F444311

General Info

Members Datasets Scaffolds Average Seq Length
439 236 878 231

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_342507_c1|nmdc:mga0rr50_342507_c1_386_1138
Length 250
Sequence LVHTFRARIEIDTNDGRMGDRVTPDTVLVVDDDKKMRRMLWEVLNDHGYRVLEAATLASAAQLAEQHRPSLILLDLTLADGDGMQLLRTLTATGRTPVIVVSGRDGEHDKVAALEAGANDYLTKPFGMRELLARIRVARRLATQLPNSVKDVLAIGSLEIDVPRHTVRIAGESVHLTPIEFRILLALARNAGRVLTHRQLLAEVWGPEHANQAHHLRVHVAALRRKIERDPAQPCLLQTEPGIGYRLRDE

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 5.92
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_342507_c1 3300050513 Bacteria 1256
2 rootH1_10023420 3300003316 Bacteria 13941
3 rootL2_10010012 3300003322 Bacteria 5124
4 Ga0055536_1000344 3300003781 Bacteria 34426
5 Ga0070658_10818644 3300005327 Bacteria 809
6 Ga0070683_100001406 3300005329 Bacteria 18487
7 Ga0070683_100090951 3300005329 Bacteria 2865
8 Ga0070683_100702094 3300005329 Bacteria 969
9 Ga0070690_100113811 3300005330 Bacteria 1808
10 Ga0070690_100114021 3300005330 Bacteria 1807
11 Ga0068869_100054746 3300005334 Bacteria 2906
12 Ga0068869_100396784 3300005334 Bacteria 1134
13 Ga0070666_10191850 3300005335 Bacteria 1436
14 Ga0070666_10253124 3300005335 Bacteria 1247
15 Ga0070666_10302434 3300005335 Bacteria 1139
16 Ga0068868_100246557 3300005338 Bacteria 1502
17 Ga0070689_100007345 3300005340 Bacteria 7694
18 Ga0070689_100028332 3300005340 Bacteria 4233
19 Ga0070689_100053023 3300005340 Bacteria 3138
20 Ga0070689_100168439 3300005340 Bacteria 1774
21 Ga0070689_100373708 3300005340 Bacteria 1200
22 Ga0070691_10007341 3300005341 Bacteria 5047
23 Ga0070691_10239812 3300005341 Bacteria 968
24 Ga0070668_100051585 3300005347 Bacteria 3170
25 Ga0070669_100004952 3300005353 Bacteria 9615
26 Ga0070675_100025270 3300005354 Bacteria 4761
27 Ga0070675_100117312 3300005354 Bacteria 2259
28 Ga0070674_100006733 3300005356 Bacteria 6727
29 Ga0070673_100000752 3300005364 Bacteria 17981
30 Ga0070673_100050406 3300005364 Bacteria 3255
31 Ga0070673_100068329 3300005364 Bacteria 2845
32 Ga0070688_100022354 3300005365 Bacteria 3705
33 Ga0070688_100023938 3300005365 Bacteria 3597
34 Ga0070688_100165293 3300005365 Bacteria 1523
35 Ga0070667_100144867 3300005367 Bacteria 2083
36 Ga0070710_10438084 3300005437 Bacteria 883
37 Ga0070700_100002984 3300005441 Bacteria 8684
38 Ga0070694_100059729 3300005444 Bacteria 2598
39 Ga0070694_100076163 3300005444 Bacteria 2322
40 Ga0070708_100380916 3300005445 Bacteria 1330
41 Ga0070678_100168502 3300005456 Bacteria 1781
42 Ga0070678_100187064 3300005456 Bacteria 1700
43 Ga0070662_100424742 3300005457 Bacteria 1100
44 Ga0070681_10108797 3300005458 Bacteria 2712
45 Ga0070681_10148221 3300005458 Bacteria 2274
46 Ga0070681_10243149 3300005458 Bacteria 1713
