_40_723 227
14 3300045976 Ga0466967_0322317 Ga0466967_0322317_365_1048 227
15 3300061719 Ga0466962_0009870 Ga0466962_0009870_3798_4481 227
16 3300005367 Ga0070667_100018165 Ga0070667_1000181655 231
17 3300006237 Ga0097621_100156233 Ga0097621_1001562332 231
18 3300009098 Ga0105245_10137905 Ga0105245_101379052 231
19 3300014968 Ga0157379_10112628 Ga0157379_101126282 231
20 3300014969 Ga0157376_10075142 Ga0157376_100751423 231
21 3300031507 Ga0307509_10035192 Ga0307509_100351924 231
22 3300046511 Ga0495608_0132161 Ga0495608_0132161_611_1324 231
23 3300031730 Ga0307516_10055371 Ga0307516_100553712 232
24 3300044673 Ga0453683_0205248 Ga0453683_0205248_512_1228 232
25 3300046514 Ga0495618_0257298 Ga0495618_0257298_317_1030 232
26 3300046557 Ga0495622_0137284 Ga0495622_0137284_61_774 232
27 3300046690 Ga0495624_0119333 Ga0495624_0119333_716_1429 232
28 3300047321 Ga0495676_0037039 Ga0495676_0037039_2849_3562 232
29 iso_pu_bacteria 2511231003 2511247849 233
30 iso_pu_bacteria 2585428057 2587729990 233
31 iso_pu_bacteria 2585428058 2587734866 233
32 iso_pu_bacteria 2585428062 2587754459 233
33 iso_pu_bacteria 2588253510 2588293183 233
34 iso_pu_bacteria 2643221592 2643968413 233
35 iso_pu_bacteria 2643221625 2644141795 233
36 iso_pu_bacteria 2643221644 2644248841 233
37 iso_pu_bacteria 2643221648 2644272535 233
38 iso_pu_bacteria 2818991445 2819594743 233
39 iso_pu_bacteria 2884811622 2884815382 233
40 iso_pu_bacteria 2884811622 2884815395 233
41 iso_pu_bacteria 2884836552 2884841237 233
42 iso_pu_bacteria 2884852848 2884856111 233
43 iso_pu_bacteria 2896154374 2896156963 233
44 iso_pu_bacteria 2919046199 2919049354 233
45 iso_pu_bacteria 2824661429 2824662839 234
46 iso_pu_bacteria 2879099564 2879102765 234
47 iso_pu_bacteria 2897803580 2897805103 234
48 iso_pu_bacteria 2929615660 2929619818 234
49 iso_pu_bacteria 2929624759 2929629129 234
50 iso_pu_bacteria 2932809354 2932816633 234
51 iso_pu_bacteria 2932818245 2932822080 234
52 iso_pu_bacteria 2933577622 2933581737 234
53 iso_pu_bacteria 2935638405 2935646778 234
54 iso_pu_bacteria 2935665750 2935674552 234
55 iso_pu_bacteria 2935684952 2935690657 234
56 iso_pu_bacteria 2935713505 2935717647 234
57 iso_pu_bacteria 2935722832 2935727203 234
58 iso_pu_bacteria 2935732158 2935735973 234
59 iso_pu_bacteria 2935741537 2935744756 234
60 iso_pu_bacteria 2935750917 2935755666 234
61 iso_pu_bacteria 2935760218 2935761845 234
62 iso_pu_bacteria 2935801545 2935808114 234
63 iso_pu_bacteria 2935810662 2935814166 234
64 iso_pu_bacteria 2935827899 2935836032 234
65 iso_pu_bacteria 2936037263 2936039721 234
66 iso_pu_bacteria 2940556831 2940561053 234
67 iso_pu_bacteria 8054002106 8054009174 234
68 iso_pu_bacteria 8055742211 8055750429 234
69 3300009545 Ga0105237_10300002 Ga0105237_103000021 235
70 3300014325 Ga0163163_10127428 Ga0163163_101274283 235
71 3300014969 Ga0157376_10573588 Ga0157376_105735882 235
72 3300044706 Ga0466964_0037619 Ga0466964_0037619_1056_1763 235
73 3300005327 Ga0070658_10251947 Ga0070658_102519472 236
74 3300005459 Ga0068867_100000018 Ga0068867_10000001846 236
75 3300005467 Ga0070706_100132758 Ga0070706_1001327581 236
76 3300006038 Ga0075365_10031551 Ga0075365_100315514 236
77 3300006195 Ga0075366_10024864 Ga0075366_100248642 236
78 3300006237 Ga0097621_100169873 Ga0097621_1001698732 236
79 3300006871 Ga0075434_100080372 Ga0075434_1000803723 236
