F444522

General Info

Members Datasets Scaffolds Average Seq Length
440 283 425 203

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0056858|Ga0501067_0056858_961_1659
Length 232
Sequence LAGVCSVSVTDDFPYLDKKSCRWQTEAMLELAVIEDPAVAEVSLDPVRSRLLAELAEPGSATTLATTLGMPRQNVNYHLKELERHGLVDLVEERRKGNMTERLLQATALSYVISPAALASVQPDPTRSPDRLSARWLIAVASALVRDVGELLAGATKARKRLATFAMDGEVRFASAADRAAFAEELARAVTSLVGKYHDEHAKGGRDHRVIVAVHPSVKPDAPDTNDRPSDP

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2643221549 Agromyces sp. Root1464 Isolate Unclassified
4 2643221714 Streptomyces sp. Root264 Isolate Unclassified
5 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
6 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
7 2867369537 Streptomyces sp. Z26 Isolate Unclassified
8 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
9 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
10 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
11 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
12 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
13 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
129 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
130 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
131 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
132 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
170 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
176 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
277 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
282 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
283 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.23
Isolates 3.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 0.68
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010660 3300001989 Bacteria 3409
2 rootH1_10007091 3300003316 Bacteria 25135
3 rootH2_10036518 3300003320 Bacteria 24238
4 rootH1_10032446 3300003323 Bacteria 6105
5 Ga0006562J51391_1040961 3300003578 Bacteria 2192
6 Ga0070676_10327097 3300005328 Bacteria 1047
7 Ga0068869_100004552 3300005334 Bacteria 8633
8 Ga0070680_100313123 3300005336 Bacteria 1332
9 Ga0068868_100221968 3300005338 Bacteria 1582
10 Ga0070660_100051174 3300005339 Bacteria 3180
11 Ga0070692_10014319 3300005345 Bacteria 3722
12 Ga0070692_10038640 3300005345 Bacteria 2434
13 Ga0070668_100000522 3300005347 Bacteria 25465
14 Ga0070668_100220305 3300005347 Bacteria 1565
15 Ga0070668_100988526 3300005347 Bacteria 756
16 Ga0070675_100007215 3300005354 Bacteria 8568
17 Ga0070659_100105072 3300005366 Bacteria 2275
18 Ga0070667_100075270 3300005367 Bacteria 2882
19 Ga0070667_101187366 3300005367 Bacteria 714
20 Ga0070714_100011879 3300005435 Bacteria 6923
21 Ga0070714_100394600 3300005435 Bacteria 1307
22 Ga0070713_100259250 3300005436 Bacteria 1588
23 Ga0070710_10000205 3300005437 Bacteria 27877
24 Ga0070710_10014839 3300005437 Bacteria 3927
25 Ga0070700_100041042 3300005441 Bacteria 2835
26 Ga0070694_100007524 3300005444 Bacteria 6647
27 Ga0070708_100017977 3300005445 Bacteria 5911
28 Ga0070708_100856055 3300005445 Unclassified 854
29 Ga0070663_100000870 3300005455 Bacteria 16412
30 Ga0070663_100050423 3300005455 Bacteria 2960
31 Ga0070706_100000265 3300005467 Bacteria 63782
32 Ga0070707_100000577 3300005468 Bacteria 36858
33 Ga0070707_100356565 3300005468 Bacteria 1420
34 Ga0070707_101260143 3300005468 Bacteria 706
35 Ga0070698_100008306 3300005471 Bacteria 11224
36 Ga0070698_100017794 3300005471 Bacteria 7486
37 Ga0070699_100097961 3300005518 Bacteria 2569
38 Ga0070699_101242989 3300005518 Bacteria 683
39 Ga0070684_100122008 3300005535 Bacteria 2345
40 Ga0070684_101130256 3300005535 Bacteria 736
41 Ga0068853_100114284 3300005539 Bacteria 2401
42 Ga0070672_100580430 3300005543 Bacteria 975
43 Ga0070686_100414001 3300005544 Bacteria 1028
44 Ga0070695_100355361 3300005545 Bacteria 1099
45 Ga0070695_100433581 3300005545 Bacteria 1003
46 Ga0070696_100309869 3300005546 Bacteria 1212
47 Ga0070696_100352370 3300005546 Bacteria 1140
48 Ga0070693_100251715 3300005547 Bacteria 1171
49 Ga0070704_100019648 3300005549 Bacteria 4344
50 Ga0070704_100165792 3300005549 Bacteria 1751
51 Ga0068857_100420680 3300005577 Bacteria 1246
52 Ga0068854_100234934 3300005578 Bacteria 1457
53 Ga0070702_100806945 3300005615 Bacteria 726
54 Ga0068852_100512273 3300005616 Bacteria 1196
55 Ga0068861_100615940 3300005719 Bacteria 998
56 Ga0068861_100976133 3300005719 Bacteria 807
57 Ga0068851_10155341 3300005834 Bacteria 1253
58 Ga0068863_100331685 3300005841 Bacteria 1479
59 Ga0068858_100991094 3300005842 Bacteria 823
60 Ga0068860_100029367 3300005843 Bacteria 5287
61 Ga0068860_100047528 3300005843 Bacteria 4090
62 Ga0068860_101504751 3300005843 Bacteria 695
63 Ga0068862_100146690 3300005844 Bacteria 2097
64 Ga0068862_100184943 3300005844 Bacteria 1872
65 Ga0081455_10000480 3300005937 Bacteria 51756
66 Ga0081455_10006802 3300005937 Bacteria 12189
67 Ga0081455_10180358 3300005937 Bacteria 1599
68 Ga0081455_10510618 3300005937 Bacteria 805
69 Ga0081539_10098230 3300005985 Bacteria 1498
70 Ga0070717_10130915 3300006028 Bacteria 2157
71 Ga0070717_10252179 3300006028 Bacteria 1559
72 Ga0075432_10042743 3300006058 Bacteria 1586
73 Ga0070716_100464575 3300006173 Bacteria 926
74 Ga0070712_100167211 3300006175 Bacteria 1703
75 Ga0070712_100763240 3300006175 Bacteria 828
76 Ga0075430_100070097 3300006846 Bacteria 2940
77 Ga0075430_100327630 3300006846 Bacteria 1266
78 Ga0075434_100239745 3300006871 Bacteria 1833
79 Ga0075429_100603757 3300006880 Bacteria 961
80 Ga0068865_100106296 3300006881 Bacteria 2063
81 Ga0075436_100747624 3300006914 Bacteria 726
82 Ga0111539_10003945 3300009094 Bacteria 19499
83 Ga0105245_10006999 3300009098 Bacteria 9895
84 Ga0105247_10537604 3300009101 Bacteria 857
85 Ga0114129_10015968 3300009147 Bacteria 10678
86 Ga0114129_10024253 3300009147 Bacteria 8593
87 Ga0114129_10203914 3300009147 Unclassified 2677
88 Ga0114129_10299657 3300009147 Bacteria 2143
89 Ga0105243_10340301 3300009148 Bacteria 1374
90 Ga0105243_10641407 3300009148 Bacteria 1028
91 Ga0105243_11213267 3300009148 Bacteria 768
92 Ga0105238_10232105 3300009551 Bacteria 1822
93 Ga0105238_10810492 3300009551 Bacteria 952
94 Ga0105249_10065229 3300009553 Bacteria 3350
95 Ga0105249_11490681 3300009553 Bacteria 749
96 Ga0105246_10035104 3300011119 Bacteria 3349
97 Ga0105246_10205544 3300011119 Bacteria 1534
98 Ga0105246_10417413 3300011119 Bacteria 1119
99 Ga0163162_10711304 3300013306 Bacteria 1126
100 Ga0157375_10198554 3300013308 Bacteria 2161
101 Ga0157375_10774216 3300013308 Bacteria 1110
102 Ga0157375_11025678 3300013308 Bacteria 964
103 Ga0157380_10140204 3300014326 Bacteria 2076
104 Ga0182008_10268075 3300014497 Bacteria 885
105 Ga0157377_10015342 3300014745 Bacteria 3917
106 Ga0157379_10037159 3300014968 Bacteria 4342
107 Ga0163161_10553539 3300017792 Bacteria 943
108 Ga0213875_10049617 3300021388 Bacteria 1967
109 Ga0207656_10234020 3300025321 Bacteria 896
110 Ga0207692_10000190 3300025898 Bacteria 20137