47 Ga0068867_100045975 3300005459 Bacteria 3204
48 Ga0068867_100494487 3300005459 Bacteria 1050
49 Ga0070685_10082684 3300005466 Bacteria 1928
50 Ga0070685_10087398 3300005466 Bacteria 1881
51 Ga0070698_100045402 3300005471 Bacteria 4497
52 Ga0070699_100767213 3300005518 Bacteria 882
53 Ga0070679_100143062 3300005530 Bacteria 2370
54 Ga0070679_100149481 3300005530 Bacteria 2313
55 Ga0070684_100053557 3300005535 Bacteria 3513
56 Ga0068853_100050350 3300005539 Bacteria 3583
57 Ga0068853_100119312 3300005539 Bacteria 2351
58 Ga0070672_100062379 3300005543 Bacteria 2941
59 Ga0070672_100252638 3300005543 Bacteria 1485
60 Ga0070686_100004199 3300005544 Bacteria 7932
61 Ga0070696_100021884 3300005546 Bacteria 4337
62 Ga0070693_100326549 3300005547 Bacteria 1043
63 Ga0070665_100575252 3300005548 Bacteria 1139
64 Ga0068855_100022508 3300005563 Bacteria 7553
65 Ga0068855_100207620 3300005563 Bacteria 2203
66 Ga0068855_100315374 3300005563 Bacteria 1729
67 Ga0070664_100069126 3300005564 Bacteria 3021
68 Ga0068857_100004130 3300005577 Bacteria 12238
69 Ga0068857_100098671 3300005577 Bacteria 2620
70 Ga0068854_100050508 3300005578 Bacteria 2976
71 Ga0068854_100190655 3300005578 Bacteria 1606
72 Ga0068856_100270537 3300005614 Bacteria 1715
73 Ga0070702_100058162 3300005615 Bacteria 2239
74 Ga0068852_100006690 3300005616 Bacteria 8355
75 Ga0068852_100052535 3300005616 Bacteria 3503
76 Ga0068859_100072936 3300005617 Bacteria 3470
77 Ga0068859_100148550 3300005617 Bacteria 2419
78 Ga0068859_100320891 3300005617 Bacteria 1643
79 Ga0068859_100486242 3300005617 Bacteria 1330
80 Ga0068864_100052649 3300005618 Bacteria 3509
81 Ga0068864_100079011 3300005618 Bacteria 2880
82 Ga0068864_100092334 3300005618 Bacteria 2672
83 Ga0068864_100433954 3300005618 Bacteria 1254
84 Ga0068864_100736468 3300005618 Bacteria 965
85 Ga0068866_10041568 3300005718 Bacteria 2282
86 Ga0068861_100035569 3300005719 Bacteria 3691
87 Ga0068861_100611310 3300005719 Bacteria 1002
88 Ga0068863_100342307 3300005841 Bacteria 1455
89 Ga0068858_100074895 3300005842 Bacteria 3143
90 Ga0068860_100048853 3300005843 Bacteria 4032
91 Ga0068860_100055973 3300005843 Bacteria 3750
92 Ga0068862_100020341 3300005844 Bacteria 5544
93 Ga0081455_10011945 3300005937 Bacteria 8690
94 Ga0097621_100683714 3300006237 Bacteria 944
95 Ga0068871_100054700 3300006358 Bacteria 3239
96 Ga0068871_100113798 3300006358 Bacteria 2279
97 Ga0068871_100461434 3300006358 Bacteria 1140
98 Ga0075428_100005871 3300006844 Bacteria 13639
99 Ga0075430_100098732 3300006846 Bacteria 2439
100 Ga0075431_100063808 3300006847 Bacteria 3802
101 Ga0075431_100377020 3300006847 Bacteria 1423
102 Ga0075431_100750641 3300006847 Bacteria 951
103 Ga0075429_100011359 3300006880 Bacteria 7711