80 3300009148 Ga0105243_10031481 Ga0105243_100314813 236
81 3300014745 Ga0157377_10000051 Ga0157377_1000005134 236
82 3300025294 Ga0209025_1032271 Ga0209025_10322713 236
83 3300025315 Ga0207697_10055271 Ga0207697_100552712 236
84 3300025909 Ga0207705_10256874 Ga0207705_102568742 236
85 3300025910 Ga0207684_10124424 Ga0207684_101244243 236
86 3300025934 Ga0207686_10491269 Ga0207686_104912692 236
87 3300025935 Ga0207709_10016442 Ga0207709_100164424 236
88 3300025941 Ga0207711_10236578 Ga0207711_102365782 236
89 3300025972 Ga0207668_10925790 Ga0207668_109257901 236
90 3300026089 Ga0207648_10000060 Ga0207648_1000006055 236
91 3300026089 Ga0207648_10192197 Ga0207648_101921972 236
92 3300026121 Ga0207683_10155100 Ga0207683_101551003 236
93 3300028794 Ga0307515_10001755 Ga0307515_100017553 236
94 3300030522 Ga0307512_10112726 Ga0307512_101127262 236
95 3300031241 Ga0265325_10076271 Ga0265325_100762711 236
96 3300031456 Ga0307513_10039320 Ga0307513_100393203 236
97 3300031649 Ga0307514_10009816 Ga0307514_100098166 236
98 3300037471 Ga0395905_0508827 Ga0395905_0508827_118_831 236
99 3300044712 Ga0453684_0108672 Ga0453684_0108672_202_912 236
100 3300045976 Ga0466967_0062542 Ga0466967_0062542_989_1747 236
101 3300046476 Ga0495662_0101413 Ga0495662_0101413_534_1292 236
102 3300046507 Ga0495606_0104738 Ga0495606_0104738_727_1473 236
103 3300046524 Ga0495648_0031103 Ga0495648_0031103_2046_2792 236
104 3300046557 Ga0495622_0029968 Ga0495622_0029968_113_859 236
105 3300046674 Ga0495588_0051116 Ga0495588_0051116_1284_2030 236
106 3300047319 Ga0495674_0173742 Ga0495674_0173742_831_1589 236
107 3300048903 Ga0496100_0323903 Ga0496100_0323903_376_1122 236
108 3300048904 Ga0496101_0214504 Ga0496101_0214504_219_977 236
109 3300048905 Ga0496102_0182924 Ga0496102_0182924_574_1332 236
110 3300048907 Ga0496104_0363993 Ga0496104_0363993_206_952 236
111 3300048908 Ga0496105_0049307 Ga0496105_0049307_1833_2579 236
112 3300048909 Ga0496106_0103948 Ga0496106_0103948_648_1394 236
113 3300048910 Ga0496107_0128386 Ga0496107_0128386_773_1531 236
114 3300048910 Ga0496107_0149481 Ga0496107_0149481_70_816 236
115 3300048911 Ga0496108_0469815 Ga0496108_0469815_187_945 236
116 3300048912 Ga0496109_0154412 Ga0496109_0154412_13_771 236
117 3300048912 Ga0496109_0645031 Ga0496109_0645031_103_849 236
118 3300048913 Ga0496110_0108228 Ga0496110_0108228_1385_2143 236
119 3300048916 Ga0496113_0506410 Ga0496113_0506410_70_816 236
120 3300048917 Ga0496114_0102842 Ga0496114_0102842_368_1126 236
121 3300048918 Ga0496115_0301209 Ga0496115_0301209_114_860 236
122 3300048919 Ga0496116_0065553 Ga0496116_0065553_55_813 236
123 3300048921 Ga0496118_0081780 Ga0496118_0081780_1373_2131 236
124 3300048922 Ga0496119_0111924 Ga0496119_0111924_73_819 236
125 3300048924 Ga0496121_0006855 Ga0496121_0006855_8773_9519 236
126 3300049579 Ga0501043_0000243 Ga0501043_0000243_33830_34540 236
127 3300049580 Ga0501046_0000137 Ga0501046_0000137_39126_39836 236
128 3300049581 Ga0501047_0000050 Ga0501047_0000050_140509_141219 236
129 3300049582 Ga0501048_0017987 Ga0501048_0017987_2330_3040 236
130 3300049824 Ga0501045_0006004 Ga0501045_0006004_39_749 236
131 3300050492 nmdc:mga0yw44_908_c1 nmdc:mga0yw44_908_c1_2198_2944 236
132 3300050493 nmdc:mga0k408_2521_c1 nmdc:mga0k408_2521_c1_4787_5500 236
133 3300050493 nmdc:mga0k408_40885_c1 nmdc:mga0k408_40885_c1_259_972 236
134 3300053077 Ga0495601_0055337 Ga0495601_0055337_1454_2212 236
