F444325

General Info

Members Datasets Scaffolds Average Seq Length
439 285 369 311

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857349434|2857351995
Length 365
Sequence RSFFLIEIESKELNRLGSVRALHAPRRSRMTKDHPHSLSRREVMAAAGVGIAAGVAGPANAQQASTKPLENGPAMQDPRTKYPKPPFEAQTQPWPGLARDMKPKPDHGETSYKGSGRLAGRKALITGGDSGMGRAAAIAYAREGADVAINYYPSEEPDASEVIQLIRDAGRTGVALPGDLRDEGFCQRLVADAVQQLGGLDIVVCNAGRQQAKPSILDVTSEDFDATMKTNIYAPFWIIKAALPHLKPGSCIIGTTSEQAYDPSPELYDYAQTKAATMNYVKSLAKQLGSKGIRVNGVAPGPVWTPLQISGGASEEKYKKFGSTTALERPGQPVELASIYVQLAADDASFATGNIYGSGGGQGQP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
5 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
6 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
9 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
10 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
11 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
12 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
13 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
14 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
15 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
16 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
17 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
18 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
19 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
20 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
21 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
22 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
23 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
24 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
25 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
26 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
27 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
28 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
29 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
30 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
31 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
32 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
33 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
34 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
35 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
36 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
37 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
38 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
39 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
40 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
41 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
42 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
43 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
44 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
45 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
46 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
47 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
48 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
49 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
50 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
51 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
52 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
53 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
54 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
55 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
56 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
57 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
58 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
59 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
60 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
61 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
62 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
63 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
64 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
65 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
66 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
67 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
68 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
69 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
70 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
73 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
108 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
109 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
164 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
165 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
166 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
266 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
273 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
274 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
275 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
276 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
277 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
282 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
283 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
284 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
285 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.14
Metatranscriptomes 0.91
Isolates 15.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 10.25
Nodule 14.12
Rhizoplane 1.82
Rhizosphere 59
Stem 0
Stem Tuber 0
Unclassified 14.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10017325 3300001989 Bacteria 2599
2 JGI24737J22298_10004758 3300001990 Bacteria 4714
3 JGI24735J21928_10007011 3300002067 Bacteria 3684
4 JGI24735J21928_10010124 3300002067 Bacteria 3014
5 JGI25156J39149_1001264 3300002705 Bacteria 10995
6 JGI25157J39369_1001806 3300002741 Bacteria 6825
7 JGI25153J46596_10000688 3300003215 Bacteria 20645
8 JGI25153J46596_10001038 3300003215 Bacteria 16939
9 JGI25153J46596_10011668 3300003215 Bacteria 3862
10 rootH1_10017040 3300003316 Bacteria 9107
11 rootH1_10013427 3300003323 Bacteria 73378
12 JGI25160J50197_1000577 3300003354 Bacteria 20605
13 Ga0065165_1043154 3300005262 Bacteria 1326
14 Ga0070658_10000885 3300005327 Bacteria 25632
15 Ga0070658_10018342 3300005327 Bacteria 5602
16 Ga0070658_10071638 3300005327 Bacteria 2839
17 Ga0070658_10082852 3300005327 Bacteria 2636
18 Ga0070658_10108989 3300005327 Bacteria 2292
19 Ga0070660_100002335 3300005339 Bacteria 13030
20 Ga0070660_100038716 3300005339 Bacteria 3620
21 Ga0070660_100228819 3300005339 Bacteria 1512
22 Ga0070675_100008469 3300005354 Bacteria 7982
23 Ga0070671_100054936 3300005355 Bacteria 3312
24 Ga0070659_100251545 3300005366 Bacteria 1465
25 Ga0070714_100013784 3300005435 Bacteria 6481
26 Ga0070713_100428668 3300005436 Bacteria 1239
27 Ga0070710_10031709 3300005437 Bacteria 2856
28 Ga0070710_10068128 3300005437 Bacteria 2044
29 Ga0070663_100005799 3300005455 Bacteria 7377
30 Ga0070678_100072882 3300005456 Bacteria 2576
31 Ga0070681_10168625 3300005458 Bacteria 2112
32 Ga0070679_100222087 3300005530 Bacteria 1850
33 Ga0070684_100002234 3300005535 Bacteria 14268