111 Ga0207692_10084299 3300025898 Bacteria 1707
112 Ga0207685_10037137 3300025905 Bacteria 1791
113 Ga0207699_10148696 3300025906 Bacteria 1547
114 Ga0207645_10436272 3300025907 Bacteria 883
115 Ga0207643_10116141 3300025908 Bacteria 1580
116 Ga0207684_10000221 3300025910 Bacteria 87708
117 Ga0207663_10068806 3300025916 Bacteria 2275
118 Ga0207660_10132134 3300025917 Bacteria 1901
119 Ga0207662_10150609 3300025918 Bacteria 1479
120 Ga0207657_10045837 3300025919 Bacteria 3833
121 Ga0207649_10083118 3300025920 Bacteria 2078
122 Ga0207646_10003675 3300025922 Bacteria 17131
123 Ga0207646_10064540 3300025922 Bacteria 3269
124 Ga0207694_10181097 3300025924 Bacteria 1709
125 Ga0207650_10283056 3300025925 Bacteria 1351
126 Ga0207659_10165417 3300025926 Bacteria 1741
127 Ga0207687_10231177 3300025927 Bacteria 1461
128 Ga0207700_10012818 3300025928 Bacteria 5422
129 Ga0207700_10569755 3300025928 Bacteria 1006
130 Ga0207664_10047139 3300025929 Bacteria 3385
131 Ga0207664_10050781 3300025929 Bacteria 3271
132 Ga0207664_10428874 3300025929 Bacteria 1178
133 Ga0207690_10220876 3300025932 Bacteria 1450
134 Ga0207706_10052288 3300025933 Bacteria 3606
135 Ga0207704_10090700 3300025938 Bacteria 2007
136 Ga0207665_10003224 3300025939 Bacteria 10929
137 Ga0207691_10304697 3300025940 Bacteria 1368
138 Ga0207689_10085580 3300025942 Bacteria 2591
139 Ga0207679_10008346 3300025945 Bacteria 6596
140 Ga0207712_10040441 3300025961 Bacteria 3200
141 Ga0207712_10292622 3300025961 Bacteria 1333
142 Ga0207668_10042919 3300025972 Bacteria 3065
143 Ga0207668_10252363 3300025972 Bacteria 1433
144 Ga0207668_10355106 3300025972 Bacteria 1227
145 Ga0207658_10510214 3300025986 Bacteria 1072
146 Ga0207658_11024441 3300025986 Bacteria 753
147 Ga0207703_10869734 3300026035 Bacteria 862
148 Ga0207639_10095767 3300026041 Bacteria 2386
149 Ga0207678_10000795 3300026067 Bacteria 28948
150 Ga0207678_10067333 3300026067 Bacteria 3074
151 Ga0207708_10013801 3300026075 Bacteria 6040
152 Ga0207708_10119994 3300026075 Bacteria 2048
153 Ga0207702_10470445 3300026078 Bacteria 1222
154 Ga0207676_10165311 3300026095 Bacteria 1922
155 Ga0207674_10154532 3300026116 Bacteria 2250
156 Ga0207674_10206066 3300026116 Bacteria 1916
157 Ga0207675_100498013 3300026118 Bacteria 1213
158 Ga0207675_100723465 3300026118 Bacteria 1005
159 Ga0207683_11191580 3300026121 Bacteria 706
160 Ga0207698_10205768 3300026142 Bacteria 1766
161 Ga0207428_10045282 3300027907 Bacteria 3545
162 Ga0268265_10260231 3300028380 Bacteria 1542
163 Ga0268265_10283510 3300028380 Bacteria 1483
164 Ga0268265_10308475 3300028380 Bacteria 1428
165 Ga0268264_10076263 3300028381 Bacteria 2852
166 Ga0268264_10212711 3300028381 Bacteria 1776
167 Ga0268264_10248773 3300028381 Bacteria 1650
168 Ga0307515_10045474 3300028794 Bacteria 6744
169 Ga0307512_10029391 3300030522 Bacteria 4804
170 Ga0316177_1125370 3300030731 Bacteria 6877
171 Ga0316176_1022213 3300030732 Bacteria 5789
172 Ga0314311_1016989 3300030733 Bacteria 787
173 Ga0314311_1091553 3300030733 Bacteria 2910
174 Ga0316178_1049729 3300030735 Bacteria 1658
175 Ga0307513_10170435 3300031456 Bacteria 2055
176 Ga0307513_10182191 3300031456 Bacteria 1962
177 Ga0307513_10283533 3300031456 Bacteria 1432
178 Ga0307509_10074584 3300031507 Bacteria 3527
179 Ga0307509_10291245 3300031507 Bacteria 1387
180 Ga0307408_100033603 3300031548 Bacteria 3585
181 Ga0307514_10002565 3300031649 Bacteria 18686
182 Ga0307514_10075587 3300031649 Bacteria 2511
183 Ga0307514_10416884 3300031649 Bacteria 677
184 Ga0307516_10008198 3300031730 Bacteria 11865
185 Ga0307516_10160305 3300031730 Bacteria 2000
186 Ga0307405_10045996 3300031731 Bacteria 2678
187 Ga0307518_10072157 3300031838 Bacteria 2500
188 Ga0307410_10057861 3300031852 Bacteria 2641
189 Ga0307406_10014406 3300031901 Bacteria 4549
190 Ga0307406_10199700 3300031901 Bacteria 1471
191 Ga0307407_10086237 3300031903 Bacteria 1912
192 Ga0307409_100001275 3300031995 Bacteria 12175
193 Ga0307409_100042111 3300031995 Bacteria 3417
194 Ga0307409_100317646 3300031995 Bacteria 1456
195 Ga0307416_100001036 3300032002 Bacteria 14774
196 Ga0307414_10230698 3300032004 Bacteria 1526
197 Ga0307415_100031202 3300032126 Bacteria 3430
198 Ga0307415_100035138 3300032126 Bacteria 3271
199 Ga0307415_100114129 3300032126 Bacteria 2011
200 Ga0307415_100642713 3300032126 Bacteria 950
201 Ga0307415_101290656 3300032126 Bacteria 691
202 Ga0307507_10000016 3300033179 Bacteria 225984
203 Ga0307507_10122055 3300033179 Bacteria 2080
204 Ga0307507_10134011 3300033179 Bacteria 1926
205 Ga0307510_10039047 3300033180 Bacteria 5238
206 Ga0307510_10052152 3300033180 Bacteria 4317
207 Ga0307510_10079976 3300033180 Bacteria 3181
208 Ga0307510_10115169 3300033180 Bacteria 2414
209 Ga0373934_0023282 3300035086 Bacteria 2393
210 Ga0373951_0000038 3300035091 Bacteria 51362
211 Ga0373923_0085474 3300035111 Bacteria 1373
212 Ga0373953_0128058 3300035117 Bacteria 1081
213 Ga0373956_0005186 3300035119 Bacteria 5218
214 Ga0373957_0006185 3300035120 Bacteria 3760
215 Ga0373955_0190407 3300035172 Bacteria 1219
216 Ga0373924_0127045 3300035410 Bacteria 1108
217 Ga0373935_0318937 3300035692 Bacteria 1102
218 Ga0373933_0395173 3300035724 Bacteria 901
219 Ga0373947_0067275 3300035725 Bacteria 2188
220 Ga0373937_0223043 3300036401 Bacteria 1774
221 Ga0373925_0024679 3300037068 Bacteria 4390
222 Ga0373925_0100323 3300037068 Bacteria 2225
223 Ga0395899_0005196 3300037312 Bacteria 10126
224 Ga0395899_0143987 3300037312 Bacteria 1694
225 Ga0395900_0020662 3300037418 Bacteria 6728
226 Ga0395900_0089422 3300037418 Bacteria 3165
227 Ga0395900_0288366 3300037418 Bacteria 1631
228 Ga0395900_0400283 3300037418 Bacteria 1337
229 Ga0395898_0010050 3300037466 Bacteria 9905
230 Ga0395898_0222316 3300037466 Bacteria 1801
231 Ga0395898_0466104 3300037466 Bacteria 1202
232 Ga0395898_0778938 3300037466 Bacteria 897
233 Ga0395905_0008137 3300037471 Bacteria 10357
234 Ga0395905_0041937 3300037471 Bacteria 4294
235 Ga0436364_0827580 3300037853 Bacteria 3469
236 Ga0436364_1156310 3300037853 Bacteria 4457
237 Ga0395901_0005748 3300038443 Bacteria 12560
238 Ga0395901_0010059 3300038443 Bacteria 9587
239 Ga0395901_0011408 3300038443 Bacteria 9005
240 Ga0395901_0082237 3300038443 Bacteria 3364
241 Ga0439461_0045491 3300041410 Bacteria 960
242 Ga0439461_0103750 3300041410 Bacteria 695
243 Ga0451795_1160994 3300041456 Bacteria 1300
244 Ga0451839_0465200 3300041496 Bacteria 760
245 Ga0439448_0038169 3300042005 Bacteria 1546
246 Ga0439448_0100435 3300042005 Bacteria 983
247 Ga0439449_0070626 3300042007 Bacteria 1287
248 Ga0450894_000332 3300042131 Bacteria 8327
249 Ga0450898_000357 3300042134 Bacteria 5227
250 Ga0450899_005332 3300042135 Bacteria 1381
251 Ga0450906_002045 3300042145 Bacteria 4406
252 Ga0439459_0049277 3300042438 Bacteria 920
253 Ga0439460_0174456 3300042461 Bacteria 725
254 Ga0466969_0003119 3300044656 Bacteria 8829
255 Ga0466969_0130705 3300044656 Bacteria 1164
256 Ga0466969_0207417 3300044656 Bacteria 893