104 Ga0075429_100107353 3300006880 Bacteria 2440
105 Ga0068865_100267956 3300006881 Bacteria 1355
106 Ga0097620_100072936 3300006931 Bacteria 3470
107 Ga0097620_100148553 3300006931 Bacteria 2419
108 Ga0097620_100320895 3300006931 Bacteria 1643
109 Ga0097620_100486219 3300006931 Bacteria 1330
110 Ga0075435_100031960 3300007076 Bacteria 4153
111 Ga0075435_100063774 3300007076 Bacteria 2993
112 Ga0105240_10001556 3300009093 Bacteria 38962
113 Ga0105240_10029153 3300009093 Bacteria 7197
114 Ga0105240_10108895 3300009093 Bacteria 3356
115 Ga0105240_10166142 3300009093 Bacteria 2617
116 Ga0105240_10480282 3300009093 Bacteria 1385
117 Ga0111539_10000092 3300009094 Bacteria 94116
118 Ga0111539_10003682 3300009094 Bacteria 20175
119 Ga0111539_10109213 3300009094 Bacteria 3246
120 Ga0111539_10149043 3300009094 Bacteria 2739
121 Ga0111539_10347177 3300009094 Bacteria 1727
122 Ga0105245_10004700 3300009098 Bacteria 12071
123 Ga0105247_10077413 3300009101 Bacteria 2090
124 Ga0105243_10119378 3300009148 Bacteria 2220
125 Ga0105243_10144831 3300009148 Unclassified 2032
126 Ga0105243_10726985 3300009148 Bacteria 971
127 Ga0105241_10001477 3300009174 Bacteria 18004
128 Ga0105241_10082693 3300009174 Bacteria 2517
129 Ga0105241_10145224 3300009174 Bacteria 1935
130 Ga0105242_10645277 3300009176 Bacteria 1029
131 Ga0105242_10711289 3300009176 Bacteria 984
132 Ga0105248_10015338 3300009177 Bacteria 8450
133 Ga0105248_10100344 3300009177 Bacteria 3262
134 Ga0105237_10006863 3300009545 Bacteria 12550
135 Ga0105237_10020524 3300009545 Bacteria 6808
136 Ga0105237_10044973 3300009545 Bacteria 4445
137 Ga0105237_10609806 3300009545 Bacteria 1098
138 Ga0105238_10001372 3300009551 Bacteria 24425
139 Ga0105238_10005727 3300009551 Bacteria 12283
140 Ga0105238_10005911 3300009551 Bacteria 12124
141 Ga0105238_10124199 3300009551 Bacteria 2560
142 Ga0105238_10158270 3300009551 Bacteria 2240
143 Ga0105238_10484383 3300009551 Bacteria 1237
144 Ga0105249_10034044 3300009553 Bacteria 4614
145 Ga0105239_10019563 3300010375 Bacteria 7474
146 Ga0105239_10036036 3300010375 Bacteria 5432
147 Ga0105239_10520144 3300010375 Bacteria 1354
148 Ga0105239_10555566 3300010375 Bacteria 1308
149 Ga0157370_10205234 3300013104 Bacteria 1827
150 Ga0157369_10184805 3300013105 Bacteria 2192
151 Ga0157374_10149388 3300013296 Unclassified 2271
152 Ga0157374_10155343 3300013296 Bacteria 2226
153 Ga0157378_10026143 3300013297 Bacteria 5145
154 Ga0157378_10077327 3300013297 Bacteria 3000
155 Ga0157372_10001284 3300013307 Bacteria 27122
156 Ga0157372_10015993 3300013307 Bacteria 8047
157 Ga0157372_10239298 3300013307 Bacteria 2106
158 Ga0157375_10102478 3300013308 Bacteria 2947
159 Ga0157375_10454351 3300013308 Unclassified 1447