34 Ga0070684_100041610 3300005535 Bacteria 3962
35 Ga0070684_100294970 3300005535 Bacteria 1487
36 Ga0068853_100018488 3300005539 Bacteria 5770
37 Ga0068853_100022151 3300005539 Bacteria 5303
38 Ga0068853_100337611 3300005539 Bacteria 1399
39 Ga0070672_100400320 3300005543 Bacteria 1177
40 Ga0070693_100109931 3300005547 Bacteria 1694
41 Ga0070665_100173431 3300005548 Bacteria 2158
42 Ga0070665_100543975 3300005548 Bacteria 1173
43 Ga0068855_100003591 3300005563 Bacteria 18946
44 Ga0068855_100003864 3300005563 Bacteria 18311
45 Ga0068855_100015815 3300005563 Bacteria 9078
46 Ga0068855_100053579 3300005563 Bacteria 4745
47 Ga0068855_100076106 3300005563 Bacteria 3896
48 Ga0068855_100195694 3300005563 Bacteria 2278
49 Ga0068854_100001682 3300005578 Bacteria 13471
50 Ga0068856_100014522 3300005614 Bacteria 7608
51 Ga0070702_100159606 3300005615 Bacteria 1456
52 Ga0068852_100004875 3300005616 Bacteria 9529
53 Ga0081540_1003947 3300005983 Bacteria 11524
54 Ga0070717_10408411 3300006028 Bacteria 1221
55 Ga0075365_10040511 3300006038 Bacteria 3038
56 Ga0075365_10112195 3300006038 Bacteria 1875
57 Ga0075364_10044887 3300006051 Bacteria 2876
58 Ga0075369_10019490 3300006186 Bacteria 2770
59 Ga0097621_100001481 3300006237 Bacteria 16099
60 Ga0075370_10009977 3300006353 Bacteria 4949
61 Ga0068871_100044068 3300006358 Bacteria 3586
62 Ga0075436_100032727 3300006914 Bacteria 3584
63 Ga0099825_1038840 3300006941 Bacteria 1497
64 Ga0099824_1014241 3300006942 Bacteria 7969
65 Ga0099822_1039146 3300006943 Bacteria 2740
66 Ga0105240_10000001 3300009093 Bacteria 2887840
67 Ga0105240_10014371 3300009093 Bacteria 10810
68 Ga0105240_10067074 3300009093 Bacteria 4449
69 Ga0105240_10090361 3300009093 Bacteria 3743
70 Ga0105240_10149423 3300009093 Bacteria 2784
71 Ga0105240_10343174 3300009093 Bacteria 1696
72 Ga0105241_10009101 3300009174 Bacteria 7308
73 Ga0105241_10233331 3300009174 Bacteria 1552
74 Ga0105241_10290269 3300009174 Bacteria 1400
75 Ga0105237_10001500 3300009545 Bacteria 30709
76 Ga0105237_10112725 3300009545 Bacteria 2712
77 Ga0105237_10383595 3300009545 Bacteria 1410
78 Ga0105238_10011778 3300009551 Bacteria 8815
79 Ga0105238_10124473 3300009551 Bacteria 2557
80 Ga0105238_10140973 3300009551 Bacteria 2387
81 Ga0099796_10003679 3300010159 Bacteria 3596
82 Ga0099796_10047725 3300010159 Bacteria 1474
83 Ga0105239_10013858 3300010375 Bacteria 8948
84 Ga0105239_10024283 3300010375 Bacteria 6677
85 Ga0105239_10026741 3300010375 Bacteria 6351
86 Ga0157373_10033063 3300013100 Bacteria 3723
87 Ga0157370_10000201 3300013104 Bacteria 75437
88 Ga0157369_10006952 3300013105 Bacteria 13053
89 Ga0157369_10102266 3300013105 Bacteria 3054
90 Ga0157374_10011612 3300013296 Bacteria 7635
91 Ga0163162_10093605 3300013306 Bacteria 3090
92 Ga0157372_10005690 3300013307 Bacteria 13263
93 Ga0157372_10115438 3300013307 Bacteria 3078
94 Ga0163163_10027389 3300014325 Bacteria 5459
95 Ga0157379_10107790 3300014968 Bacteria 2501
96 Ga0163161_10003855 3300017792 Bacteria 10514
97 Ga0213872_10037429 3300021361 Bacteria 2215
98 Ga0213872_10069777 3300021361 Bacteria 1585
99 Ga0213876_10000424 3300021384 Bacteria 35167
100 Ga0213876_10018689 3300021384 Bacteria 3661
101 Ga0213876_10036452 3300021384 Bacteria 2593
102 Ga0213876_10045117 3300021384 Bacteria 2331
103 Ga0213876_10056337 3300021384 Bacteria 2075
104 Ga0213875_10000030 3300021388 Bacteria 178500
105 Ga0213875_10000077 3300021388 Bacteria 116884
106 Ga0213875_10008537 3300021388 Bacteria 5240
107 Ga0207427_102266 3300025231 Bacteria 5376
108 Ga0209026_1000211 3300025250 Bacteria 81007
109 Ga0209677_101186 3300025253 Bacteria 11953
110 Ga0209148_1001974 3300025254 Bacteria 8193
111 Ga0209148_1007962 3300025254 Bacteria 2160
112 Ga0209759_1000208 3300025256 Bacteria 91006
113 Ga0209759_1001336 3300025256 Bacteria 14450
114 Ga0209233_1000003 3300025261 Bacteria 1607366
115 Ga0209455_1002547 3300025272 Bacteria 6970
116 Ga0209455_1003043 3300025272 Bacteria 6133
117 Ga0209758_1000011 3300025297 Bacteria 1049685
118 Ga0209758_1000085 3300025297 Bacteria 256191
119 Ga0209758_1001157 3300025297 Bacteria 33783
120 Ga0209758_1002031 3300025297 Bacteria 21734
121 Ga0207426_1000212 3300025302 Bacteria 137314
122 Ga0207426_1009704 3300025302 Bacteria 3785
123 Ga0209257_1001093 3300025304 Bacteria 35344
124 Ga0207647_10008861 3300025904 Bacteria 7178
125 Ga0207705_10000084 3300025909 Bacteria 116809
126 Ga0207705_10001236 3300025909 Bacteria 20582
127 Ga0207705_10050862 3300025909 Bacteria 2983
128 Ga0207705_10093853 3300025909 Bacteria 2200
129 Ga0207705_10135286 3300025909 Bacteria 1837
130 Ga0207705_10409885 3300025909 Bacteria 1048
131 Ga0207654_10008067 3300025911 Bacteria 5306
132 Ga0207695_10000001 3300025913 Bacteria 2888630
133 Ga0207695_10000610 3300025913 Bacteria 71851
134 Ga0207695_10008371 3300025913 Bacteria 12955
135 Ga0207695_10034095 3300025913 Bacteria 5542
136 Ga0207695_10218769 3300025913 Bacteria 1813
137 Ga0207695_10261923 3300025913 Bacteria 1626
138 Ga0207695_10371649 3300025913 Bacteria 1316
139 Ga0207671_10003938 3300025914 Bacteria 14470
140 Ga0207671_10267727 3300025914 Bacteria 1346
141 Ga0207660_10382043 3300025917 Bacteria 1132
142 Ga0207657_10002865 3300025919 Bacteria 18549
143 Ga0207657_10093852 3300025919 Bacteria 2499
144 Ga0207657_10098964 3300025919 Bacteria 2423
145 Ga0207657_10182266 3300025919 Bacteria 1697
146 Ga0207649_10249083 3300025920 Bacteria 1279
147 Ga0207652_10224579 3300025921 Bacteria 1692
148 Ga0207694_10023321 3300025924 Bacteria 4697
149 Ga0207694_10199181 3300025924 Bacteria 1629
150 Ga0207659_10006695 3300025926 Bacteria 7079
151 Ga0207700_10433774 3300025928 Bacteria 1156
152 Ga0207644_10048210 3300025931 Bacteria 3044
153 Ga0207690_10214987 3300025932 Bacteria 1468
154 Ga0207706_10101177 3300025933 Bacteria 2535
155 Ga0207686_10005439 3300025934 Bacteria 6838
156 Ga0207691_10246634 3300025940 Bacteria 1543
157 Ga0207661_10007108 3300025944 Bacteria 7954
158 Ga0207661_10039701 3300025944 Bacteria 3696
159 Ga0207667_10000024 3300025949 Bacteria 355874
160 Ga0207667_10027658 3300025949 Bacteria 6169
161 Ga0207667_10038249 3300025949 Bacteria 5125
162 Ga0207667_10181610 3300025949 Bacteria 2160
163 Ga0207640_10000229 3300025981 Bacteria 39028
164 Ga0207639_10155362 3300026041 Bacteria 1921
165 Ga0207678_10055681 3300026067 Bacteria 3406
166 Ga0207702_10011130 3300026078 Bacteria 7507
167 Ga0207683_10110339 3300026121 Bacteria 2463
168 Ga0207698_10077440 3300026142 Bacteria 2666
169 Ga0209389_1000009 3300027296 Bacteria 226873
170 Ga0209589_1000001 3300027357 Bacteria 794224
171 Ga0209489_100001 3300027361 Bacteria 794224
172 Ga0209489_100671 3300027361 Bacteria 66550
173 Ga0209700_100001 3300027363 Bacteria 794224
174 Ga0209700_100016 3300027363 Bacteria 252567
175 Ga0209179_1002284 3300027512 Bacteria 2561
176 Ga0209179_1018341 3300027512 Bacteria 1335
177 Ga0268266_10026055 3300028379 Bacteria 4974
178 Ga0268266_10218601 3300028379 Bacteria 1750
179 Ga0307511_10057839 3300030521 Bacteria 3007