257 Ga0466972_0001447 3300044658 Bacteria 11536
258 Ga0466972_0006998 3300044658 Bacteria 5657
259 Ga0466972_0013620 3300044658 Bacteria 4081
260 Ga0466965_0004325 3300044683 Bacteria 6310
261 Ga0466965_0010989 3300044683 Bacteria 4234
262 Ga0466965_0066578 3300044683 Bacteria 1806
263 Ga0466965_0116642 3300044683 Bacteria 1376
264 Ga0466966_0006168 3300044684 Bacteria 7923
265 Ga0466966_0020489 3300044684 Bacteria 4347
266 Ga0466966_0113288 3300044684 Bacteria 1670
267 Ga0466966_0393009 3300044684 Bacteria 833
268 Ga0466961_0368313 3300044693 Bacteria 873
269 Ga0466971_0006581 3300044719 Bacteria 5049
270 Ga0466971_0036983 3300044719 Bacteria 2189
271 Ga0466971_0102903 3300044719 Bacteria 1313
272 Ga0466970_0046109 3300044765 Bacteria 2321
273 Ga0466970_0147728 3300044765 Bacteria 1297
274 Ga0466960_0001345 3300044901 Bacteria 8935
275 Ga0466959_0005066 3300045049 Bacteria 8961
276 Ga0466959_0040854 3300045049 Bacteria 3426
277 Ga0466959_0233143 3300045049 Bacteria 1273
278 Ga0451576_0145314 3300045051 Bacteria 2473
279 Ga0466958_0049855 3300045836 Bacteria 2534
280 Ga0466958_0167136 3300045836 Bacteria 1392
281 Ga0466958_0230614 3300045836 Bacteria 1182
282 Ga0466967_0436087 3300045976 Bacteria 1279
283 Ga0495627_063881 3300046453 Bacteria 1084
284 Ga0495592_0045039 3300046454 Bacteria 3293
285 Ga0495603_0010775 3300046455 Bacteria 5544
286 Ga0495603_0210934 3300046455 Bacteria 1121
287 Ga0495603_0582550 3300046455 Bacteria 640
288 Ga0495629_0010092 3300046459 Bacteria 6890
289 Ga0495629_0034304 3300046459 Bacteria 3588
290 Ga0495651_0002267 3300046462 Bacteria 14850
291 Ga0495651_0065472 3300046462 Bacteria 2775
292 Ga0495651_0132605 3300046462 Bacteria 1817
293 Ga0495653_0137041 3300046463 Bacteria 1725
294 Ga0495580_0038098 3300046472 Bacteria 3446
295 Ga0495582_0000326 3300046473 Bacteria 26091
296 Ga0495639_0018254 3300046475 Bacteria 3053
297 Ga0495662_0002979 3300046476 Bacteria 8548
298 Ga0495664_0013709 3300046477 Bacteria 4597
299 Ga0495585_0029980 3300046492 Bacteria 3095
300 Ga0495585_0168683 3300046492 Bacteria 1132
301 Ga0495594_0049915 3300046499 Bacteria 2301
302 Ga0495594_0105946 3300046499 Bacteria 1583
303 Ga0495607_0232416 3300046501 Bacteria 896
304 Ga0495608_0264781 3300046511 Bacteria 1069
305 Ga0495618_0053680 3300046514 Bacteria 2548
306 Ga0495618_0229112 3300046514 Bacteria 1170
307 Ga0495628_0091562 3300046516 Bacteria 2353
308 Ga0495628_0236004 3300046516 Bacteria 1369
309 Ga0495628_0503402 3300046516 Bacteria 874
310 Ga0495630_0192038 3300046517 Bacteria 1558
311 Ga0495630_0417874 3300046517 Bacteria 1027
312 Ga0495631_0074382 3300046518 Bacteria 1467
313 Ga0495644_0129603 3300046523 Bacteria 961
314 Ga0495666_0043646 3300046526 Bacteria 2166
315 Ga0495666_0236064 3300046526 Bacteria 835
316 Ga0495652_0015131 3300046529 Bacteria 6910
317 Ga0495652_0262396 3300046529 Bacteria 1274
318 Ga0495665_0007940 3300046531 Bacteria 5754
319 Ga0495640_0052137 3300046533 Bacteria 2810
320 Ga0495640_0165074 3300046533 Bacteria 1417
321 Ga0495587_0007492 3300046536 Bacteria 7067
322 Ga0495587_0093952 3300046536 Bacteria 1731
323 Ga0495609_0042110 3300046538 Bacteria 2051
324 Ga0495645_0070064 3300046543 Bacteria 2531
325 Ga0495645_0112380 3300046543 Bacteria 1926
326 Ga0495622_0009764 3300046557 Bacteria 4437
327 Ga0495667_0207662 3300046559 Bacteria 1252
328 Ga0495668_0302524 3300046616 Bacteria 877
329 Ga0495634_0007955 3300046642 Bacteria 7909
330 Ga0495634_0038015 3300046642 Bacteria 3284
331 Ga0495634_0089513 3300046642 Bacteria 2000
332 Ga0495611_0327279 3300046648 Bacteria 705
333 Ga0495625_0102264 3300046660 Bacteria 1967
334 Ga0495635_0005450 3300046663 Bacteria 8849
335 Ga0495661_0112303 3300046665 Bacteria 1517
336 Ga0495588_0009293 3300046674 Bacteria 4539
337 Ga0495588_0194296 3300046674 Bacteria 1072
338 Ga0495657_0058335 3300046675 Bacteria 2563
339 Ga0495657_0097541 3300046675 Bacteria 1876
340 Ga0495657_0098255 3300046675 Bacteria 1868
341 Ga0495657_0158164 3300046675 Bacteria 1403
342 Ga0495599_0160331 3300046678 Bacteria 1390
343 Ga0495658_0015487 3300046683 Bacteria 3912
344 Ga0495613_0000892 3300046689 Bacteria 22978
345 Ga0495613_0007892 3300046689 Bacteria 7915
346 Ga0495613_0249231 3300046689 Bacteria 1240
347 Ga0495613_0487244 3300046689 Bacteria 831
348 Ga0495624_0077683 3300046690 Bacteria 2059
349 Ga0495670_0142511 3300046691 Bacteria 1254
350 Ga0495589_0002517 3300046794 Bacteria 10217
351 Ga0495589_0011892 3300046794 Bacteria 4514
352 Ga0495589_0076099 3300046794 Bacteria 1636
353 Ga0495600_0019042 3300046809 Bacteria 4381
354 Ga0495600_0020092 3300046809 Bacteria 4272
355 Ga0495600_0067374 3300046809 Bacteria 2340
356 Ga0495581_0024487 3300047315 Bacteria 3498
357 Ga0495581_0029313 3300047315 Bacteria 3190
358 Ga0495581_0039762 3300047315 Bacteria 2723
359 Ga0495581_0116051 3300047315 Bacteria 1557
360 Ga0495581_0137866 3300047315 Bacteria 1422
361 Ga0495604_0064739 3300047317 Bacteria 2784
362 Ga0495604_0070478 3300047317 Bacteria 2647
363 Ga0495604_0079248 3300047317 Bacteria 2463
364 Ga0495636_0274201 3300047318 Bacteria 784
365 Ga0495674_0299601 3300047319 Bacteria 1313
366 Ga0495676_0010866 3300047321 Bacteria 8235
367 Ga0495676_0033257 3300047321 Bacteria 4345
368 Ga0495676_0106692 3300047321 Bacteria 2063
369 Ga0495680_0094680 3300047322 Bacteria 2234
370 Ga0495683_0037259 3300047323 Bacteria 2466
371 Ga0495687_001750 3300047443 Bacteria 19208
372 Ga0495675_0017176 3300047444 Bacteria 4582
373 Ga0495675_0061239 3300047444 Bacteria 2384
374 Ga0495675_0061597 3300047444 Bacteria 2377
375 Ga0495675_0076492 3300047444 Bacteria 2110
376 Ga0495677_0095670 3300047445 Bacteria 1122
377 Ga0495685_103941 3300047447 Bacteria 937
378 Ga0495681_0051792 3300047470 Bacteria 1929
379 Ga0495684_0030260 3300047471 Bacteria 4157
380 Ga0495602_0071062 3300048088 Bacteria 2974
381 Ga0495614_0078032 3300048089 Bacteria 1433
382 Ga0496106_0139995 3300048909 Bacteria 1903
383 Ga0496111_0305363 3300048914 Bacteria 1179
384 Ga0501031_0088930 3300049568 Bacteria 2014
385 Ga0501031_0134699 3300049568 Bacteria 1614
386 Ga0501032_0116786 3300049569 Bacteria 1764
387 Ga0501032_0124227 3300049569 Bacteria 1705
388 Ga0501033_0006118 3300049570 Bacteria 9441
389 Ga0501034_0266424 3300049571 Bacteria 1655
390 Ga0501036_0058576 3300049572 Bacteria 3263
391 Ga0501037_0094578 3300049573 Bacteria 2161
392 Ga0501038_0048299 3300049574 Bacteria 3683
393 Ga0501039_0064873 3300049575 Bacteria 2832
394 Ga0501039_0269577 3300049575 Bacteria 1338
395 Ga0501043_0033152 3300049579 Bacteria 4063
396 Ga0501043_0038001 3300049579 Bacteria 3786
397 Ga0501046_0221553 3300049580 Bacteria 1400
398 Ga0501047_0030084 3300049581 Bacteria 5236
399 Ga0501047_0051908 3300049581 Bacteria 3963
400 Ga0501047_0361100 3300049581 Bacteria 1288
401 Ga0501047_0458592 3300049581 Bacteria 1103
402 Ga0501067_0056858 3300049583 Bacteria 2167
403 Ga0501075_0140589 3300049591 Bacteria 1840
404 Ga0501035_0057198 3300049822 Bacteria 3477