160 Ga0163163_10125220 3300014325 Bacteria 2607
161 Ga0163163_10195585 3300014325 Bacteria 2070
162 Ga0157380_10008661 3300014326 Bacteria 7273
163 Ga0213876_10149124 3300021384 Bacteria 1244
164 Ga0209148_1001511 3300025254 Bacteria 11507
165 Ga0209455_1000760 3300025272 Bacteria 18220
166 Ga0209564_1011186 3300025295 Bacteria 4046
167 Ga0207642_10026921 3300025899 Bacteria 2348
168 Ga0207642_10143760 3300025899 Bacteria 1261
169 Ga0207710_10333353 3300025900 Bacteria 771
170 Ga0207680_10085182 3300025903 Bacteria 1996
171 Ga0207647_10017140 3300025904 Bacteria 4930
172 Ga0207699_10225992 3300025906 Bacteria 1280
173 Ga0207645_10014608 3300025907 Bacteria 5248
174 Ga0207705_10434836 3300025909 Bacteria 1017
175 Ga0207654_10002081 3300025911 Bacteria 10259
176 Ga0207654_10069381 3300025911 Bacteria 2088
177 Ga0207707_10042613 3300025912 Bacteria 3960
178 Ga0207695_10007678 3300025913 Bacteria 13660
179 Ga0207695_10016877 3300025913 Bacteria 8521
180 Ga0207695_10074174 3300025913 Unclassified 3464
181 Ga0207695_10341415 3300025913 Bacteria 1385
182 Ga0207671_10004223 3300025914 Bacteria 13841
183 Ga0207671_10024178 3300025914 Bacteria 4571
184 Ga0207671_10146618 3300025914 Bacteria 1821
185 Ga0207663_10038637 3300025916 Bacteria 2887
186 Ga0207657_10209598 3300025919 Bacteria 1564
187 Ga0207649_10159564 3300025920 Bacteria 1562
188 Ga0207652_10159866 3300025921 Bacteria 2019
189 Ga0207652_10254089 3300025921 Bacteria 1585
190 Ga0207681_10004867 3300025923 Bacteria 8250
191 Ga0207694_10009415 3300025924 Bacteria 7366
192 Ga0207694_10029255 3300025924 Bacteria 4203
193 Ga0207694_10153793 3300025924 Bacteria 1854
194 Ga0207659_10062053 3300025926 Bacteria 2697
195 Ga0207659_10140011 3300025926 Bacteria 1877
196 Ga0207687_10003671 3300025927 Bacteria 10335
197 Ga0207687_10239671 3300025927 Bacteria 1437
198 Ga0207687_10621291 3300025927 Unclassified 912
199 Ga0207706_10148950 3300025933 Bacteria 2059
200 Ga0207706_10189360 3300025933 Bacteria 1806
201 Ga0207686_10116116 3300025934 Bacteria 1814
202 Ga0207709_10094508 3300025935 Bacteria 1962
203 Ga0207709_10161751 3300025935 Unclassified 1562
204 Ga0207709_10174735 3300025935 Bacteria 1511
205 Ga0207709_10430020 3300025935 Bacteria 1016
206 Ga0207670_10012898 3300025936 Bacteria 4908
207 Ga0207670_10019770 3300025936 Bacteria 4122
208 Ga0207670_10192961 3300025936 Bacteria 1542
209 Ga0207669_10001224 3300025937 Bacteria 10908
210 Ga0207704_10130894 3300025938 Bacteria 1737
211 Ga0207704_10319563 3300025938 Bacteria 1197
212 Ga0207691_10005250 3300025940 Bacteria 12506
213 Ga0207691_10720434 3300025940 Bacteria 841
214 Ga0207711_10084487 3300025941 Bacteria 2778
215 Ga0207689_10068169 3300025942 Bacteria 2924