180 Ga0265340_10078183 3300031247 Bacteria 1560
181 Ga0265339_10010169 3300031249 Bacteria 5858
182 Ga0265316_10201968 3300031344 Bacteria 1473
183 Ga0265314_10013131 3300031711 Bacteria 6709
184 Ga0307416_100302310 3300032002 Bacteria 1591
185 Ga0307414_10000009 3300032004 Bacteria 359782
186 Ga0373937_0029535 3300036401 Bacteria 4965
187 Ga0373937_0190428 3300036401 Bacteria 1927
188 Ga0395899_0004150 3300037312 Bacteria 11374
189 Ga0395900_0103831 3300037418 Bacteria 2919
190 Ga0395900_0208386 3300037418 Bacteria 1975
191 Ga0395900_0284369 3300037418 Bacteria 1645
192 Ga0395905_0046103 3300037471 Bacteria 4088
193 Ga0395905_0054094 3300037471 Bacteria 3757
194 Ga0395905_0179603 3300037471 Bacteria 1987
195 Ga0436364_0024756 3300037853 Bacteria 185423
196 Ga0436364_0044497 3300037853 Bacteria 3040
197 Ga0436364_0123579 3300037853 Bacteria 1031
198 Ga0436364_0539821 3300037853 Bacteria 7596
199 Ga0436364_1012562 3300037853 Bacteria 11525
200 Ga0436364_1075474 3300037853 Bacteria 3401
201 Ga0436364_1391193 3300037853 Bacteria 22877
202 Ga0395901_0014386 3300038443 Bacteria 8054
203 Ga0395901_0183502 3300038443 Bacteria 2195
204 Ga0436365_0358379 3300039437 Bacteria 5520
205 Ga0436365_0472524 3300039437 Bacteria 2633
206 Ga0436365_0662108 3300039437 Bacteria 12927
207 Ga0436365_0837091 3300039437 Bacteria 16775
208 Ga0436365_1338454 3300039437 Bacteria 115168
209 Ga0436365_1674268 3300039437 Bacteria 1517
210 Ga0436365_1716323 3300039437 Bacteria 15523
211 Ga0436360_0462961 3300039438 Bacteria 1112
212 Ga0436360_0814610 3300039438 Bacteria 1238
213 Ga0436360_0899278 3300039438 Bacteria 1778
214 Ga0436360_1244217 3300039438 Bacteria 4207
215 Ga0436360_1288635 3300039438 Bacteria 7023
216 Ga0436361_0138441 3300039447 Bacteria 7710
217 Ga0436361_0232817 3300039447 Bacteria 2166
218 Ga0436361_0278632 3300039447 Bacteria 2245
219 Ga0436361_0608888 3300039447 Bacteria 9957
220 Ga0436361_0710342 3300039447 Bacteria 1666
221 Ga0436361_0726305 3300039447 Bacteria 1452
222 Ga0436361_0886713 3300039447 Bacteria 3958
223 Ga0436361_0955129 3300039447 Bacteria 5107
224 Ga0436363_0022177 3300039450 Bacteria 1845
225 Ga0436363_0535526 3300039450 Bacteria 1519
226 Ga0436363_0559028 3300039450 Bacteria 4430
227 Ga0436363_0707747 3300039450 Bacteria 4429
228 Ga0436363_0999782 3300039450 Bacteria 1555
229 Ga0436363_1659540 3300039450 Bacteria 8532
230 Ga0436362_0202539 3300039453 Bacteria 3363
231 Ga0466969_0018208 3300044656 Bacteria 3662
232 Ga0466969_0043013 3300044656 Bacteria 2252
233 Ga0466972_0083989 3300044658 Bacteria 1514
234 Ga0466972_0164330 3300044658 Bacteria 1042
235 Ga0466966_0001735 3300044684 Bacteria 14102
236 Ga0466966_0013560 3300044684 Bacteria 5395
237 Ga0466966_0294198 3300044684 Bacteria 976
238 Ga0466961_0000156 3300044693 Bacteria 46106
239 Ga0466968_0035825 3300044735 Bacteria 2077
240 Ga0466970_0096010 3300044765 Bacteria 1612
241 Ga0466957_0016605 3300044842 Bacteria 4306
242 Ga0466957_0137125 3300044842 Bacteria 1573
243 Ga0466959_0000683 3300045049 Bacteria 19817
244 Ga0466959_0048524 3300045049 Bacteria 3120
245 Ga0466958_0038244 3300045836 Bacteria 2879
246 Ga0466967_0188483 3300045976 Bacteria 1948
247 Ga0466967_0239004 3300045976 Bacteria 1732
248 Ga0466967_0459593 3300045976 Bacteria 1245
249 Ga0495590_0000192 3300046457 Bacteria 34538
250 Ga0495590_0053472 3300046457 Bacteria 1410
251 Ga0495638_0000872 3300046460 Bacteria 31279
252 Ga0495605_0036421 3300046474 Bacteria 2481
253 Ga0495584_0029294 3300046491 Bacteria 2790
254 Ga0495607_0154395 3300046501 Bacteria 1172
255 Ga0495583_0119171 3300046506 Bacteria 1112
256 Ga0495606_0027095 3300046507 Bacteria 4069
257 Ga0495606_0037332 3300046507 Bacteria 3300
258 Ga0495606_0047435 3300046507 Bacteria 2831
259 Ga0495606_0147779 3300046507 Bacteria 1382
260 Ga0495610_0031702 3300046512 Bacteria 2755
261 Ga0495610_0052919 3300046512 Bacteria 1969
262 Ga0495610_0135747 3300046512 Bacteria 1064
263 Ga0495620_0020178 3300046515 Bacteria 3260
264 Ga0495620_0091275 3300046515 Bacteria 1222
265 Ga0495630_0305723 3300046517 Bacteria 1215
266 Ga0495632_0004089 3300046519 Bacteria 10060
267 Ga0495643_0004697 3300046522 Bacteria 9483
268 Ga0495643_0010090 3300046522 Bacteria 5826
269 Ga0495643_0081111 3300046522 Bacteria 1687
270 Ga0495597_0005922 3300046542 Bacteria 6382
271 Ga0495597_0034757 3300046542 Bacteria 2277
272 Ga0495645_0021819 3300046543 Bacteria 4629
273 Ga0495633_0103638 3300046558 Bacteria 1320
274 Ga0495667_0009022 3300046559 Bacteria 6776
275 Ga0495667_0093675 3300046559 Bacteria 1945
276 Ga0495668_0000223 3300046616 Bacteria 81874
277 Ga0495668_0022676 3300046616 Bacteria 3587
278 Ga0495634_0037322 3300046642 Bacteria 3321
279 Ga0495625_0024036 3300046660 Bacteria 4645
280 Ga0495635_0060173 3300046663 Bacteria 2611
281 Ga0495635_0075788 3300046663 Bacteria 2304
282 Ga0495659_0050369 3300046664 Bacteria 1514
283 Ga0495661_0065288 3300046665 Bacteria 2145
284 Ga0495661_0136137 3300046665 Bacteria 1340
285 Ga0495657_0010042 3300046675 Bacteria 7139
286 Ga0495599_0044885 3300046678 Bacteria 2771
287 Ga0495623_0013943 3300046679 Bacteria 5210
288 Ga0495624_0055243 3300046690 Bacteria 2502
289 Ga0495671_0014652 3300046692 Bacteria 4214
290 Ga0495649_0010406 3300046694 Bacteria 5489
291 Ga0495649_0011132 3300046694 Bacteria 5292
292 Ga0495649_0011683 3300046694 Bacteria 5142
293 Ga0495589_0023473 3300046794 Bacteria 3143
294 Ga0495600_0034897 3300046809 Bacteria 3266
295 Ga0495581_0090993 3300047315 Bacteria 1770
296 Ga0495604_0002416 3300047317 Bacteria 14943
297 Ga0495604_0141363 3300047317 Bacteria 1719
298 Ga0495636_0006248 3300047318 Bacteria 4681
299 Ga0495674_0011720 3300047319 Bacteria 8271
300 Ga0495676_0195761 3300047321 Bacteria 1407
301 Ga0495680_0006491 3300047322 Bacteria 10856
302 Ga0495683_0012620 3300047323 Bacteria 4437
303 Ga0495683_0095692 3300047323 Bacteria 1433
304 Ga0495687_008465 3300047443 Bacteria 5885
305 Ga0495687_075343 3300047443 Bacteria 1339
306 Ga0495675_0005741 3300047444 Bacteria 7592
307 Ga0495673_0022581 3300047469 Bacteria 3080
308 Ga0495684_0085480 3300047471 Bacteria 2392
309 Ga0495686_0001612 3300047472 Bacteria 23707
310 Ga0495686_0005257 3300047472 Bacteria 10281
311 Ga0495686_0007754 3300047472 Bacteria 7997
312 Ga0495686_0084450 3300047472 Bacteria 1935
313 Ga0495686_0101668 3300047472 Bacteria 1733
314 Ga0495602_0017108 3300048088 Bacteria 7274
315 Ga0495602_0102586 3300048088 Bacteria 2344
316 Ga0495626_0007047 3300048091 Bacteria 6311
317 Ga0496104_0046912 3300048907 Bacteria 4070
318 Ga0496104_0257247 3300048907 Bacteria 1659
319 Ga0496105_0066334 3300048908 Bacteria 2979
320 Ga0496108_0000606 3300048911 Bacteria 28078
321 Ga0496109_0021656 3300048912 Bacteria 5688
322 Ga0496110_0050228 3300048913 Bacteria 3661
323 Ga0496112_0004346 3300048915 Bacteria 11981
324 Ga0496113_0256917 3300048916 Bacteria 1395
325 Ga0496117_0065312 3300048920 Bacteria 2475
326 Ga0496118_0022917 3300048921 Bacteria 5441
327 Ga0496118_0024955 3300048921 Bacteria 5144