405 Ga0501035_0117662 3300049822 Bacteria 2325
406 Ga0501044_0013366 3300049823 Bacteria 8877
407 nmdc:mga05p37_129035_c1 3300050507 Bacteria 3104
408 nmdc:mga05p37_493016_c1 3300050507 Bacteria 1408
409 nmdc:mga09592_302208_c1 3300050508 Bacteria 1387
410 nmdc:mga0qj67_449762_c1 3300050509 Bacteria 1038
411 nmdc:mga06r32_796971_c1 3300050510 Bacteria 906
412 nmdc:mga08y16_92741_c1 3300050511 Bacteria 3147
413 nmdc:mga0n895_557876_c1 3300050512 Bacteria 1151
414 nmdc:mga0a205_273819_c1 3300050515 Bacteria 1565
415 Ga0495612_0000131 3300053078 Bacteria 31696
416 Ga0500644_0006108 3300053088 Bacteria 3072
417 Ga0500660_139937 3300053100 Bacteria 964
418 Ga0500553_120362 3300053101 Bacteria 1083
419 Ga0500573_0108248 3300053140 Bacteria 1558
420 Ga0500624_007858 3300053157 Bacteria 1479
421 Ga0501084_0536755 3300054114 Bacteria 989
422 Ga0466962_0004736 3300061719 Bacteria 6539
423 Ga0466962_0029787 3300061719 Bacteria 2613
424 Ga0466962_0086346 3300061719 Bacteria 1502
425 Ga0466962_0100587 3300061719 Bacteria 1388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2558860112 2558912040 186
2 3300006880 Ga0075429_100603757 Ga0075429_1006037572 187
3 3300032126 Ga0307415_100642713 Ga0307415_1006427132 187
4 iso_pu_bacteria 8003314358 8003319966 188
5 3300037418 Ga0395900_0400283 Ga0395900_0400283_742_1323 189
6 iso_pu_bacteria 2795385470 2795783579 189
7 3300005937 Ga0081455_10510618 Ga0081455_105106181 190
8 iso_pu_bacteria 2870721527 2870728836 190
9 iso_pu_bacteria 2917736166 2917736646 190
10 3300009147 Ga0114129_10299657 Ga0114129_102996573 191
11 3300025925 Ga0207650_10283056 Ga0207650_102830563 191
12 3300050507 nmdc:mga05p37_493016_c1 nmdc:mga05p37_493016_c1_275_859 191
13 3300005347 Ga0070668_100000522 Ga0070668_10000052212 192
14 3300005455 Ga0070663_100000870 Ga0070663_1000008704 192
15 3300005544 Ga0070686_100414001 Ga0070686_1004140011 192
16 3300005546 Ga0070696_100352370 Ga0070696_1003523702 192
17 3300005937 Ga0081455_10000480 Ga0081455_1000048032 192
18 3300009147 Ga0114129_10024253 Ga0114129_100242531 192
19 3300025972 Ga0207668_10042919 Ga0207668_100429192 192
20 3300026067 Ga0207678_10000795 Ga0207678_1000079514 192
21 3300026116 Ga0207674_10154532 Ga0207674_101545324 192
22 3300028794 Ga0307515_10045474 Ga0307515_100454746 192
23 3300031649 Ga0307514_10416884 Ga0307514_104168841 192
24 3300031901 Ga0307406_10199700 Ga0307406_101997002 192
25 3300032126 Ga0307415_100031202 Ga0307415_1000312022 192
26 3300033179 Ga0307507_10122055 Ga0307507_101220552 192
27 3300033180 Ga0307510_10052152 Ga0307510_100521524 192
28 3300044656 Ga0466969_0207417 Ga0466969_0207417_185_784 192
29 3300044658 Ga0466972_0006998 Ga0466972_0006998_477_1088 192
30 3300044684 Ga0466966_0393009 Ga0466966_0393009_135_722 192
31 3300044693 Ga0466961_0368313 Ga0466961_0368313_223_810 192
32 3300050507 nmdc:mga05p37_129035_c1 nmdc:mga05p37_129035_c1_2157_2753 192
33 iso_pu_bacteria 2643221549 2643766597 192
34 3300005328 Ga0070676_10327097 Ga0070676_103270972 193
35 3300005334 Ga0068869_100004552 Ga0068869_1000045524 193
36 3300005336 Ga0070680_100313123 Ga0070680_1003131232 193
37 3300005338 Ga0068868_100221968 Ga0068868_1002219682 193
38 3300005339 Ga0070660_100051174 Ga0070660_1000511744 193
39 3300005345 Ga0070692_10014319 Ga0070692_100143192 193
40 3300005347 Ga0070668_100220305 Ga0070668_1002203051 193
41 3300005347 Ga0070668_100988526 Ga0070668_1009885261 193
42 3300005354 Ga0070675_100007215 Ga0070675_1000072159 193
43 3300005366 Ga0070659_100105072 Ga0070659_1001050722 193
44 3300005367 Ga0070667_100075270 Ga0070667_1000752702 193
45 3300005441 Ga0070700_100041042 Ga0070700_1000410424 193
46 3300005455 Ga0070663_100050423 Ga0070663_1000504232 193
47 3300005535 Ga0070684_100122008 Ga0070684_1001220082 193
48 3300005545 Ga0070695_100433581 Ga0070695_1004335811 193
49 3300005547 Ga0070693_100251715 Ga0070693_1002517152 193
50 3300005578 Ga0068854_100234934 Ga0068854_1002349342 193
51 3300005615 Ga0070702_100806945 Ga0070702_1008069451 193
52 3300005616 Ga0068852_100512273 Ga0068852_1005122732 193
53 3300005719 Ga0068861_100615940 Ga0068861_1006159401 193
54 3300005834 Ga0068851_10155341 Ga0068851_101553412 193
55 3300005841 Ga0068863_100331685 Ga0068863_1003316852 193
56 3300005842 Ga0068858_100991094 Ga0068858_1009910941 193
57 3300005843 Ga0068860_100047528 Ga0068860_1000475283 193
58 3300005844 Ga0068862_100146690 Ga0068862_1001466902 193
59 3300006881 Ga0068865_100106296 Ga0068865_1001062963 193
60 3300009094 Ga0111539_10003945 Ga0111539_100039454 193
61 3300009098 Ga0105245_10006999 Ga0105245_100069992 193
62 3300009148 Ga0105243_11213267 Ga0105243_112132672 193
63 3300009551 Ga0105238_10232105 Ga0105238_102321052 193
64 3300013306 Ga0163162_10711304 Ga0163162_107113042 193
65 3300013308 Ga0157375_11025678 Ga0157375_110256782 193
66 3300014326 Ga0157380_10140204 Ga0157380_101402042 193
67 3300014745 Ga0157377_10015342 Ga0157377_100153422 193
68 3300025321 Ga0207656_10234020 Ga0207656_102340201 193
69 3300025907 Ga0207645_10436272 Ga0207645_104362721 193
70 3300025908 Ga0207643_10116141 Ga0207643_101161411 193
71 3300025917 Ga0207660_10132134 Ga0207660_101321342 193
72 3300025918 Ga0207662_10150609 Ga0207662_101506092 193
73 3300025919 Ga0207657_10045837 Ga0207657_100458374 193
74 3300025920 Ga0207649_10083118 Ga0207649_100831182 193
75 3300025924 Ga0207694_10181097 Ga0207694_101810972 193
76 3300025927 Ga0207687_10231177 Ga0207687_102311772 193
77 3300025932 Ga0207690_10220876 Ga0207690_102208761 193
78 3300025933 Ga0207706_10052288 Ga0207706_100522884 193
79 3300025938 Ga0207704_10090700 Ga0207704_100907003 193
80 3300025942 Ga0207689_10085580 Ga0207689_100855801 193
81 3300025945 Ga0207679_10008346 Ga0207679_100083467 193
82 3300025972 Ga0207668_10252363 Ga0207668_102523633 193
83 3300025986 Ga0207658_10510214 Ga0207658_105102142 193
84 3300026035 Ga0207703_10869734 Ga0207703_108697341 193
85 3300026067 Ga0207678_10067333 Ga0207678_100673334 193
86 3300026075 Ga0207708_10013801 Ga0207708_100138011 193
87 3300026078 Ga0207702_10470445 Ga0207702_104704452 193
88 3300026118 Ga0207675_100723465 Ga0207675_1007234651 193
89 3300026121 Ga0207683_11191580 Ga0207683_111915801 193
90 3300026142 Ga0207698_10205768 Ga0207698_102057682 193
91 3300028380 Ga0268265_10283510 Ga0268265_102835102 193
92 3300028380 Ga0268265_10308475 Ga0268265_103084753 193
93 3300028381 Ga0268264_10076263 Ga0268264_100762633 193
94 3300030733 Ga0314311_1016989 Ga0314311_10169892 193
95 3300031995 Ga0307409_100042111 Ga0307409_1000421114 193
96 3300050511 nmdc:mga08y16_92741_c1 nmdc:mga08y16_92741_c1_475_1056 193
97 iso_pu_bacteria 2867369537 2867372047 193
98 3300005437 Ga0070710_10000205 Ga0070710_1000020513 194
99 3300005545 Ga0070695_100355361 Ga0070695_1003553612 194
100 3300005937 Ga0081455_10006802 Ga0081455_100068029 194
101 3300005985 Ga0081539_10098230 Ga0081539_100982302 194
102 3300006914 Ga0075436_100747624 Ga0075436_1007476242 194
103 3300009147 Ga0114129_10203914 Ga0114129_102039141 194