216 Ga0207689_10129166 3300025942 Bacteria 2079
217 Ga0207689_10176683 3300025942 Bacteria 1761
218 Ga0207661_10018191 3300025944 Bacteria 5220
219 Ga0207661_10047438 3300025944 Bacteria 3410
220 Ga0207661_10078940 3300025944 Bacteria 2712
221 Ga0207661_10510535 3300025944 Bacteria 1099
222 Ga0207667_10003610 3300025949 Bacteria 19086
223 Ga0207667_10208017 3300025949 Bacteria 2006
224 Ga0207651_10002764 3300025960 Bacteria 8422
225 Ga0207651_10034748 3300025960 Bacteria 3269
226 Ga0207651_10191213 3300025960 Bacteria 1633
227 Ga0207651_10333026 3300025960 Bacteria 1273
228 Ga0207651_10375156 3300025960 Bacteria 1204
229 Ga0207712_10019242 3300025961 Bacteria 4457
230 Ga0207668_10197785 3300025972 Bacteria 1598
231 Ga0207640_10332030 3300025981 Bacteria 1215
232 Ga0207640_10357938 3300025981 Bacteria 1175
233 Ga0207677_10224067 3300026023 Bacteria 1510
234 Ga0207703_10016234 3300026035 Bacteria 5803
235 Ga0207703_10049489 3300026035 Bacteria 3398
236 Ga0207639_10117469 3300026041 Bacteria 2180
237 Ga0207639_10169179 3300026041 Bacteria 1849
238 Ga0207639_10173965 3300026041 Bacteria 1826
239 Ga0207708_10000769 3300026075 Bacteria 24152
240 Ga0207702_10101230 3300026078 Bacteria 2544
241 Ga0207702_10378174 3300026078 Bacteria 1361
242 Ga0207641_10008301 3300026088 Bacteria 8581
243 Ga0207641_10241929 3300026088 Bacteria 1682
244 Ga0207648_10007063 3300026089 Bacteria 11087
245 Ga0207676_10843395 3300026095 Bacteria 896
246 Ga0207674_10003537 3300026116 Bacteria 19078
247 Ga0207674_10071137 3300026116 Bacteria 3495
248 Ga0207675_100010276 3300026118 Bacteria 8770
249 Ga0207675_100357099 3300026118 Bacteria 1433
250 Ga0207683_10057921 3300026121 Bacteria 3401
251 Ga0207683_10060977 3300026121 Bacteria 3318
252 Ga0207683_10127717 3300026121 Bacteria 2286
253 Ga0207698_10009813 3300026142 Bacteria 6118
254 Ga0207698_10232762 3300026142 Bacteria 1674
255 Ga0209998_10015543 3300027717 Bacteria 1595
256 Ga0207428_10008948 3300027907 Bacteria 9018
257 Ga0207428_10049540 3300027907 Bacteria 3365
258 Ga0268264_10036381 3300028381 Bacteria 4056
259 Ga0268264_10097372 3300028381 Bacteria 2550
260 Ga0307515_10341621 3300028794 Bacteria 1149
261 Ga0265330_10106619 3300031235 Unclassified 1198
262 Ga0265325_10028585 3300031241 Bacteria 3004
263 Ga0265339_10003842 3300031249 Bacteria 10425
264 Ga0265316_10015329 3300031344 Bacteria 6705
265 Ga0307513_10133968 3300031456 Bacteria 2417
266 Ga0307509_10527075 3300031507 Bacteria 862
267 Ga0307408_100101406 3300031548 Bacteria 2194
268 Ga0265314_10000001 3300031711 Bacteria 3792860
269 Ga0265314_10142247 3300031711 Bacteria 1481
270 Ga0265342_10244766 3300031712 Bacteria 959
271 Ga0307405_10656574 3300031731 Bacteria 863
272 Ga0307410_10006112 3300031852 Bacteria 6462