328 Ga0496119_0041918 3300048922 Bacteria 2908
329 Ga0496121_0000026 3300048924 Bacteria 450157
330 Ga0496121_0000213 3300048924 Bacteria 127487
331 Ga0496121_0001253 3300048924 Bacteria 43985
332 Ga0496121_0147070 3300048924 Bacteria 1739
333 Ga0496125_0029795 3300048928 Bacteria 4897
334 Ga0496125_0208818 3300048928 Bacteria 1270
335 Ga0496126_0015656 3300048929 Bacteria 7620
336 Ga0496126_0029758 3300048929 Bacteria 5184
337 Ga0495682_0010765 3300049460 Bacteria 3531
338 Ga0501033_0005604 3300049570 Bacteria 9919
339 Ga0501080_0003661 3300049742 Bacteria 13563
340 Ga0501035_0055845 3300049822 Bacteria 3525
341 Ga0501044_0034729 3300049823 Bacteria 5286
342 nmdc:mga00v17_164524_c1 3300050491 Bacteria 1429
343 nmdc:mga00v17_41453_c1 3300050491 Bacteria 2765
344 nmdc:mga0yw44_25514_c1 3300050492 Bacteria 3362
345 nmdc:mga0yw44_44462_c1 3300050492 Bacteria 2656
346 nmdc:mga07m45_18043_c1 3300050496 Bacteria 3801
347 nmdc:mga0sz30_12114_c1 3300050516 Bacteria 3347
348 nmdc:mga0sz30_23959_c1 3300050516 Bacteria 2489
349 Ga0495655_0012009 3300053083 Bacteria 1755
350 Ga0495595_0105456 3300053084 Bacteria 1363
351 Ga0500578_0030209 3300053086 Bacteria 3481
352 Ga0500643_000047 3300053087 Bacteria 148938
353 Ga0500556_0000741 3300053104 Bacteria 19644
354 Ga0500557_000085 3300053105 Bacteria 32236
355 Ga0500562_003820 3300053108 Bacteria 3793
356 Ga0500642_0000021 3300053130 Bacteria 146938
357 Ga0500577_0030310 3300053142 Bacteria 1882
358 Ga0500622_0041209 3300053156 Bacteria 2404
359 Ga0500622_0056513 3300053156 Bacteria 2009
360 Ga0500636_0048401 3300053177 Bacteria 2502
361 Ga0500636_0237230 3300053177 Bacteria 939
362 Ga0500625_006115 3300053729 Bacteria 5099
363 Ga0500601_000382 3300053737 Bacteria 7787
364 Ga0500661_007853 3300055283 Bacteria 1968
365 Ga0587085_003357 3300059506 Bacteria 1733
366 Ga0587098_001776 3300059604 Bacteria 1720
367 Ga0587122_003402 3300059628 Bacteria 1226
368 Ga0587072_006504 3300059643 Bacteria 1783
369 Ga0466962_0186736 3300061719 Bacteria 1011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0035825 Ga0466968_0035825_955_2046 273
2 3300044842 Ga0466957_0137125 Ga0466957_0137125_381_1409 277
3 3300039450 Ga0436363_0999782 Ga0436363_0999782_506_1465 285
4 3300047315 Ga0495581_0090993 Ga0495581_0090993_118_1128 285
5 3300048907 Ga0496104_0046912 Ga0496104_0046912_1935_2945 285
6 3300048911 Ga0496108_0000606 Ga0496108_0000606_24202_25212 285
7 3300048912 Ga0496109_0021656 Ga0496109_0021656_1981_2991 285
8 3300048913 Ga0496110_0050228 Ga0496110_0050228_2382_3392 285
9 3300048915 Ga0496112_0004346 Ga0496112_0004346_8959_9969 285
10 3300048916 Ga0496113_0256917 Ga0496113_0256917_22_1032 285
11 3300048920 Ga0496117_0065312 Ga0496117_0065312_1381_2373 290
12 3300048921 Ga0496118_0024955 Ga0496118_0024955_3302_4294 290
13 3300009174 Ga0105241_10009101 Ga0105241_100091016 291
14 3300010375 Ga0105239_10013858 Ga0105239_1001385810 291
15 3300021388 Ga0213875_10000077 Ga0213875_10000077108 291
16 3300021388 Ga0213875_10008537 Ga0213875_100085373 291
17 3300025911 Ga0207654_10008067 Ga0207654_100080675 291
18 3300027512 Ga0209179_1018341 Ga0209179_10183411 291
19 3300037853 Ga0436364_0024756 Ga0436364_0024756_147544_148536 291
20 3300037853 Ga0436364_1012562 Ga0436364_1012562_6856_7851 291
21 3300005563 Ga0068855_100003864 Ga0068855_10000386417 292
22 3300025949 Ga0207667_10038249 Ga0207667_100382495 292
23 3300047472 Ga0495686_0005257 Ga0495686_0005257_2245_3267 292
24 3300049570 Ga0501033_0005604 Ga0501033_0005604_2929_3807 292
25 iso_pu_bacteria 2508501009 2508541397 292
26 iso_pu_bacteria 2508501128 2509148324 292
27 iso_pu_bacteria 2513237161 2514017022 292
28 iso_pu_bacteria 2517093001 2517104730 292
29 iso_pu_bacteria 2824661429 2824670835 292
30 iso_pu_bacteria 2824671348 2824673806 292
31 iso_pu_bacteria 2824687955 2824690414 292
32 iso_pu_bacteria 2838122688 2838127188 292
33 iso_pu_bacteria 2841941048 2841947426 292
34 iso_pu_bacteria 2841949485 2841956300 292
35 iso_pu_bacteria 2841966195 2841973212 292
36 iso_pu_bacteria 2841974524 2841980800 292
37 iso_pu_bacteria 2841983080 2841987288 292
38 iso_pu_bacteria 2842038055 2842041002 292
39 iso_pu_bacteria 2842045827 2842046053 292
40 iso_pu_bacteria 2847930680 2847937650 292
41 iso_pu_bacteria 2849076700 2849078090 292
42 iso_pu_bacteria 2857509624 2857515458 292
43 iso_pu_bacteria 2879083081 2879084147 292
44 iso_pu_bacteria 2881364244 2881370286 292
45 iso_pu_bacteria 2888419890 2888425935 292
46 iso_pu_bacteria 2908739725 2908743142 292
47 iso_pu_bacteria 2932818245 2932825666 292
48 iso_pu_bacteria 2935616580 2935624659 292
49 iso_pu_bacteria 2935675223 2935679684 292
50 iso_pu_bacteria 2935684952 2935690885 292
51 iso_pu_bacteria 2935713505 2935718266 292
52 iso_pu_bacteria 2935722832 2935727753 292
53 iso_pu_bacteria 2935732158 2935736457 292
54 iso_pu_bacteria 2935741537 2935745836 292
55 iso_pu_bacteria 2935750917 2935756217 292
56 iso_pu_bacteria 2935855204 2935863289 292
57 iso_pu_bacteria 2935864058 2935872174 292
58 iso_pu_bacteria 2935873716 2935882356 292
59 iso_pu_bacteria 2940556831 2940561808 292
60 iso_pu_bacteria 3005474847 3005477966 292
61 iso_pu_bacteria 3005594810 3005600705 292
62 iso_pu_bacteria 8016583857 8016594781 292
63 3300037853 Ga0436364_0123579 Ga0436364_0123579_76_957 293
64 3300047472 Ga0495686_0001612 Ga0495686_0001612_6844_7800 293
65 3300005435 Ga0070714_100013784 Ga0070714_1000137847 294
66 3300005437 Ga0070710_10031709 Ga0070710_100317092 294
67 3300006028 Ga0070717_10408411 Ga0070717_104084111 294
68 3300006353 Ga0075370_10009977 Ga0075370_100099773 294
69 3300010159 Ga0099796_10047725 Ga0099796_100477252 294
70 3300014325 Ga0163163_10027389 Ga0163163_100273892 294
71 3300028379 Ga0268266_10026055 Ga0268266_100260554 294
72 3300031247 Ga0265340_10078183 Ga0265340_100781832 294
73 3300031711 Ga0265314_10013131 Ga0265314_100131314 294
74 3300046501 Ga0495607_0154395 Ga0495607_0154395_204_1088 294
75 3300046558 Ga0495633_0103638 Ga0495633_0103638_63_947 294
76 3300046664 Ga0495659_0050369 Ga0495659_0050369_517_1401 294
77 3300046665 Ga0495661_0065288 Ga0495661_0065288_66_950 294
78 3300046794 Ga0495589_0023473 Ga0495589_0023473_1397_2281 294
79 3300047318 Ga0495636_0006248 Ga0495636_0006248_1712_2596 294
80 3300048907 Ga0496104_0257247 Ga0496104_0257247_344_1363 294
81 3300048924 Ga0496121_0147070 Ga0496121_0147070_200_1165 294
82 3300003215 JGI25153J46596_10011668 JGI25153J46596_100116682 295
83 3300005530 Ga0070679_100222087 Ga0070679_1002220872 295
84 3300005616 Ga0068852_100004875 Ga0068852_1000048756 295
85 3300009545 Ga0105237_10383595 Ga0105237_103835952 295
86 3300013105 Ga0157369_10006952 Ga0157369_100069525 295
87 3300021361 Ga0213872_10037429 Ga0213872_100374293 295
88 3300025909 Ga0207705_10409885 Ga0207705_104098851 295
89 3300025913 Ga0207695_10371649 Ga0207695_103716491 295
90 3300025914 Ga0207671_10267727 Ga0207671_102677272 295
91 3300026142 Ga0207698_10077440 Ga0207698_100774402 295
92 3300031344 Ga0265316_10201968 Ga0265316_102019682 295