135 3300002704 JGI25155J39150_1001038 JGI25155J39150_10010381 237
136 3300002704 JGI25155J39150_1001040 JGI25155J39150_10010404 237
137 3300002705 JGI25156J39149_1000158 JGI25156J39149_100015843 237
138 3300002705 JGI25156J39149_1000164 JGI25156J39149_100016419 237
139 3300002737 JGI25162J39368_1006794 JGI25162J39368_10067942 237
140 3300002738 JGI25154J39366_1000074 JGI25154J39366_100007486 237
141 3300002738 JGI25154J39366_1000114 JGI25154J39366_100011437 237
142 3300002738 JGI25154J39366_1000175 JGI25154J39366_10001751 237
143 3300002741 JGI25157J39369_1000335 JGI25157J39369_100033532 237
144 3300002773 JGI25152J39213_1002477 JGI25152J39213_10024773 237
145 3300003215 JGI25153J46596_10002270 JGI25153J46596_100022703 237
146 3300003215 JGI25153J46596_10003693 JGI25153J46596_100036935 237
147 3300003316 rootH1_10019386 rootH1_100193862 237
148 3300003322 rootL2_10064870 rootL2_100648702 237
149 3300003323 rootH1_10082242 rootH1_100822422 237
150 3300003758 Ga0055532_1000080 Ga0055532_100008064 237
151 3300003761 Ga0055535_1000056 Ga0055535_100005645 237
152 3300003761 Ga0055535_1003152 Ga0055535_10031523 237
153 3300003763 Ga0055529_1000165 Ga0055529_100016562 237
154 3300003771 Ga0055526_1002150 Ga0055526_10021504 237
155 3300003775 Ga0055524_1000027 Ga0055524_100002735 237
156 3300003791 Ga0055530_10017021 Ga0055530_100170213 237
157 3300005262 Ga0065165_1000832 Ga0065165_10008328 237
158 3300005327 Ga0070658_10296983 Ga0070658_102969832 237
159 3300005331 Ga0070670_100083039 Ga0070670_1000830392 237
160 3300005334 Ga0068869_100044130 Ga0068869_1000441303 237
161 3300005338 Ga0068868_100008596 Ga0068868_1000085963 237
162 3300005344 Ga0070661_100000893 Ga0070661_1000008935 237
163 3300005344 Ga0070661_100101521 Ga0070661_1001015213 237
164 3300005354 Ga0070675_100009253 Ga0070675_1000092532 237
165 3300005366 Ga0070659_100004831 Ga0070659_1000048312 237
166 3300005366 Ga0070659_100310788 Ga0070659_1003107882 237
167 3300005367 Ga0070667_100264293 Ga0070667_1002642932 237
168 3300005445 Ga0070708_100414037 Ga0070708_1004140372 237
169 3300005455 Ga0070663_100258089 Ga0070663_1002580892 237
170 3300005457 Ga0070662_100000931 Ga0070662_10000093114 237
171 3300005457 Ga0070662_100725795 Ga0070662_1007257951 237
172 3300005459 Ga0068867_100004640 Ga0068867_1000046408 237
173 3300005543 Ga0070672_100009637 Ga0070672_1000096378 237
174 3300005563 Ga0068855_100040000 Ga0068855_1000400003 237
175 3300005563 Ga0068855_101157616 Ga0068855_1011576161 237
176 3300005564 Ga0070664_100002509 Ga0070664_10000250912 237
177 3300005564 Ga0070664_100065471 Ga0070664_1000654712 237
178 3300005564 Ga0070664_100113132 Ga0070664_1001131322 237
179 3300005577 Ga0068857_100080602 Ga0068857_1000806023 237
180 3300005577 Ga0068857_100127728 Ga0068857_1001277283 237
181 3300005578 Ga0068854_100066767 Ga0068854_1000667672 237
182 3300005614 Ga0068856_100018591 Ga0068856_1000185913 237
183 3300005616 Ga0068852_100006807 Ga0068852_1000068072 237
184 3300005616 Ga0068852_100025699 Ga0068852_1000256992 237
185 3300005841 Ga0068863_100698632 Ga0068863_1006986321 237
186 3300006038 Ga0075365_10353476 Ga0075365_103534762 237
187 3300006048 Ga0075363_100080666 Ga0075363_1000806662 237
188 3300006048 Ga0075363_100163118 Ga0075363_1001631182 237
189 3300006051 Ga0075364_10158072 Ga0075364_101580722 237