104 3300009551 Ga0105238_10810492 Ga0105238_108104922 194
105 3300013308 Ga0157375_10198554 Ga0157375_101985543 194
106 3300025898 Ga0207692_10000190 Ga0207692_100001905 194
107 3300030731 Ga0316177_1125370 Ga0316177_11253707 194
108 3300030732 Ga0316176_1022213 Ga0316176_10222135 194
109 3300030733 Ga0314311_1091553 Ga0314311_10915533 194
110 3300030735 Ga0316178_1049729 Ga0316178_10497293 194
111 3300031456 Ga0307513_10170435 Ga0307513_101704352 194
112 3300031456 Ga0307513_10182191 Ga0307513_101821912 194
113 3300031548 Ga0307408_100033603 Ga0307408_1000336036 194
114 3300031731 Ga0307405_10045996 Ga0307405_100459964 194
115 3300031852 Ga0307410_10057861 Ga0307410_100578614 194
116 3300031901 Ga0307406_10014406 Ga0307406_100144067 194
117 3300031903 Ga0307407_10086237 Ga0307407_100862373 194
118 3300031995 Ga0307409_100001275 Ga0307409_1000012758 194
119 3300032002 Ga0307416_100001036 Ga0307416_1000010364 194
120 3300032004 Ga0307414_10230698 Ga0307414_102306982 194
121 3300032126 Ga0307415_100035138 Ga0307415_1000351385 194
122 3300032126 Ga0307415_101290656 Ga0307415_1012906561 194
123 3300035091 Ga0373951_0000038 Ga0373951_0000038_3391_3981 194
124 3300035725 Ga0373947_0067275 Ga0373947_0067275_118_714 194
125 3300037068 Ga0373925_0024679 Ga0373925_0024679_3744_4340 194
126 3300038443 Ga0395901_0082237 Ga0395901_0082237_1709_2305 194
127 3300042005 Ga0439448_0100435 Ga0439448_0100435_277_873 194
128 3300042007 Ga0439449_0070626 Ga0439449_0070626_80_664 194
129 3300042438 Ga0439459_0049277 Ga0439459_0049277_72_671 194
130 3300044658 Ga0466972_0001447 Ga0466972_0001447_7137_7733 194
131 3300044683 Ga0466965_0004325 Ga0466965_0004325_4852_5448 194
132 3300044683 Ga0466965_0010989 Ga0466965_0010989_3291_3887 194
133 3300044683 Ga0466965_0066578 Ga0466965_0066578_536_1135 194
134 3300044684 Ga0466966_0113288 Ga0466966_0113288_413_1009 194
135 3300044719 Ga0466971_0102903 Ga0466971_0102903_454_1050 194
136 3300044901 Ga0466960_0001345 Ga0466960_0001345_105_701 194
137 3300045049 Ga0466959_0233143 Ga0466959_0233143_188_784 194
138 3300046455 Ga0495603_0582550 Ga0495603_0582550_29_625 194
139 3300046459 Ga0495629_0010092 Ga0495629_0010092_5998_6594 194
140 3300046472 Ga0495580_0038098 Ga0495580_0038098_1562_2158 194
141 3300046473 Ga0495582_0000326 Ga0495582_0000326_18345_18941 194
142 3300046475 Ga0495639_0018254 Ga0495639_0018254_1419_2015 194
143 3300046517 Ga0495630_0417874 Ga0495630_0417874_333_929 194
144 3300046526 Ga0495666_0043646 Ga0495666_0043646_129_725 194
145 3300046531 Ga0495665_0007940 Ga0495665_0007940_3914_4510 194
146 3300046648 Ga0495611_0327279 Ga0495611_0327279_58_669 194
147 3300046683 Ga0495658_0015487 Ga0495658_0015487_2006_2602 194
148 3300046689 Ga0495613_0000892 Ga0495613_0000892_1671_2267 194
149 3300047315 Ga0495581_0039762 Ga0495581_0039762_1410_2006 194
150 3300047321 Ga0495676_0010866 Ga0495676_0010866_4253_4849 194
151 3300048914 Ga0496111_0305363 Ga0496111_0305363_155_790 194
152 3300049575 Ga0501039_0269577 Ga0501039_0269577_180_791 194
153 3300049591 Ga0501075_0140589 Ga0501075_0140589_40_651 194
154 3300053100 Ga0500660_139937 Ga0500660_139937_258_845 194
155 3300054114 Ga0501084_0536755 Ga0501084_0536755_195_797 194
156 iso_pu_bacteria 2582581314 2585317746 194
157 iso_pu_bacteria 2643221714 2644630478 194
158 iso_pu_bacteria 2863404153 2863406470 194
159 iso_pu_bacteria 2912723979 2912725696 194
160 iso_pu_bacteria 2919468124 2919475293 194
161 iso_pu_bacteria 2946072368 2946074364 194
162 iso_pu_bacteria 2990059506 2990066284 194
163 iso_pu_bacteria 8056829672 8056833081 194
164 3300005549 Ga0070704_100165792 Ga0070704_1001657922 195
165 3300005577 Ga0068857_100420680 Ga0068857_1004206803 195
166 3300006058 Ga0075432_10042743 Ga0075432_100427431 195
167 3300006175 Ga0070712_100763240 Ga0070712_1007632402 195
168 3300006846 Ga0075430_100070097 Ga0075430_1000700972 195
169 3300006871 Ga0075434_100239745 Ga0075434_1002397452 195
170 3300009148 Ga0105243_10641407 Ga0105243_106414072 195
171 3300013308 Ga0157375_10774216 Ga0157375_107742162 195
172 3300014497 Ga0182008_10268075 Ga0182008_102680752 195
173 3300025926 Ga0207659_10165417 Ga0207659_101654172 195
174 3300025961 Ga0207712_10292622 Ga0207712_102926222 195
175 3300025972 Ga0207668_10355106 Ga0207668_103551062 195
176 3300026116 Ga0207674_10206066 Ga0207674_102060663 195
177 3300027907 Ga0207428_10045282 Ga0207428_100452822 195
178 3300028381 Ga0268264_10212711 Ga0268264_102127112 195
179 3300031507 Ga0307509_10291245 Ga0307509_102912452 195
180 3300033179 Ga0307507_10000016 Ga0307507_1000001686 195
181 3300037853 Ga0436364_0827580 Ga0436364_0827580_762_1388 195
182 3300044683 Ga0466965_0116642 Ga0466965_0116642_100_699 195
183 3300044719 Ga0466971_0036983 Ga0466971_0036983_1472_2071 195
184 3300045836 Ga0466958_0230614 Ga0466958_0230614_562_1161 195
185 3300045976 Ga0466967_0436087 Ga0466967_0436087_616_1239 195
186 3300046455 Ga0495603_0010775 Ga0495603_0010775_3463_4140 195
187 3300046462 Ga0495651_0132605 Ga0495651_0132605_968_1630 195
188 3300046499 Ga0495594_0105946 Ga0495594_0105946_112_789 195
189 3300046557 Ga0495622_0009764 Ga0495622_0009764_1626_2303 195
190 3300046674 Ga0495588_0009293 Ga0495588_0009293_1369_2046 195
191 3300047315 Ga0495581_0029313 Ga0495581_0029313_65_742 195
192 3300049570 Ga0501033_0006118 Ga0501033_0006118_5138_5737 195
193 3300050509 nmdc:mga0qj67_449762_c1 nmdc:mga0qj67_449762_c1_122_748 195
194 3300050510 nmdc:mga06r32_796971_c1 nmdc:mga06r32_796971_c1_221_847 195
195 3300050512 nmdc:mga0n895_557876_c1 nmdc:mga0n895_557876_c1_90_716 195
196 3300050515 nmdc:mga0a205_273819_c1 nmdc:mga0a205_273819_c1_392_1018 195
197 3300061719 Ga0466962_0086346 Ga0466962_0086346_851_1450 195
198 3300005445 Ga0070708_100856055 Ga0070708_1008560551 196
199 3300026095 Ga0207676_10165311 Ga0207676_101653112 196
200 3300033180 Ga0307510_10115169 Ga0307510_101151692 196
201 3300044656 Ga0466969_0003119 Ga0466969_0003119_7775_8431 196
202 3300044684 Ga0466966_0020489 Ga0466966_0020489_3423_4079 196
203 3300044719 Ga0466971_0006581 Ga0466971_0006581_3009_3665 196
204 3300047470 Ga0495681_0051792 Ga0495681_0051792_1116_1811 196
205 3300061719 Ga0466962_0004736 Ga0466962_0004736_2225_2881 196
206 3300005345 Ga0070692_10038640 Ga0070692_100386403 197
207 3300005367 Ga0070667_101187366 Ga0070667_1011873661 197
208 3300005435 Ga0070714_100011879 Ga0070714_1000118796 197
209 3300005435 Ga0070714_100394600 Ga0070714_1003946001 197
210 3300005436 Ga0070713_100259250 Ga0070713_1002592501 197
211 3300005437 Ga0070710_10014839 Ga0070710_100148392 197
212 3300005444 Ga0070694_100007524 Ga0070694_1000075246 197
213 3300005445 Ga0070708_100017977 Ga0070708_1000179773 197
214 3300005467 Ga0070706_100000265 Ga0070706_10000026546 197
215 3300005468 Ga0070707_100000577 Ga0070707_1000005778 197
216 3300005468 Ga0070707_100356565 Ga0070707_1003565652 197
217 3300005468 Ga0070707_101260143 Ga0070707_1012601431 197