93 3300037853 Ga0436364_0044497 Ga0436364_0044497_117_1112 295
94 3300037853 Ga0436364_0539821 Ga0436364_0539821_2275_3165 295
95 3300039438 Ga0436360_0462961 Ga0436360_0462961_102_1088 295
96 3300039438 Ga0436360_0814610 Ga0436360_0814610_81_1064 295
97 3300039447 Ga0436361_0278632 Ga0436361_0278632_405_1388 295
98 3300039450 Ga0436363_1659540 Ga0436363_1659540_568_1551 295
99 3300049742 Ga0501080_0003661 Ga0501080_0003661_5766_6653 295
100 iso_pu_bacteria 8016630954 8016638814 295
101 3300005548 Ga0070665_100173431 Ga0070665_1001734312 296
102 3300005615 Ga0070702_100159606 Ga0070702_1001596062 296
103 3300005983 Ga0081540_1003947 Ga0081540_10039475 296
104 3300006038 Ga0075365_10112195 Ga0075365_101121951 296
105 3300006941 Ga0099825_1038840 Ga0099825_10388402 296
106 3300006942 Ga0099824_1014241 Ga0099824_10142413 296
107 3300006943 Ga0099822_1039146 Ga0099822_10391463 296
108 3300025297 Ga0209758_1000011 Ga0209758_1000011695 296
109 3300025304 Ga0209257_1001093 Ga0209257_100109313 296
110 3300025913 Ga0207695_10000610 Ga0207695_1000061038 296
111 3300025913 Ga0207695_10008371 Ga0207695_1000837112 296
112 3300025928 Ga0207700_10433774 Ga0207700_104337741 296
113 3300025933 Ga0207706_10101177 Ga0207706_101011772 296
114 3300027296 Ga0209389_1000009 Ga0209389_1000009204 296
115 3300027357 Ga0209589_1000001 Ga0209589_1000001384 296
116 3300027361 Ga0209489_100001 Ga0209489_100001384 296
117 3300027361 Ga0209489_100671 Ga0209489_10067174 296
118 3300027363 Ga0209700_100001 Ga0209700_100001384 296
119 3300027363 Ga0209700_100016 Ga0209700_10001630 296
120 3300031249 Ga0265339_10010169 Ga0265339_100101699 296
121 3300037471 Ga0395905_0054094 Ga0395905_0054094_2454_3344 296
122 3300038443 Ga0395901_0014386 Ga0395901_0014386_3415_4305 296
123 3300039438 Ga0436360_1244217 Ga0436360_1244217_1032_1922 296
124 3300039447 Ga0436361_0608888 Ga0436361_0608888_1882_2772 296
125 3300039453 Ga0436362_0202539 Ga0436362_0202539_2184_3074 296
126 3300044658 Ga0466972_0083989 Ga0466972_0083989_339_1229 296
127 3300044658 Ga0466972_0164330 Ga0466972_0164330_43_933 296
128 3300045049 Ga0466959_0048524 Ga0466959_0048524_1199_2089 296
129 3300045976 Ga0466967_0239004 Ga0466967_0239004_511_1401 296
130 3300046457 Ga0495590_0053472 Ga0495590_0053472_53_1054 296
131 3300046474 Ga0495605_0036421 Ga0495605_0036421_121_1122 296
132 3300046506 Ga0495583_0119171 Ga0495583_0119171_20_1021 296
133 3300046507 Ga0495606_0037332 Ga0495606_0037332_1061_2062 296
134 3300046512 Ga0495610_0031702 Ga0495610_0031702_1093_2094 296
135 3300046512 Ga0495610_0052919 Ga0495610_0052919_368_1258 296
136 3300046512 Ga0495610_0135747 Ga0495610_0135747_136_1026 296
137 3300046517 Ga0495630_0305723 Ga0495630_0305723_212_1102 296
138 3300046522 Ga0495643_0081111 Ga0495643_0081111_34_1035 296
139 3300046543 Ga0495645_0021819 Ga0495645_0021819_1223_2113 296
140 3300046559 Ga0495667_0009022 Ga0495667_0009022_5296_6186 296
141 3300046642 Ga0495634_0037322 Ga0495634_0037322_255_1145 296
142 3300046663 Ga0495635_0060173 Ga0495635_0060173_841_1842 296
143 3300046663 Ga0495635_0075788 Ga0495635_0075788_474_1364 296
144 3300046665 Ga0495661_0136137 Ga0495661_0136137_191_1192 296
145 3300046675 Ga0495657_0010042 Ga0495657_0010042_2995_3885 296
146 3300046678 Ga0495599_0044885 Ga0495599_0044885_1385_2275 296
147 3300046679 Ga0495623_0013943 Ga0495623_0013943_408_1298 296
148 3300046690 Ga0495624_0055243 Ga0495624_0055243_1277_2278 296
149 3300046694 Ga0495649_0011683 Ga0495649_0011683_3652_4653 296
150 3300046809 Ga0495600_0034897 Ga0495600_0034897_255_1145 296
151 3300047317 Ga0495604_0002416 Ga0495604_0002416_4441_5331 296
152 3300047317 Ga0495604_0141363 Ga0495604_0141363_23_913 296
153 3300047319 Ga0495674_0011720 Ga0495674_0011720_4740_5630 296
154 3300047321 Ga0495676_0195761 Ga0495676_0195761_300_1301 296
155 3300047322 Ga0495680_0006491 Ga0495680_0006491_6058_6948 296
156 3300047323 Ga0495683_0095692 Ga0495683_0095692_311_1312 296
157 3300047443 Ga0495687_075343 Ga0495687_075343_300_1301 296
158 3300047444 Ga0495675_0005741 Ga0495675_0005741_2145_3035 296
159 3300047469 Ga0495673_0022581 Ga0495673_0022581_754_1755 296
160 3300047471 Ga0495684_0085480 Ga0495684_0085480_626_1516 296
161 3300047472 Ga0495686_0084450 Ga0495686_0084450_850_1740 296
162 3300048088 Ga0495602_0017108 Ga0495602_0017108_2868_3758 296
163 3300048088 Ga0495602_0102586 Ga0495602_0102586_850_1740 296
164 3300048908 Ga0496105_0066334 Ga0496105_0066334_146_1147 296
165 3300048922 Ga0496119_0041918 Ga0496119_0041918_898_1899 296
166 3300048928 Ga0496125_0208818 Ga0496125_0208818_213_1214 296
167 3300048929 Ga0496126_0029758 Ga0496126_0029758_1666_2667 296
168 3300049460 Ga0495682_0010765 Ga0495682_0010765_1250_2251 296
169 3300050491 nmdc:mga00v17_164524_c1 nmdc:mga00v17_164524_c1_50_940 296
170 3300050492 nmdc:mga0yw44_44462_c1 nmdc:mga0yw44_44462_c1_403_1293 296
171 3300050516 nmdc:mga0sz30_12114_c1 nmdc:mga0sz30_12114_c1_367_1368 296
172 3300053084 Ga0495595_0105456 Ga0495595_0105456_440_1330 296
173 3300053104 Ga0500556_0000741 Ga0500556_0000741_10077_11078 296
174 3300053105 Ga0500557_000085 Ga0500557_000085_7253_8143 296
175 3300053130 Ga0500642_0000021 Ga0500642_0000021_139217_140107 296
176 3300053142 Ga0500577_0030310 Ga0500577_0030310_849_1841 296
177 3300053177 Ga0500636_0048401 Ga0500636_0048401_1096_2142 296
178 3300053177 Ga0500636_0237230 Ga0500636_0237230_17_907 296
179 3300053729 Ga0500625_006115 Ga0500625_006115_2268_3158 296
180 3300061719 Ga0466962_0186736 Ga0466962_0186736_20_988 296
181 iso_pu_bacteria 2507262055 2507507343 296
182 iso_pu_bacteria 2617270735 2617351955 296
183 iso_pu_bacteria 2824704595 2824708367 296
184 iso_pu_bacteria 2824753945 2824759098 296
185 iso_pu_bacteria 2824763712 2824769486 296
186 iso_pu_bacteria 2824773399 2824777191 296
187 iso_pu_bacteria 2879099564 2879100616 296
188 iso_pu_bacteria 2888378607 2888386562 296
189 iso_pu_bacteria 2904711408 2904711560 296
190 iso_pu_bacteria 2932784394 2932792999 296
191 iso_pu_bacteria 2932818245 2932825864 296
192 iso_pu_bacteria 2935648319 2935651254 296
193 iso_pu_bacteria 2935656913 2935659434 296
194 iso_pu_bacteria 2935703347 2935712004 296
195 iso_pu_bacteria 2935984226 2935986295 296
196 iso_pu_bacteria 2936002035 2936010657 296
197 iso_pu_bacteria 2936011229 2936013849 296
198 iso_pu_bacteria 2936019824 2936022627 296
199 iso_pu_bacteria 2936028420 2936033320 296
200 iso_pu_bacteria 2936046547 2936048955 296
201 iso_pu_bacteria 2936055302 2936060467 296
202 iso_pu_bacteria 2941531003 2941534609 296
203 iso_pu_bacteria 8019586578 8019587123 296
204 iso_pu_bacteria 8019608314 8019608496 296
205 3300009093 Ga0105240_10014371 Ga0105240_1001437112 297
206 3300009551 Ga0105238_10140973 Ga0105238_101409732 297
207 3300021384 Ga0213876_10036452 Ga0213876_100364522 297
208 3300025913 Ga0207695_10218769 Ga0207695_102187692 297
209 3300039450 Ga0436363_0022177 Ga0436363_0022177_454_1467 297
210 3300044684 Ga0466966_0294198 Ga0466966_0294198_60_953 297