190 3300006177 Ga0075362_10020128 Ga0075362_100201283 237
191 3300006177 Ga0075362_10023088 Ga0075362_100230882 237
192 3300006178 Ga0075367_10047429 Ga0075367_100474292 237
193 3300006178 Ga0075367_10097664 Ga0075367_100976642 237
194 3300006195 Ga0075366_10076207 Ga0075366_100762072 237
195 3300006353 Ga0075370_10001985 Ga0075370_100019854 237
196 3300006353 Ga0075370_10062522 Ga0075370_100625222 237
197 3300006353 Ga0075370_10063322 Ga0075370_100633222 237
198 3300006946 Ga0079104_1004958 Ga0079104_10049582 237
199 3300007265 Ga0099794_10000585 Ga0099794_100005854 237
200 3300009093 Ga0105240_10000809 Ga0105240_1000080946 237
201 3300009093 Ga0105240_10010334 Ga0105240_100103349 237
202 3300009093 Ga0105240_10167965 Ga0105240_101679653 237
203 3300009147 Ga0114129_10356465 Ga0114129_103564653 237
204 3300009148 Ga0105243_10130285 Ga0105243_101302853 237
205 3300009148 Ga0105243_10285397 Ga0105243_102853972 237
206 3300009176 Ga0105242_10266071 Ga0105242_102660712 237
207 3300009545 Ga0105237_10233927 Ga0105237_102339272 237
208 3300010375 Ga0105239_10075487 Ga0105239_100754873 237
209 3300010375 Ga0105239_10491575 Ga0105239_104915752 237
210 3300014325 Ga0163163_10613255 Ga0163163_106132552 237
211 3300014326 Ga0157380_11003351 Ga0157380_110033511 237
212 3300014497 Ga0182008_10020675 Ga0182008_100206753 237
213 3300015261 Ga0182006_1020942 Ga0182006_10209423 237
214 3300021377 Ga0213874_10074047 Ga0213874_100740472 237
215 3300021388 Ga0213875_10180639 Ga0213875_101806392 237
216 3300025206 Ga0209435_100018 Ga0209435_100018156 237
217 3300025206 Ga0209435_100138 Ga0209435_10013821 237
218 3300025229 Ga0209147_100051 Ga0209147_100051156 237
219 3300025233 Ga0209437_100145 Ga0209437_10014583 237
220 3300025242 Ga0209258_100071 Ga0209258_10007178 237
221 3300025242 Ga0209258_100244 Ga0209258_10024427 237
222 3300025246 Ga0209646_1000081 Ga0209646_100008185 237
223 3300025246 Ga0209646_1000090 Ga0209646_100009075 237
224 3300025250 Ga0209026_1000042 Ga0209026_100004290 237
225 3300025250 Ga0209026_1007538 Ga0209026_10075382 237
226 3300025256 Ga0209759_1000098 Ga0209759_100009885 237
227 3300025256 Ga0209759_1000109 Ga0209759_100010965 237
228 3300025256 Ga0209759_1000936 Ga0209759_100093616 237
229 3300025258 Ga0209129_1000075 Ga0209129_1000075129 237
230 3300025263 Ga0209565_1010168 Ga0209565_10101682 237
231 3300025272 Ga0209455_1000030 Ga0209455_1000030193 237
232 3300025272 Ga0209455_1028487 Ga0209455_10284872 237
233 3300025295 Ga0209564_1000046 Ga0209564_1000046293 237
234 3300025297 Ga0209758_1000045 Ga0209758_1000045290 237
235 3300025297 Ga0209758_1000052 Ga0209758_1000052170 237
236 3300025298 Ga0209050_1000257 Ga0209050_100025770 237
237 3300025299 Ga0209256_1000013 Ga0209256_1000013379 237
238 3300025303 Ga0209051_1003673 Ga0209051_10036735 237
239 3300025303 Ga0209051_1014608 Ga0209051_10146084 237
240 3300025304 Ga0209257_1038287 Ga0209257_10382872 237
241 3300025907 Ga0207645_10001304 Ga0207645_1000130419 237
242 3300025907 Ga0207645_10160947 Ga0207645_101609472 237
243 3300025909 Ga0207705_10281201 Ga0207705_102812012 237
244 3300025910 Ga0207684_10447590 Ga0207684_104475901 237
245 3300025913 Ga0207695_10001196 Ga0207695_1000119635 237
246 3300025913 Ga0207695_10008186 Ga0207695_100081869 237
247 3300025914 Ga0207671_10217853 Ga0207671_102178532 237
248 3300025920 Ga0207649_10077692 Ga0207649_100776923 237