273 Ga0307410_10036998 3300031852 Bacteria 3184
274 Ga0307406_10133269 3300031901 Bacteria 1747
275 Ga0307412_10053936 3300031911 Bacteria 2667
276 Ga0307416_100140974 3300032002 Bacteria 2191
277 Ga0307414_10063234 3300032004 Bacteria 2630
278 Ga0307411_10022907 3300032005 Bacteria 3688
279 Ga0307411_10028186 3300032005 Bacteria 3411
280 Ga0307411_10288628 3300032005 Bacteria 1310
281 Ga0373950_0024021 3300034818 Bacteria 1093
282 Ga0373934_0003923 3300035086 Bacteria 5463
283 Ga0373934_0145980 3300035086 Bacteria 968
284 Ga0373940_0022330 3300035088 Bacteria 1625
285 Ga0373949_0000017 3300035090 Bacteria 60131
286 Ga0373951_0000658 3300035091 Bacteria 9500
287 Ga0373936_0102952 3300035113 Bacteria 1206
288 Ga0373953_0025744 3300035117 Bacteria 2250
289 Ga0373954_0086781 3300035118 Bacteria 1499
290 Ga0373956_0026530 3300035119 Bacteria 2510
291 Ga0373943_0164269 3300035170 Bacteria 1211
292 Ga0373943_0167187 3300035170 Bacteria 1201
293 Ga0373946_0052888 3300035171 Bacteria 1705
294 Ga0373946_0076353 3300035171 Bacteria 1458
295 Ga0373955_0062788 3300035172 Bacteria 2055
296 Ga0373961_0000139 3300035241 Bacteria 35977
297 Ga0373962_0062322 3300035242 Bacteria 1098
298 Ga0373931_0019539 3300035691 Bacteria 3384
299 Ga0373927_0336578 3300035695 Bacteria 994
300 Ga0373933_0001203 3300035724 Bacteria 15337
301 Ga0373933_0384396 3300035724 Bacteria 914
302 Ga0373947_0061577 3300035725 Bacteria 2281
303 Ga0373947_0134141 3300035725 Bacteria 1583
304 Ga0373937_0002329 3300036401 Bacteria 15872
305 Ga0373937_0072075 3300036401 Bacteria 3186
306 Ga0373937_0140541 3300036401 Bacteria 2259
307 Ga0373937_0426787 3300036401 Bacteria 1258
308 Ga0373925_0009124 3300037068 Bacteria 7218
309 Ga0373925_0499996 3300037068 Bacteria 998
310 Ga0436365_0158450 3300039437 Bacteria 1964
311 Ga0451577_0686702 3300042876 Unclassified 928
312 Ga0453683_0139080 3300044673 Bacteria 1532
313 Ga0453684_0657189 3300044712 Unclassified 1143
314 Ga0495580_0065254 3300046472 Bacteria 2550
315 Ga0495582_0004984 3300046473 Bacteria 7440
316 Ga0495664_0002820 3300046477 Bacteria 9341
317 Ga0495664_0347160 3300046477 Bacteria 894
318 Ga0495618_0146188 3300046514 Bacteria 1511
319 Ga0495628_0267097 3300046516 Bacteria 1274
320 Ga0495630_0004147 3300046517 Bacteria 10151
321 Ga0495586_0003143 3300046535 Bacteria 8882
322 Ga0495586_0100354 3300046535 Bacteria 1606
323 Ga0495634_0000584 3300046642 Bacteria 35462
324 Ga0495658_0248866 3300046683 Bacteria 1117
325 Ga0495674_0015785 3300047319 Bacteria 7049
326 Ga0495674_0220454 3300047319 Bacteria 1568
327 Ga0495680_0345005 3300047322 Bacteria 1038
328 Ga0495684_0012239 3300047471 Bacteria 6619
329 Ga0495684_0485024 3300047471 Bacteria 853