211 3300053737 Ga0500601_000382 Ga0500601_000382_820_1821 297
212 3300055283 Ga0500661_007853 Ga0500661_007853_201_1202 297
213 3300005327 Ga0070658_10071638 Ga0070658_100716382 298
214 3300005436 Ga0070713_100428668 Ga0070713_1004286681 298
215 3300005437 Ga0070710_10068128 Ga0070710_100681281 298
216 3300005547 Ga0070693_100109931 Ga0070693_1001099312 298
217 3300009093 Ga0105240_10090361 Ga0105240_100903611 298
218 3300009545 Ga0105237_10001500 Ga0105237_1000150018 298
219 3300013306 Ga0163162_10093605 Ga0163162_100936054 298
220 3300021384 Ga0213876_10045117 Ga0213876_100451172 298
221 3300021384 Ga0213876_10056337 Ga0213876_100563373 298
222 3300025909 Ga0207705_10135286 Ga0207705_101352862 298
223 3300025913 Ga0207695_10261923 Ga0207695_102619231 298
224 3300025914 Ga0207671_10003938 Ga0207671_100039382 298
225 3300039437 Ga0436365_0358379 Ga0436365_0358379_879_1898 298
226 3300039437 Ga0436365_1716323 Ga0436365_1716323_665_1648 298
227 3300039438 Ga0436360_0899278 Ga0436360_0899278_573_1607 298
228 3300039447 Ga0436361_0232817 Ga0436361_0232817_973_2007 298
229 3300046507 Ga0495606_0027095 Ga0495606_0027095_2835_3830 298
230 3300046507 Ga0495606_0047435 Ga0495606_0047435_864_1856 298
231 3300046515 Ga0495620_0091275 Ga0495620_0091275_155_1150 298
232 3300046522 Ga0495643_0010090 Ga0495643_0010090_3331_4326 298
233 3300046542 Ga0495597_0034757 Ga0495597_0034757_1208_2203 298
234 3300046616 Ga0495668_0022676 Ga0495668_0022676_2161_3156 298
235 3300046694 Ga0495649_0010406 Ga0495649_0010406_4178_5173 298
236 3300047443 Ga0495687_008465 Ga0495687_008465_3014_4009 298
237 3300047472 Ga0495686_0101668 Ga0495686_0101668_30_1025 298
238 3300048924 Ga0496121_0001253 Ga0496121_0001253_17807_18793 298
239 3300053083 Ga0495655_0012009 Ga0495655_0012009_418_1413 298
240 3300059506 Ga0587085_003357 Ga0587085_003357_556_1551 298
241 3300059604 Ga0587098_001776 Ga0587098_001776_563_1558 298
242 3300059628 Ga0587122_003402 Ga0587122_003402_83_1078 298
243 3300059643 Ga0587072_006504 Ga0587072_006504_580_1575 298
244 3300003215 JGI25153J46596_10000688 JGI25153J46596_100006887 299
245 3300003215 JGI25153J46596_10001038 JGI25153J46596_1000103813 299
246 3300003354 JGI25160J50197_1000577 JGI25160J50197_100057720 299
247 3300005262 Ga0065165_1043154 Ga0065165_10431541 299
248 3300005327 Ga0070658_10082852 Ga0070658_100828521 299
249 3300005327 Ga0070658_10108989 Ga0070658_101089893 299
250 3300005339 Ga0070660_100228819 Ga0070660_1002288192 299
251 3300005535 Ga0070684_100294970 Ga0070684_1002949702 299
252 3300005539 Ga0068853_100337611 Ga0068853_1003376111 299
253 3300005563 Ga0068855_100015815 Ga0068855_1000158153 299
254 3300006038 Ga0075365_10040511 Ga0075365_100405113 299
255 3300006051 Ga0075364_10044887 Ga0075364_100448876 299
256 3300006186 Ga0075369_10019490 Ga0075369_100194901 299
257 3300025253 Ga0209677_101186 Ga0209677_10118611 299
258 3300025254 Ga0209148_1007962 Ga0209148_10079622 299
259 3300025272 Ga0209455_1002547 Ga0209455_10025473 299
260 3300025297 Ga0209758_1001157 Ga0209758_100115727 299
261 3300025297 Ga0209758_1002031 Ga0209758_100203116 299
262 3300025302 Ga0207426_1000212 Ga0207426_1000212138 299
263 3300025302 Ga0207426_1009704 Ga0207426_10097044 299
264 3300025909 Ga0207705_10050862 Ga0207705_100508622 299
265 3300025909 Ga0207705_10093853 Ga0207705_100938533 299
266 3300025919 Ga0207657_10098964 Ga0207657_100989643 299
267 3300026041 Ga0207639_10155362 Ga0207639_101553622 299
268 3300032002 Ga0307416_100302310 Ga0307416_1003023102 299
269 3300039437 Ga0436365_0472524 Ga0436365_0472524_1159_2172 299
270 3300044656 Ga0466969_0018208 Ga0466969_0018208_2394_3395 299
271 3300044684 Ga0466966_0001735 Ga0466966_0001735_5102_6103 299
272 3300044693 Ga0466961_0000156 Ga0466961_0000156_16263_17264 299
273 3300045049 Ga0466959_0000683 Ga0466959_0000683_5889_6890 299
274 3300046507 Ga0495606_0147779 Ga0495606_0147779_321_1226 299
275 3300048921 Ga0496118_0022917 Ga0496118_0022917_3746_4744 299
276 3300048928 Ga0496125_0029795 Ga0496125_0029795_173_1078 299
277 3300050491 nmdc:mga00v17_41453_c1 nmdc:mga00v17_41453_c1_1345_2250 299
278 3300050492 nmdc:mga0yw44_25514_c1 nmdc:mga0yw44_25514_c1_1841_2746 299
279 3300050496 nmdc:mga07m45_18043_c1 nmdc:mga07m45_18043_c1_1464_2369 299
280 3300050516 nmdc:mga0sz30_23959_c1 nmdc:mga0sz30_23959_c1_348_1253 299
281 3300053086 Ga0500578_0030209 Ga0500578_0030209_1423_2424 299
282 3300053087 Ga0500643_000047 Ga0500643_000047_90132_91133 299
283 iso_pu_bacteria 2739367663 2739647691 299
284 3300005366 Ga0070659_100251545 Ga0070659_1002515451 300
285 3300005539 Ga0068853_100018488 Ga0068853_1000184882 300
286 3300006914 Ga0075436_100032727 Ga0075436_1000327273 300
287 3300009551 Ga0105238_10011778 Ga0105238_100117783 300
288 3300013105 Ga0157369_10102266 Ga0157369_101022663 300
289 3300025920 Ga0207649_10249083 Ga0207649_102490831 300
290 3300025924 Ga0207694_10023321 Ga0207694_100233211 300
291 3300025932 Ga0207690_10214987 Ga0207690_102149871 300
292 3300003323 rootH1_10013427 rootH1_1001342746 302
293 3300009093 Ga0105240_10000001 Ga0105240_100000011769 302
294 3300009174 Ga0105241_10290269 Ga0105241_102902692 302
295 3300010375 Ga0105239_10026741 Ga0105239_100267414 302
296 3300025297 Ga0209758_1000085 Ga0209758_100008549 302
297 3300025934 Ga0207686_10005439 Ga0207686_1000543911 302
298 3300030521 Ga0307511_10057839 Ga0307511_100578393 302
299 3300032004 Ga0307414_10000009 Ga0307414_10000009344 302
300 3300037471 Ga0395905_0179603 Ga0395905_0179603_822_1799 302
301 3300039437 Ga0436365_0662108 Ga0436365_0662108_11434_12432 302
302 3300039438 Ga0436360_1288635 Ga0436360_1288635_5824_6819 302
303 3300039447 Ga0436361_0138441 Ga0436361_0138441_2232_3242 302
304 3300044765 Ga0466970_0096010 Ga0466970_0096010_347_1393 302
305 3300045976 Ga0466967_0188483 Ga0466967_0188483_269_1258 302
306 3300046457 Ga0495590_0000192 Ga0495590_0000192_13109_14101 302
307 3300046460 Ga0495638_0000872 Ga0495638_0000872_14857_15849 302
308 3300046491 Ga0495584_0029294 Ga0495584_0029294_977_1969 302
309 3300046515 Ga0495620_0020178 Ga0495620_0020178_1624_2616 302
310 3300046519 Ga0495632_0004089 Ga0495632_0004089_2695_3687 302
311 3300046522 Ga0495643_0004697 Ga0495643_0004697_4034_5026 302
312 3300046542 Ga0495597_0005922 Ga0495597_0005922_1596_2588 302
313 3300046616 Ga0495668_0000223 Ga0495668_0000223_59967_60959 302
314 3300046660 Ga0495625_0024036 Ga0495625_0024036_3497_4489 302
315 3300046692 Ga0495671_0014652 Ga0495671_0014652_3106_4098 302
316 3300046694 Ga0495649_0011132 Ga0495649_0011132_3272_4264 302
317 3300047323 Ga0495683_0012620 Ga0495683_0012620_2694_3686 302
318 3300047472 Ga0495686_0007754 Ga0495686_0007754_5183_6175 302
319 3300048091 Ga0495626_0007047 Ga0495626_0007047_2722_3714 302
320 3300048924 Ga0496121_0000213 Ga0496121_0000213_99969_100934 302
321 3300048929 Ga0496126_0015656 Ga0496126_0015656_4859_5824 302
322 3300053108 Ga0500562_003820 Ga0500562_003820_1059_2051 302
323 3300053156 Ga0500622_0041209 Ga0500622_0041209_806_1798 302