218 3300005471 Ga0070698_100008306 Ga0070698_10000830616 197
219 3300005471 Ga0070698_100017794 Ga0070698_1000177943 197
220 3300005518 Ga0070699_100097961 Ga0070699_1000979613 197
221 3300005518 Ga0070699_101242989 Ga0070699_1012429891 197
222 3300005535 Ga0070684_101130256 Ga0070684_1011302561 197
223 3300005539 Ga0068853_100114284 Ga0068853_1001142842 197
224 3300005546 Ga0070696_100309869 Ga0070696_1003098692 197
225 3300005549 Ga0070704_100019648 Ga0070704_1000196483 197
226 3300005719 Ga0068861_100976133 Ga0068861_1009761332 197
227 3300005843 Ga0068860_100029367 Ga0068860_1000293676 197
228 3300005843 Ga0068860_101504751 Ga0068860_1015047511 197
229 3300005844 Ga0068862_100184943 Ga0068862_1001849433 197
230 3300005937 Ga0081455_10180358 Ga0081455_101803582 197
231 3300006028 Ga0070717_10130915 Ga0070717_101309152 197
232 3300006028 Ga0070717_10252179 Ga0070717_102521792 197
233 3300006173 Ga0070716_100464575 Ga0070716_1004645751 197
234 3300006175 Ga0070712_100167211 Ga0070712_1001672113 197
235 3300006846 Ga0075430_100327630 Ga0075430_1003276302 197
236 3300009101 Ga0105247_10537604 Ga0105247_105376042 197
237 3300009147 Ga0114129_10015968 Ga0114129_100159688 197
238 3300009553 Ga0105249_10065229 Ga0105249_100652294 197
239 3300009553 Ga0105249_11490681 Ga0105249_114906812 197
240 3300011119 Ga0105246_10205544 Ga0105246_102055442 197
241 3300014968 Ga0157379_10037159 Ga0157379_100371595 197
242 3300017792 Ga0163161_10553539 Ga0163161_105535391 197
243 3300021388 Ga0213875_10049617 Ga0213875_100496173 197
244 3300025898 Ga0207692_10084299 Ga0207692_100842992 197
245 3300025905 Ga0207685_10037137 Ga0207685_100371372 197
246 3300025906 Ga0207699_10148696 Ga0207699_101486962 197
247 3300025910 Ga0207684_10000221 Ga0207684_1000022132 197
248 3300025916 Ga0207663_10068806 Ga0207663_100688063 197
249 3300025922 Ga0207646_10003675 Ga0207646_100036758 197
250 3300025922 Ga0207646_10064540 Ga0207646_100645403 197
251 3300025928 Ga0207700_10012818 Ga0207700_100128185 197
252 3300025928 Ga0207700_10569755 Ga0207700_105697551 197
253 3300025929 Ga0207664_10047139 Ga0207664_100471394 197
254 3300025929 Ga0207664_10050781 Ga0207664_100507813 197
255 3300025929 Ga0207664_10428874 Ga0207664_104288742 197
256 3300025939 Ga0207665_10003224 Ga0207665_100032241 197
257 3300025961 Ga0207712_10040441 Ga0207712_100404414 197
258 3300025986 Ga0207658_11024441 Ga0207658_110244411 197
259 3300026041 Ga0207639_10095767 Ga0207639_100957672 197
260 3300026075 Ga0207708_10119994 Ga0207708_101199942 197
261 3300026118 Ga0207675_100498013 Ga0207675_1004980132 197
262 3300028380 Ga0268265_10260231 Ga0268265_102602312 197
263 3300028381 Ga0268264_10248773 Ga0268264_102487731 197
264 3300031507 Ga0307509_10074584 Ga0307509_100745842 197
265 3300031730 Ga0307516_10008198 Ga0307516_100081989 197
266 3300031995 Ga0307409_100317646 Ga0307409_1003176461 197
267 3300032126 Ga0307415_100114129 Ga0307415_1001141292 197
268 3300033179 Ga0307507_10134011 Ga0307507_101340112 197
269 3300033180 Ga0307510_10079976 Ga0307510_100799764 197
270 3300035086 Ga0373934_0023282 Ga0373934_0023282_547_1152 197
271 3300035111 Ga0373923_0085474 Ga0373923_0085474_292_897 197
272 3300035117 Ga0373953_0128058 Ga0373953_0128058_155_760 197
273 3300035119 Ga0373956_0005186 Ga0373956_0005186_2495_3100 197
274 3300035120 Ga0373957_0006185 Ga0373957_0006185_815_1420 197
275 3300035172 Ga0373955_0190407 Ga0373955_0190407_235_840 197
276 3300035410 Ga0373924_0127045 Ga0373924_0127045_13_618 197
277 3300035692 Ga0373935_0318937 Ga0373935_0318937_173_778 197
278 3300035724 Ga0373933_0395173 Ga0373933_0395173_254_859 197
279 3300036401 Ga0373937_0223043 Ga0373937_0223043_958_1563 197
280 3300037068 Ga0373925_0100323 Ga0373925_0100323_686_1291 197
281 3300037312 Ga0395899_0005196 Ga0395899_0005196_3077_3691 197
282 3300037312 Ga0395899_0143987 Ga0395899_0143987_913_1557 197
283 3300037418 Ga0395900_0020662 Ga0395900_0020662_3963_4607 197
284 3300037418 Ga0395900_0089422 Ga0395900_0089422_610_1224 197
285 3300037466 Ga0395898_0010050 Ga0395898_0010050_7659_8273 197
286 3300037466 Ga0395898_0222316 Ga0395898_0222316_927_1571 197
287 3300037466 Ga0395898_0466104 Ga0395898_0466104_284_928 197
288 3300037471 Ga0395905_0008137 Ga0395905_0008137_5734_6348 197
289 3300037471 Ga0395905_0041937 Ga0395905_0041937_321_965 197
290 3300037853 Ga0436364_1156310 Ga0436364_1156310_3737_4381 197
291 3300038443 Ga0395901_0005748 Ga0395901_0005748_6063_6677 197
292 3300038443 Ga0395901_0010059 Ga0395901_0010059_2349_2993 197
293 3300038443 Ga0395901_0011408 Ga0395901_0011408_8291_8935 197
294 3300041410 Ga0439461_0045491 Ga0439461_0045491_187_828 197
295 3300041410 Ga0439461_0103750 Ga0439461_0103750_25_672 197
296 3300041496 Ga0451839_0465200 Ga0451839_0465200_18_668 197
297 3300042005 Ga0439448_0038169 Ga0439448_0038169_582_1214 197
298 3300042461 Ga0439460_0174456 Ga0439460_0174456_52_684 197
299 3300044656 Ga0466969_0130705 Ga0466969_0130705_438_1085 197
300 3300044765 Ga0466970_0147728 Ga0466970_0147728_72_728 197
301 3300045049 Ga0466959_0005066 Ga0466959_0005066_8242_8898 197
302 3300045051 Ga0451576_0145314 Ga0451576_0145314_1104_1733 197
303 3300045836 Ga0466958_0049855 Ga0466958_0049855_481_1137 197
304 3300045836 Ga0466958_0167136 Ga0466958_0167136_254_949 197
305 3300046454 Ga0495592_0045039 Ga0495592_0045039_292_897 197
306 3300046462 Ga0495651_0002267 Ga0495651_0002267_10826_11434 197
307 3300046462 Ga0495651_0065472 Ga0495651_0065472_80_685 197
308 3300046463 Ga0495653_0137041 Ga0495653_0137041_35_640 197
309 3300046477 Ga0495664_0013709 Ga0495664_0013709_834_1442 197
310 3300046511 Ga0495608_0264781 Ga0495608_0264781_233_838 197
311 3300046514 Ga0495618_0053680 Ga0495618_0053680_1594_2202 197
312 3300046516 Ga0495628_0236004 Ga0495628_0236004_357_965 197
313 3300046516 Ga0495628_0503402 Ga0495628_0503402_243_848 197
314 3300046517 Ga0495630_0192038 Ga0495630_0192038_808_1413 197
315 3300046523 Ga0495644_0129603 Ga0495644_0129603_278_910 197
316 3300046526 Ga0495666_0236064 Ga0495666_0236064_121_729 197
317 3300046529 Ga0495652_0015131 Ga0495652_0015131_542_1147 197
318 3300046533 Ga0495640_0165074 Ga0495640_0165074_611_1219 197
319 3300046536 Ga0495587_0007492 Ga0495587_0007492_4462_5070 197
320 3300046536 Ga0495587_0093952 Ga0495587_0093952_784_1389 197
321 3300046543 Ga0495645_0070064 Ga0495645_0070064_1088_1696 197
322 3300046559 Ga0495667_0207662 Ga0495667_0207662_409_1017 197
323 3300046642 Ga0495634_0007955 Ga0495634_0007955_4574_5182 197
324 3300046642 Ga0495634_0038015 Ga0495634_0038015_704_1309 197
325 3300046663 Ga0495635_0005450 Ga0495635_0005450_1412_2020 197
326 3300046665 Ga0495661_0112303 Ga0495661_0112303_809_1441 197
327 3300046675 Ga0495657_0058335 Ga0495657_0058335_859_1467 197
328 3300046675 Ga0495657_0158164 Ga0495657_0158164_431_1036 197
329 3300046678 Ga0495599_0160331 Ga0495599_0160331_364_969 197
330 3300046689 Ga0495613_0007892 Ga0495613_0007892_6949_7557 197