330 Ga0495686_0041369 3300047472 Bacteria 2935
331 Ga0496100_0059659 3300048903 Bacteria 2508
332 Ga0496100_0162416 3300048903 Bacteria 1602
333 Ga0496101_0005297 3300048904 Bacteria 8216
334 Ga0496101_0058343 3300048904 Bacteria 2795
335 Ga0496101_0303940 3300048904 Bacteria 1250
336 Ga0496102_0024613 3300048905 Bacteria 5353
337 Ga0496102_0180890 3300048905 Bacteria 1987
338 Ga0496104_0003557 3300048907 Bacteria 13445
339 Ga0496104_0108796 3300048907 Bacteria 2657
340 Ga0496106_0107964 3300048909 Bacteria 2165
341 Ga0496106_0136650 3300048909 Bacteria 1926
342 Ga0496106_0293105 3300048909 Bacteria 1304
343 Ga0496107_0097554 3300048910 Bacteria 2152
344 Ga0496108_0000820 3300048911 Bacteria 24155
345 Ga0496108_0006593 3300048911 Bacteria 9414
346 Ga0496108_0123444 3300048911 Bacteria 2222
347 Ga0496109_0002317 3300048912 Bacteria 15854
348 Ga0496109_0002692 3300048912 Bacteria 14903
349 Ga0496109_0078968 3300048912 Bacteria 3031
350 Ga0496110_0005572 3300048913 Bacteria 9886
351 Ga0496110_0026198 3300048913 Bacteria 4987
352 Ga0496112_0215588 3300048915 Bacteria 1876
353 Ga0496113_0000153 3300048916 Bacteria 30067
354 Ga0496113_0144038 3300048916 Bacteria 1876
355 Ga0496114_0000646 3300048917 Bacteria 25683
356 Ga0496115_0090762 3300048918 Bacteria 2496
357 Ga0501034_0031518 3300049571 Bacteria 5384
358 Ga0501034_0107680 3300049571 Bacteria 2779
359 Ga0501038_0440544 3300049574 Bacteria 1003
360 Ga0501042_0263176 3300049578 Bacteria 1245
361 Ga0501043_0020775 3300049579 Bacteria 5150
362 Ga0501046_0114346 3300049580 Bacteria 2059
363 Ga0501046_0297782 3300049580 Bacteria 1179
364 Ga0501047_0003323 3300049581 Bacteria 15230
365 Ga0501047_0011314 3300049581 Bacteria 8448
366 Ga0501047_0035786 3300049581 Bacteria 4797
367 Ga0501067_0001182 3300049583 Bacteria 14166
368 Ga0501067_0004284 3300049583 Bacteria 7864
369 Ga0501067_0018504 3300049583 Bacteria 3858
370 Ga0501067_0140283 3300049583 Bacteria 1346
371 Ga0501068_0000394 3300049584 Bacteria 22113
372 Ga0501068_0101949 3300049584 Bacteria 1779
373 Ga0501068_0101950 3300049584 Bacteria 1779
374 Ga0501069_0000211 3300049585 Bacteria 25989
375 Ga0501069_0000810 3300049585 Bacteria 14743
376 Ga0501069_0043693 3300049585 Bacteria 2481
377 Ga0501070_0002969 3300049586 Bacteria 14781
378 Ga0501070_0025932 3300049586 Bacteria 4918
379 Ga0501070_0074344 3300049586 Bacteria 2813
380 Ga0501070_0082073 3300049586 Bacteria 2667
381 Ga0501070_0196762 3300049586 Bacteria 1655
382 Ga0501070_0268171 3300049586 Bacteria 1394
383 Ga0501070_0324458 3300049586 Bacteria 1252
384 Ga0501071_0028613 3300049587 Bacteria 3929
385 Ga0501071_0036151 3300049587 Bacteria 3522
386 Ga0501071_0036682 3300049587 Bacteria 3497
387 Ga0501072_0000016 3300049588 Bacteria 165259