324 3300053156 Ga0500622_0056513 Ga0500622_0056513_204_1127 302
325 3300014968 Ga0157379_10107790 Ga0157379_101077902 303
326 3300037418 Ga0395900_0284369 Ga0395900_0284369_213_1163 303
327 3300037853 Ga0436364_1075474 Ga0436364_1075474_1820_2773 303
328 3300039450 Ga0436363_0535526 Ga0436363_0535526_332_1351 303
329 3300039450 Ga0436363_0707747 Ga0436363_0707747_2179_3192 303
330 3300044656 Ga0466969_0043013 Ga0466969_0043013_785_1837 303
331 3300044684 Ga0466966_0013560 Ga0466966_0013560_761_1813 303
332 3300045836 Ga0466958_0038244 Ga0466958_0038244_87_1139 303
333 3300002067 JGI24735J21928_10007011 JGI24735J21928_100070113 304
334 3300005327 Ga0070658_10018342 Ga0070658_100183424 304
335 3300005339 Ga0070660_100038716 Ga0070660_1000387162 304
336 3300005563 Ga0068855_100076106 Ga0068855_1000761062 304
337 3300009551 Ga0105238_10124473 Ga0105238_101244733 304
338 3300021361 Ga0213872_10069777 Ga0213872_100697772 304
339 3300025254 Ga0209148_1001974 Ga0209148_10019747 304
340 3300025272 Ga0209455_1003043 Ga0209455_10030433 304
341 3300025904 Ga0207647_10008861 Ga0207647_100088615 304
342 3300025909 Ga0207705_10001236 Ga0207705_1000123618 304
343 3300025919 Ga0207657_10093852 Ga0207657_100938523 304
344 3300036401 Ga0373937_0029535 Ga0373937_0029535_2423_3427 304
345 3300036401 Ga0373937_0190428 Ga0373937_0190428_46_1050 304
346 3300039447 Ga0436361_0710342 Ga0436361_0710342_168_1184 304
347 3300039447 Ga0436361_0726305 Ga0436361_0726305_90_1106 304
348 3300046559 Ga0495667_0093675 Ga0495667_0093675_136_1140 304
349 3300001989 JGI24739J22299_10017325 JGI24739J22299_100173252 305
350 3300001990 JGI24737J22298_10004758 JGI24737J22298_100047583 305
351 3300002067 JGI24735J21928_10010124 JGI24735J21928_100101242 305
352 3300002705 JGI25156J39149_1001264 JGI25156J39149_10012642 305
353 3300002741 JGI25157J39369_1001806 JGI25157J39369_10018063 305
354 3300003316 rootH1_10017040 rootH1_100170407 305
355 3300005327 Ga0070658_10000885 Ga0070658_100008853 305
356 3300005339 Ga0070660_100002335 Ga0070660_1000023358 305
357 3300005354 Ga0070675_100008469 Ga0070675_1000084697 305
358 3300005355 Ga0070671_100054936 Ga0070671_1000549363 305
359 3300005455 Ga0070663_100005799 Ga0070663_1000057996 305
360 3300005456 Ga0070678_100072882 Ga0070678_1000728822 305
361 3300005458 Ga0070681_10168625 Ga0070681_101686253 305
362 3300005535 Ga0070684_100002234 Ga0070684_1000022344 305
363 3300005535 Ga0070684_100041610 Ga0070684_1000416105 305
364 3300005539 Ga0068853_100022151 Ga0068853_1000221513 305
365 3300005543 Ga0070672_100400320 Ga0070672_1004003202 305
366 3300005548 Ga0070665_100543975 Ga0070665_1005439751 305
367 3300005563 Ga0068855_100003591 Ga0068855_1000035918 305
368 3300005563 Ga0068855_100053579 Ga0068855_1000535791 305
369 3300005563 Ga0068855_100195694 Ga0068855_1001956943 305
370 3300005578 Ga0068854_100001682 Ga0068854_10000168213 305
371 3300005614 Ga0068856_100014522 Ga0068856_1000145223 305
372 3300006237 Ga0097621_100001481 Ga0097621_10000148111 305
373 3300006358 Ga0068871_100044068 Ga0068871_1000440683 305
374 3300009093 Ga0105240_10067074 Ga0105240_100670741 305
375 3300009093 Ga0105240_10149423 Ga0105240_101494232 305
376 3300009093 Ga0105240_10343174 Ga0105240_103431742 305
377 3300009174 Ga0105241_10233331 Ga0105241_102333312 305
378 3300009545 Ga0105237_10112725 Ga0105237_101127252 305
379 3300010159 Ga0099796_10003679 Ga0099796_100036791 305
380 3300010375 Ga0105239_10024283 Ga0105239_100242837 305
381 3300013100 Ga0157373_10033063 Ga0157373_100330635 305
382 3300013104 Ga0157370_10000201 Ga0157370_1000020164 305
383 3300013296 Ga0157374_10011612 Ga0157374_100116125 305
384 3300013307 Ga0157372_10005690 Ga0157372_1000569011 305
385 3300013307 Ga0157372_10115438 Ga0157372_101154381 305
386 3300017792 Ga0163161_10003855 Ga0163161_100038557 305
387 3300021384 Ga0213876_10000424 Ga0213876_100004244 305
388 3300021384 Ga0213876_10018689 Ga0213876_100186893 305
389 3300021388 Ga0213875_10000030 Ga0213875_1000003012 305
390 3300025231 Ga0207427_102266 Ga0207427_1022665 305
391 3300025250 Ga0209026_1000211 Ga0209026_100021145 305
392 3300025256 Ga0209759_1000208 Ga0209759_100020845 305
393 3300025256 Ga0209759_1001336 Ga0209759_100133611 305
394 3300025261 Ga0209233_1000003 Ga0209233_10000031016 305
395 3300025909 Ga0207705_10000084 Ga0207705_1000008463 305
396 3300025913 Ga0207695_10000001 Ga0207695_100000011772 305
397 3300025913 Ga0207695_10034095 Ga0207695_100340953 305
398 3300025917 Ga0207660_10382043 Ga0207660_103820431 305
399 3300025919 Ga0207657_10002865 Ga0207657_100028658 305
400 3300025919 Ga0207657_10182266 Ga0207657_101822662 305
401 3300025921 Ga0207652_10224579 Ga0207652_102245792 305
402 3300025924 Ga0207694_10199181 Ga0207694_101991812 305
403 3300025926 Ga0207659_10006695 Ga0207659_100066957 305
404 3300025931 Ga0207644_10048210 Ga0207644_100482103 305
405 3300025940 Ga0207691_10246634 Ga0207691_102466342 305
406 3300025944 Ga0207661_10007108 Ga0207661_100071083 305
407 3300025944 Ga0207661_10039701 Ga0207661_100397013 305
408 3300025949 Ga0207667_10000024 Ga0207667_10000024284 305
409 3300025949 Ga0207667_10027658 Ga0207667_100276586 305
410 3300025949 Ga0207667_10181610 Ga0207667_101816102 305
411 3300025981 Ga0207640_10000229 Ga0207640_1000022929 305
412 3300026067 Ga0207678_10055681 Ga0207678_100556812 305
413 3300026078 Ga0207702_10011130 Ga0207702_100111303 305
414 3300026121 Ga0207683_10110339 Ga0207683_101103392 305
415 3300027512 Ga0209179_1002284 Ga0209179_10022841 305
416 3300028379 Ga0268266_10218601 Ga0268266_102186011 305
417 3300037312 Ga0395899_0004150 Ga0395899_0004150_1753_2670 305
418 3300037418 Ga0395900_0103831 Ga0395900_0103831_856_1773 305
419 3300037418 Ga0395900_0208386 Ga0395900_0208386_531_1448 305
420 3300037471 Ga0395905_0046103 Ga0395905_0046103_1602_2519 305
421 3300037853 Ga0436364_1391193 Ga0436364_1391193_13881_14900 305
422 3300038443 Ga0395901_0183502 Ga0395901_0183502_218_1135 305
423 3300039437 Ga0436365_0837091 Ga0436365_0837091_9817_10821 305
424 3300039437 Ga0436365_1338454 Ga0436365_1338454_112936_113919 305
425 3300039437 Ga0436365_1674268 Ga0436365_1674268_291_1286 305
426 3300039447 Ga0436361_0886713 Ga0436361_0886713_2073_3092 305
427 3300039447 Ga0436361_0955129 Ga0436361_0955129_3104_4117 305
428 3300039450 Ga0436363_0559028 Ga0436363_0559028_1596_2597 305
429 3300044842 Ga0466957_0016605 Ga0466957_0016605_375_1403 305
430 3300045976 Ga0466967_0459593 Ga0466967_0459593_81_1109 305
431 3300048924 Ga0496121_0000026 Ga0496121_0000026_139337_140341 305
432 3300049822 Ga0501035_0055845 Ga0501035_0055845_1663_2697 305
433 3300049823 Ga0501044_0034729 Ga0501044_0034729_4258_5274 305
434 iso_pu_bacteria 2857349434 2857351995 305
435 iso_pu_bacteria 2977942078 2977944953 305
436 iso_pu_bacteria 2984572630 2984572996 305
437 iso_pu_bacteria 2984606641 2984610444 305
438 iso_pu_bacteria 2987636660 2987639179 305
439 iso_pu_bacteria 3004203850 3004204577 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