249 3300025925 Ga0207650_10057935 Ga0207650_100579352 237
250 3300025926 Ga0207659_10071735 Ga0207659_100717352 237
251 3300025931 Ga0207644_10103523 Ga0207644_101035233 237
252 3300025932 Ga0207690_10062549 Ga0207690_100625492 237
253 3300025933 Ga0207706_10001218 Ga0207706_100012186 237
254 3300025933 Ga0207706_10105094 Ga0207706_101050942 237
255 3300025940 Ga0207691_10006518 Ga0207691_100065184 237
256 3300025942 Ga0207689_10031804 Ga0207689_100318043 237
257 3300025942 Ga0207689_10117317 Ga0207689_101173172 237
258 3300025945 Ga0207679_10000056 Ga0207679_10000056110 237
259 3300025945 Ga0207679_10445463 Ga0207679_104454632 237
260 3300025949 Ga0207667_10007680 Ga0207667_100076807 237
261 3300025949 Ga0207667_10209921 Ga0207667_102099212 237
262 3300025960 Ga0207651_10048131 Ga0207651_100481313 237
263 3300025981 Ga0207640_10014346 Ga0207640_100143465 237
264 3300026078 Ga0207702_10034341 Ga0207702_100343415 237
265 3300026088 Ga0207641_10722678 Ga0207641_107226782 237
266 3300026089 Ga0207648_10002312 Ga0207648_100023122 237
267 3300026116 Ga0207674_10071423 Ga0207674_100714233 237
268 3300026116 Ga0207674_10127555 Ga0207674_101275553 237
269 3300026116 Ga0207674_10486756 Ga0207674_104867562 237
270 3300026118 Ga0207675_100173706 Ga0207675_1001737062 237
271 3300026142 Ga0207698_10020491 Ga0207698_100204915 237
272 3300026142 Ga0207698_10120826 Ga0207698_101208262 237
273 3300027671 Ga0209588_1000022 Ga0209588_100002279 237
274 3300028381 Ga0268264_10797293 Ga0268264_107972932 237
275 3300028786 Ga0307517_10000499 Ga0307517_1000049944 237
276 3300028786 Ga0307517_10115266 Ga0307517_101152663 237
277 3300028794 Ga0307515_10000366 Ga0307515_1000036633 237
278 3300028794 Ga0307515_10001653 Ga0307515_1000165321 237
279 3300028794 Ga0307515_10076802 Ga0307515_100768024 237
280 3300028794 Ga0307515_10089438 Ga0307515_100894383 237
281 3300030522 Ga0307512_10252708 Ga0307512_102527081 237
282 3300031456 Ga0307513_10018139 Ga0307513_100181395 237
283 3300031456 Ga0307513_10020950 Ga0307513_100209502 237
284 3300031456 Ga0307513_10051731 Ga0307513_100517315 237
285 3300031456 Ga0307513_10107739 Ga0307513_101077393 237
286 3300031456 Ga0307513_10199739 Ga0307513_101997393 237
287 3300031507 Ga0307509_10002631 Ga0307509_1000263122 237
288 3300031507 Ga0307509_10006190 Ga0307509_100061907 237
289 3300031507 Ga0307509_10008010 Ga0307509_100080105 237
290 3300031507 Ga0307509_10020942 Ga0307509_100209422 237
291 3300031507 Ga0307509_10184443 Ga0307509_101844432 237
292 3300031616 Ga0307508_10000194 Ga0307508_1000019468 237
293 3300031616 Ga0307508_10001847 Ga0307508_100018476 237
294 3300031616 Ga0307508_10006981 Ga0307508_100069814 237
295 3300031649 Ga0307514_10036410 Ga0307514_100364103 237
296 3300031730 Ga0307516_10002103 Ga0307516_1000210321 237
297 3300031730 Ga0307516_10002796 Ga0307516_1000279614 237
298 3300031730 Ga0307516_10019944 Ga0307516_100199444 237
299 3300031730 Ga0307516_10080561 Ga0307516_100805613 237
300 3300031730 Ga0307516_10166431 Ga0307516_101664312 237
301 3300031730 Ga0307516_10270959 Ga0307516_102709591 237
302 3300031730 Ga0307516_10306829 Ga0307516_103068291 237
303 3300033179 Ga0307507_10063323 Ga0307507_100633232 237
304 3300033179 Ga0307507_10089503 Ga0307507_100895032 237
305 3300033180 Ga0307510_10002130 Ga0307510_100021306 237
306 3300033180 Ga0307510_10130976 Ga0307510_101309761 237