331 3300046689 Ga0495613_0249231 Ga0495613_0249231_584_1189 197
332 3300046809 Ga0495600_0019042 Ga0495600_0019042_1695_2303 197
333 3300046809 Ga0495600_0020092 Ga0495600_0020092_570_1175 197
334 3300047315 Ga0495581_0137866 Ga0495581_0137866_746_1354 197
335 3300047317 Ga0495604_0070478 Ga0495604_0070478_1984_2589 197
336 3300047317 Ga0495604_0079248 Ga0495604_0079248_1046_1654 197
337 3300047318 Ga0495636_0274201 Ga0495636_0274201_131_748 197
338 3300047319 Ga0495674_0299601 Ga0495674_0299601_134_739 197
339 3300047321 Ga0495676_0033257 Ga0495676_0033257_2903_3511 197
340 3300047322 Ga0495680_0094680 Ga0495680_0094680_33_638 197
341 3300047443 Ga0495687_001750 Ga0495687_001750_16069_16686 197
342 3300047444 Ga0495675_0061239 Ga0495675_0061239_711_1319 197
343 3300047444 Ga0495675_0076492 Ga0495675_0076492_317_922 197
344 3300047471 Ga0495684_0030260 Ga0495684_0030260_1947_2552 197
345 3300048088 Ga0495602_0071062 Ga0495602_0071062_443_1048 197
346 3300048909 Ga0496106_0139995 Ga0496106_0139995_575_1204 197
347 3300049581 Ga0501047_0030084 Ga0501047_0030084_3655_4287 197
348 3300049581 Ga0501047_0361100 Ga0501047_0361100_37_672 197
349 3300049583 Ga0501067_0056858 Ga0501067_0056858_961_1659 197
350 3300050508 nmdc:mga09592_302208_c1 nmdc:mga09592_302208_c1_380_1015 197
351 3300053078 Ga0495612_0000131 Ga0495612_0000131_30619_31248 197
352 3300053088 Ga0500644_0006108 Ga0500644_0006108_1638_2249 197
353 3300053101 Ga0500553_120362 Ga0500553_120362_107_715 197
354 3300053140 Ga0500573_0108248 Ga0500573_0108248_605_1213 197
355 3300053157 Ga0500624_007858 Ga0500624_007858_802_1410 197
356 3300061719 Ga0466962_0029787 Ga0466962_0029787_1804_2502 197
357 3300001989 JGI24739J22299_10010660 JGI24739J22299_100106603 198
358 3300003316 rootH1_10007091 rootH1_100070915 198
359 3300003320 rootH2_10036518 rootH2_1003651818 198
360 3300003323 rootH1_10032446 rootH1_100324465 198
361 3300003578 Ga0006562J51391_1040961 Ga0006562J51391_10409612 198
362 3300005543 Ga0070672_100580430 Ga0070672_1005804302 198
363 3300009148 Ga0105243_10340301 Ga0105243_103403012 198
364 3300011119 Ga0105246_10035104 Ga0105246_100351042 198
365 3300011119 Ga0105246_10417413 Ga0105246_104174131 198
366 3300025940 Ga0207691_10304697 Ga0207691_103046972 198
367 3300030522 Ga0307512_10029391 Ga0307512_100293913 198
368 3300031456 Ga0307513_10283533 Ga0307513_102835332 198
369 3300031649 Ga0307514_10002565 Ga0307514_1000256513 198
370 3300031649 Ga0307514_10075587 Ga0307514_100755873 198
371 3300031730 Ga0307516_10160305 Ga0307516_101603052 198
372 3300031838 Ga0307518_10072157 Ga0307518_100721572 198
373 3300033180 Ga0307510_10039047 Ga0307510_100390476 198
374 3300037418 Ga0395900_0288366 Ga0395900_0288366_73_783 198
375 3300037466 Ga0395898_0778938 Ga0395898_0778938_161_766 198
376 3300041456 Ga0451795_1160994 Ga0451795_1160994_286_939 198
377 3300042131 Ga0450894_000332 Ga0450894_000332_7595_8266 198
378 3300042134 Ga0450898_000357 Ga0450898_000357_3129_3800 198
379 3300042135 Ga0450899_005332 Ga0450899_005332_99_770 198
380 3300042145 Ga0450906_002045 Ga0450906_002045_92_763 198
381 3300044658 Ga0466972_0013620 Ga0466972_0013620_627_1244 198
382 3300044684 Ga0466966_0006168 Ga0466966_0006168_4505_5122 198
383 3300044765 Ga0466970_0046109 Ga0466970_0046109_245_862 198
384 3300045049 Ga0466959_0040854 Ga0466959_0040854_2661_3278 198
385 3300046453 Ga0495627_063881 Ga0495627_063881_98_718 198
386 3300046455 Ga0495603_0210934 Ga0495603_0210934_86_697 198
387 3300046459 Ga0495629_0034304 Ga0495629_0034304_1592_2254 198
388 3300046476 Ga0495662_0002979 Ga0495662_0002979_1633_2382 198
389 3300046492 Ga0495585_0029980 Ga0495585_0029980_1075_1695 198
390 3300046492 Ga0495585_0168683 Ga0495585_0168683_58_720 198
391 3300046499 Ga0495594_0049915 Ga0495594_0049915_786_1397 198
392 3300046501 Ga0495607_0232416 Ga0495607_0232416_100_720 198
393 3300046514 Ga0495618_0229112 Ga0495618_0229112_13_675 198
394 3300046516 Ga0495628_0091562 Ga0495628_0091562_1232_1894 198
395 3300046518 Ga0495631_0074382 Ga0495631_0074382_199_810 198
396 3300046529 Ga0495652_0262396 Ga0495652_0262396_312_974 198
397 3300046533 Ga0495640_0052137 Ga0495640_0052137_1177_1839 198
398 3300046538 Ga0495609_0042110 Ga0495609_0042110_1281_1901 198
399 3300046543 Ga0495645_0112380 Ga0495645_0112380_1173_1904 198
400 3300046616 Ga0495668_0302524 Ga0495668_0302524_122_733 198
401 3300046642 Ga0495634_0089513 Ga0495634_0089513_377_1039 198
402 3300046660 Ga0495625_0102264 Ga0495625_0102264_1249_1869 198
403 3300046674 Ga0495588_0194296 Ga0495588_0194296_150_971 198
404 3300046675 Ga0495657_0097541 Ga0495657_0097541_1176_1838 198
405 3300046675 Ga0495657_0098255 Ga0495657_0098255_133_882 198
406 3300046689 Ga0495613_0487244 Ga0495613_0487244_88_750 198
407 3300046690 Ga0495624_0077683 Ga0495624_0077683_1352_2014 198
408 3300046691 Ga0495670_0142511 Ga0495670_0142511_226_837 198
409 3300046794 Ga0495589_0002517 Ga0495589_0002517_5132_5752 198
410 3300046794 Ga0495589_0011892 Ga0495589_0011892_527_1150 198
411 3300046794 Ga0495589_0076099 Ga0495589_0076099_337_948 198
412 3300046809 Ga0495600_0067374 Ga0495600_0067374_1367_2029 198
413 3300047315 Ga0495581_0024487 Ga0495581_0024487_2616_3278 198
414 3300047315 Ga0495581_0116051 Ga0495581_0116051_795_1406 198
415 3300047317 Ga0495604_0064739 Ga0495604_0064739_1295_1957 198
416 3300047321 Ga0495676_0106692 Ga0495676_0106692_715_1377 198
417 3300047323 Ga0495683_0037259 Ga0495683_0037259_1578_2198 198
418 3300047444 Ga0495675_0017176 Ga0495675_0017176_3631_4362 198
419 3300047444 Ga0495675_0061597 Ga0495675_0061597_893_1555 198
420 3300047445 Ga0495677_0095670 Ga0495677_0095670_451_1062 198
421 3300047447 Ga0495685_103941 Ga0495685_103941_120_782 198
422 3300048089 Ga0495614_0078032 Ga0495614_0078032_455_1066 198
423 3300049568 Ga0501031_0088930 Ga0501031_0088930_329_982 198
424 3300049568 Ga0501031_0134699 Ga0501031_0134699_398_1048 198
425 3300049569 Ga0501032_0116786 Ga0501032_0116786_922_1638 198
426 3300049569 Ga0501032_0124227 Ga0501032_0124227_919_1572 198
427 3300049571 Ga0501034_0266424 Ga0501034_0266424_189_842 198
428 3300049572 Ga0501036_0058576 Ga0501036_0058576_1216_1869 198
429 3300049573 Ga0501037_0094578 Ga0501037_0094578_714_1430 198
430 3300049574 Ga0501038_0048299 Ga0501038_0048299_2185_2838 198
431 3300049575 Ga0501039_0064873 Ga0501039_0064873_1574_2227 198
432 3300049579 Ga0501043_0033152 Ga0501043_0033152_1256_1909 198
433 3300049579 Ga0501043_0038001 Ga0501043_0038001_1855_2571 198
434 3300049580 Ga0501046_0221553 Ga0501046_0221553_545_1198 198
435 3300049581 Ga0501047_0051908 Ga0501047_0051908_2769_3485 198
436 3300049581 Ga0501047_0458592 Ga0501047_0458592_320_973 198
437 3300049822 Ga0501035_0057198 Ga0501035_0057198_2110_2826 198
438 3300049822 Ga0501035_0117662 Ga0501035_0117662_1197_1850 198
439 3300049823 Ga0501044_0013366 Ga0501044_0013366_2357_3010 198
440 3300061719 Ga0466962_0100587 Ga0466962_0100587_336_953 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