127

362

0.96

PF00106

adh_short

short chain dehydrogenase

121

316

0.93

PF08659

KR

KR domain

122

305

0.89

PF23441

114

336

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u8p-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9909 14 303
3r3s-assembly1.cif.gz_D structure of the ygha oxidoreductase from salmonella enterica 0.983 14 305
5u8p-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9808 14 303
3r3s-assembly1.cif.gz_D structure of the ygha oxidoreductase from salmonella enterica 0.9797 14 305
3i3o-assembly2.cif.gz_H 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone 0.9792 30 301
ID Description Score Start End Superfamily
3r3sA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.985 14 305 3.40.50.720
3r3sA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9817 14 305 3.40.50.720
3i3oG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9787 43 301 3.40.50.720
af_K7KGR3_30_220_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9738 123 301 3.40.50.720
af_Q75KH3_1_297_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9597 24 301 3.40.50.720
ID Description Score Start End GO Terms
AF-X6K9W2-F1-model_v4 Dehydrogenase 0.9919 15 118 GO:0016614
AF-A0A4Q2Y8T3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9895 13 155 GO:0016614
AF-A0A418IZU3-F1-model_v4 deleted 0.9818 110 239
AF-A0A519T453-F1-model_v4 SDR family oxidoreductase 0.9755 50 302 GO:0016614
AF-A0A418IZU3-F1-model_v4 deleted 0.9744 110 239

Feature Viewer

pLDDT pTM Quality
90.82 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map