307 3300033180 Ga0307510_10229799 Ga0307510_102297992 237
308 3300034816 Ga0373930_0018110 Ga0373930_0018110_148_861 237
309 3300035691 Ga0373931_0036659 Ga0373931_0036659_649_1365 237
310 3300035691 Ga0373931_0072833 Ga0373931_0072833_654_1367 237
311 3300037312 Ga0395899_0002403 Ga0395899_0002403_13041_13754 237
312 3300037418 Ga0395900_0022594 Ga0395900_0022594_4649_5362 237
313 3300037418 Ga0395900_0029616 Ga0395900_0029616_2031_2744 237
314 3300037418 Ga0395900_0063521 Ga0395900_0063521_2541_3254 237
315 3300037418 Ga0395900_0570933 Ga0395900_0570933_26_739 237
316 3300037418 Ga0395900_0642283 Ga0395900_0642283_89_808 237
317 3300037466 Ga0395898_0059445 Ga0395898_0059445_520_1233 237
318 3300037471 Ga0395905_0000531 Ga0395905_0000531_29446_30159 237
319 3300037471 Ga0395905_0001953 Ga0395905_0001953_5999_6712 237
320 3300037471 Ga0395905_0008345 Ga0395905_0008345_1734_2447 237
321 3300037471 Ga0395905_0052191 Ga0395905_0052191_804_1517 237
322 3300037471 Ga0395905_0344553 Ga0395905_0344553_93_806 237
323 3300037471 Ga0395905_0438026 Ga0395905_0438026_293_1006 237
324 3300037853 Ga0436364_0361338 Ga0436364_0361338_618_1334 237
325 3300038443 Ga0395901_0015495 Ga0395901_0015495_1355_2074 237
326 3300038443 Ga0395901_0054940 Ga0395901_0054940_201_914 237
327 3300038443 Ga0395901_0087920 Ga0395901_0087920_1075_1788 237
328 3300038443 Ga0395901_0279889 Ga0395901_0279889_874_1587 237
329 3300039437 Ga0436365_1525646 Ga0436365_1525646_271_987 237
330 3300041505 Ga0451849_0545189 Ga0451849_0545189_276_989 237
331 3300041507 Ga0451851_0370427 Ga0451851_0370427_308_1021 237
332 3300041512 Ga0451853_1153607 Ga0451853_1153607_71_784 237
333 3300042121 Ga0450919_002275 Ga0450919_002275_337_1050 237
334 3300042125 Ga0450923_005975 Ga0450923_005975_628_1341 237
335 3300042531 Ga0450918_000456 Ga0450918_000456_1029_1742 237
336 3300042876 Ga0451577_0203625 Ga0451577_0203625_535_1272 237
337 3300044656 Ga0466969_0010501 Ga0466969_0010501_4007_4720 237
338 3300044658 Ga0466972_0000353 Ga0466972_0000353_462_1175 237
339 3300044683 Ga0466965_0099755 Ga0466965_0099755_313_1026 237
340 3300044683 Ga0466965_0181611 Ga0466965_0181611_302_1015 237
341 3300044684 Ga0466966_0003743 Ga0466966_0003743_4703_5416 237
342 3300044684 Ga0466966_0083421 Ga0466966_0083421_1125_1838 237
343 3300044693 Ga0466961_0009341 Ga0466961_0009341_1936_2649 237
344 3300044693 Ga0466961_0084724 Ga0466961_0084724_788_1501 237
345 3300044694 Ga0466963_0048876 Ga0466963_0048876_1395_2108 237
346 3300044706 Ga0466964_0035089 Ga0466964_0035089_342_1055 237
347 3300044706 Ga0466964_0084004 Ga0466964_0084004_480_1193 237
348 3300044712 Ga0453684_0001576 Ga0453684_0001576_36296_37036 237
349 3300044712 Ga0453684_0023623 Ga0453684_0023623_6472_7212 237
350 3300044712 Ga0453684_0028538 Ga0453684_0028538_2625_3362 237
351 3300044712 Ga0453684_0042842 Ga0453684_0042842_4439_5176 237
352 3300044712 Ga0453684_0052876 Ga0453684_0052876_3694_4425 237
353 3300044719 Ga0466971_0024785 Ga0466971_0024785_236_949 237
354 3300044765 Ga0466970_0088968 Ga0466970_0088968_801_1514 237
355 3300044842 Ga0466957_0035421 Ga0466957_0035421_1947_2660 237
356 3300044842 Ga0466957_0130472 Ga0466957_0130472_729_1442 237
357 3300044901 Ga0466960_0065242 Ga0466960_0065242_610_1323 237
358 3300045049 Ga0466959_0000519 Ga0466959_0000519_20932_21645 237
359 3300045049 Ga0466959_0031327 Ga0466959_0031327_1141_1854 237