44

91

0.97

PF12802

MarR_2

MarR family

43

97

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f72-assembly2.cif.gz_D crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.9725 11 63
2zkz-assembly3.cif.gz_D-2 crystal structure of the transcriptional repressor pagr of bacillus anthracis 0.9175 11 56
1u2w-assembly1.cif.gz_A crystal structure of the staphylococcus aureus pi258 cadc 0.913 11 80
3f72-assembly2.cif.gz_C crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.9104 11 80
7rhe-assembly1.cif.gz_A-2 crystal structure of rok family protein from burkholderia vietnamiensis g4 0.906 20 80
ID Description Score Start End Superfamily
3f72D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9725 11 63 1.10.10.10
1ulyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9531 1 88 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9411 17 81 1.10.10.10
af_P33020_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9406 17 63 1.10.10.10
1ulyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9317 1 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6B1KAE5-F1-model_v4 deleted 0.9824 1 92
AF-A0A2M9WUP4-F1-model_v4 deleted 0.9737 11 80
AF-A0A075GWE0-F1-model_v4 Putative transcriptional regulator 0.9697 11 80
AF-A0A7J4I656-F1-model_v4 S-layer protein 0.9653 17 88 GO:0003700
AF-A0A7X7SMM1-F1-model_v4 PBP domain-containing protein 0.9615 11 84

Feature Viewer

pLDDT pTM Quality
75.92 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map