360 3300045049 Ga0466959_0052823 Ga0466959_0052823_1430_2143 237
361 3300045051 Ga0451576_0158250 Ga0451576_0158250_1363_2100 237
362 3300045051 Ga0451576_0452118 Ga0451576_0452118_508_1251 237
363 3300045836 Ga0466958_0112778 Ga0466958_0112778_158_871 237
364 3300045836 Ga0466958_0275667 Ga0466958_0275667_163_876 237
365 3300045836 Ga0466958_0489419 Ga0466958_0489419_53_766 237
366 3300045976 Ga0466967_0070711 Ga0466967_0070711_779_1492 237
367 3300045976 Ga0466967_0363097 Ga0466967_0363097_273_986 237
368 3300046454 Ga0495592_0000237 Ga0495592_0000237_12176_12889 237
369 3300046457 Ga0495590_0032102 Ga0495590_0032102_608_1321 237
370 3300046474 Ga0495605_0074541 Ga0495605_0074541_517_1230 237
371 3300046501 Ga0495607_0044221 Ga0495607_0044221_219_932 237
372 3300046506 Ga0495583_0145996 Ga0495583_0145996_130_843 237
373 3300046512 Ga0495610_0036768 Ga0495610_0036768_1498_2211 237
374 3300046512 Ga0495610_0083191 Ga0495610_0083191_249_962 237
375 3300046519 Ga0495632_0000179 Ga0495632_0000179_7479_8192 237
376 3300046519 Ga0495632_0007246 Ga0495632_0007246_2499_3212 237
377 3300046519 Ga0495632_0050828 Ga0495632_0050828_598_1311 237
378 3300046522 Ga0495643_0010850 Ga0495643_0010850_2905_3618 237
379 3300046522 Ga0495643_0032688 Ga0495643_0032688_146_859 237
380 3300046528 Ga0495642_0003544 Ga0495642_0003544_2062_2775 237
381 3300046528 Ga0495642_0044251 Ga0495642_0044251_186_965 237
382 3300046528 Ga0495642_0154027 Ga0495642_0154027_170_883 237
383 3300046542 Ga0495597_0007276 Ga0495597_0007276_2254_2967 237
384 3300046542 Ga0495597_0042758 Ga0495597_0042758_1269_1982 237
385 3300046616 Ga0495668_0017470 Ga0495668_0017470_2977_3690 237
386 3300046648 Ga0495611_0048337 Ga0495611_0048337_858_1571 237
387 3300046660 Ga0495625_0000673 Ga0495625_0000673_35497_36210 237
388 3300046660 Ga0495625_0026166 Ga0495625_0026166_490_1203 237
389 3300046665 Ga0495661_0012220 Ga0495661_0012220_2027_2740 237
390 3300046665 Ga0495661_0021567 Ga0495661_0021567_1679_2392 237
391 3300046680 Ga0495646_0305569 Ga0495646_0305569_91_804 237
392 3300046683 Ga0495658_0039692 Ga0495658_0039692_445_1158 237
393 3300046692 Ga0495671_0068433 Ga0495671_0068433_274_987 237
394 3300046810 Ga0495660_0018201 Ga0495660_0018201_156_869 237
395 3300047318 Ga0495636_0154734 Ga0495636_0154734_179_892 237
396 3300047320 Ga0495672_0000036 Ga0495672_0000036_41197_41910 237
397 3300047443 Ga0495687_003725 Ga0495687_003725_8105_8818 237
398 3300047443 Ga0495687_005772 Ga0495687_005772_6515_7228 237
399 3300047443 Ga0495687_005773 Ga0495687_005773_6515_7228 237
400 3300047443 Ga0495687_012330 Ga0495687_012330_2072_2785 237
401 3300047443 Ga0495687_025960 Ga0495687_025960_225_938 237
402 3300048091 Ga0495626_0104219 Ga0495626_0104219_459_1172 237
403 3300048904 Ga0496101_0208792 Ga0496101_0208792_362_1099 237
404 3300048906 Ga0496103_0013398 Ga0496103_0013398_367_1080 237
405 3300048910 Ga0496107_0288281 Ga0496107_0288281_202_915 237
406 3300048914 Ga0496111_0191375 Ga0496111_0191375_338_1051 237
407 3300048919 Ga0496116_0004558 Ga0496116_0004558_6647_7360 237
408 3300048924 Ga0496121_0345715 Ga0496121_0345715_193_906 237
409 3300048925 Ga0496122_0000801 Ga0496122_0000801_29741_30454 237
410 3300048926 Ga0496123_0000528 Ga0496123_0000528_35379_36092 237
411 3300048928 Ga0496125_0004529 Ga0496125_0004529_12733_13446 237
412 3300049573 Ga0501037_0023442 Ga0501037_0023442_1565_2281 237
413 3300050489 nmdc:mga03683_107837_c1 nmdc:mga03683_107837_c1_303_1016 237
414 3300050492 nmdc:mga0yw44_285693_c1 nmdc:mga0yw44_285693_c1_54_767 237
415 3300050493 nmdc:mga0k408_160648_c1 nmdc:mga0k408_160648_c1_215_928 237
416 3300050493 nmdc:mga0k408_1828_c2 nmdc:mga0k408_1828_c2_5954_6667 237
417 3300050494 nmdc:mga06z11_207521_c1 nmdc:mga06z11_207521_c1_129_842 237
418 3300050496 nmdc:mga07m45_1471_c1 nmdc:mga07m45_1471_c1_5738_6451 237
419 3300050496 nmdc:mga07m45_43057_c1 nmdc:mga07m45_43057_c1_575_1288 237
420 3300050496 nmdc:mga07m45_67182_c2 nmdc:mga07m45_67182_c2_320_1033 237
421 3300050496 nmdc:mga07m45_8963_c1 nmdc:mga07m45_8963_c1_4036_4749 237
422 3300050507 nmdc:mga05p37_399618_c1 nmdc:mga05p37_399618_c1_516_1229 237
423 3300050516 nmdc:mga0sz30_56789_c1 nmdc:mga0sz30_56789_c1_300_1013 237
424 3300053086 Ga0500578_0000437 Ga0500578_0000437_45173_45886 237
425 3300053093 Ga0500651_0027776 Ga0500651_0027776_1890_2603 237
426 3300053093 Ga0500651_0042097 Ga0500651_0042097_1566_2279 237
427 3300053118 Ga0500594_0007781 Ga0500594_0007781_202_915 237
428 3300053125 Ga0500618_000922 Ga0500618_000922_6733_7446 237
429 3300053125 Ga0500618_002393 Ga0500618_002393_5356_6069 237
430 3300053130 Ga0500642_0004416 Ga0500642_0004416_1743_2456 237
431 3300053131 Ga0500652_000312 Ga0500652_000312_3527_4240 237
432 3300053136 Ga0500559_0000602 Ga0500559_0000602_12509_13222 237
433 3300053139 Ga0500568_0022336 Ga0500568_0022336_209_922 237
434 3300053154 Ga0500619_000040 Ga0500619_000040_18770_19561 237
435 3300053156 Ga0500622_0000164 Ga0500622_0000164_47655_48368 237
436 3300053177 Ga0500636_0080448 Ga0500636_0080448_1017_1730 237
437 3300053726 Ga0500584_088842 Ga0500584_088842_300_1013 237
438 3300059504 Ga0587082_000257 Ga0587082_000257_1660_2379 237
439 3300061719 Ga0466962_0164083 Ga0466962_0164083_166_879 237
440 3300061719 Ga0466962_0287063 Ga0466962_0287063_22_735 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

214

235

0.98

PF00005

ABC_tran

ABC transporter

19

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.937 4 235
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.928 4 234
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9217 4 235
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9211 1 223
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9204 1 223
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.947 3 236 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9314 3 236 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9241 2 226 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9221 2 224 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9213 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6J6GRK5-F1-model_v4 Unannotated protein 0.9682 111 235 GO:0005524
GO:0005886
GO:0016887
AF-A0A257UMR1-F1-model_v4 deleted 0.9649 1 235
AF-A0A537X5T0-F1-model_v4 ABC transporter ATP-binding protein 0.9585 3 235 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A538R5L1-F1-model_v4 Branched-chain amino acid ABC transporter ATP-binding protein/permease 0.9584 4 235 GO:0005524
GO:0005886
GO:0015658
GO:0016887
AF-A0A5P2H818-F1-model_v4 ABC transporter ATP-binding protein 0.9553 1 235 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Feature Viewer

pLDDT pTM Quality
92.93 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map