388 Ga0501072_0060180 3300049588 Bacteria 2995
389 Ga0501073_0004660 3300049589 Bacteria 10301
390 Ga0501073_0012647 3300049589 Bacteria 6157
391 Ga0501073_0025056 3300049589 Bacteria 4281
392 Ga0501073_0056734 3300049589 Bacteria 2739
393 Ga0501073_0060702 3300049589 Bacteria 2639
394 Ga0501074_0003292 3300049590 Bacteria 11428
395 Ga0501074_0012423 3300049590 Bacteria 6190
396 Ga0501074_0216920 3300049590 Bacteria 1363
397 Ga0501074_0411006 3300049590 Bacteria 960
398 Ga0501075_0010780 3300049591 Bacteria 6439
399 Ga0501076_0025945 3300049592 Bacteria 4537
400 Ga0501076_0034243 3300049592 Bacteria 3969
401 Ga0501077_0001049 3300049593 Bacteria 16666
402 Ga0501077_0001542 3300049593 Bacteria 13880
403 Ga0501079_0005386 3300049741 Bacteria 9528
404 Ga0501079_0036108 3300049741 Bacteria 3806
405 Ga0501080_0013898 3300049742 Bacteria 7410
406 Ga0501080_0213004 3300049742 Bacteria 1770
407 Ga0501080_0276463 3300049742 Bacteria 1527
408 Ga0501081_0049056 3300049743 Bacteria 2906
409 Ga0501081_0577460 3300049743 Bacteria 841
410 Ga0501083_0005162 3300049744 Bacteria 9239
411 Ga0501083_0034431 3300049744 Bacteria 3463
412 Ga0501044_0002394 3300049823 Bacteria 21381
413 Ga0501044_0124743 3300049823 Bacteria 2573
414 Ga0501045_0077926 3300049824 Bacteria 2443
415 nmdc:mga09592_145705_c1 3300050508 Bacteria 2042
416 nmdc:mga09592_35262_c1 3300050508 Bacteria 4187
417 nmdc:mga09592_36726_c1 3300050508 Bacteria 4105
418 nmdc:mga0qj67_62235_c1 3300050509 Bacteria 2966
419 nmdc:mga06r32_71402_c1 3300050510 Bacteria 3359
420 nmdc:mga06r32_807326_c1 3300050510 Bacteria 898
421 nmdc:mga06r32_878350_c1 3300050510 Bacteria 854
422 nmdc:mga08y16_166166_c1 3300050511 Bacteria 2292
423 nmdc:mga08y16_16722_c1 3300050511 Bacteria 7720
424 nmdc:mga08y16_5465_c1 3300050511 Bacteria 13285
425 nmdc:mga0n895_11332_c1 3300050512 Bacteria 7946
426 nmdc:mga0n895_726668_c1 3300050512 Bacteria 987
427 nmdc:mga0rr50_121494_c1 3300050513 Bacteria 2079
428 nmdc:mga0rr50_323794_c1 3300050513 Bacteria 1293
429 nmdc:mga08x19_107257_c1 3300050514 Bacteria 1859
430 nmdc:mga0a205_428957_c1 3300050515 Bacteria 1183
431 nmdc:mga0a205_455792_c1 3300050515 Bacteria 1139
432 nmdc:mga0a205_825627_c1 3300050515 Bacteria 774
433 Ga0495601_0388545 3300053077 Bacteria 905
434 Ga0501084_0000028 3300054114 Bacteria 124129
435 Ga0501084_0454027 3300054114 Bacteria 1083
436 Ga0501084_0536340 3300054114 Bacteria 989
437 Ga0501082_0000787 3300060353 Bacteria 27894
438 Ga0501082_0028304 3300060353 Bacteria 4829
439 Ga0501082_0065414 3300060353 Bacteria 3131
440 nmdc:mga0rr50_342507_c1
441 rootH1_10023420
442 rootL2_10010012
443 Ga0055536_1000344
444 Ga0070658_10818644
445 Ga0070683_100001406
446 Ga0070683_100090951
447 Ga0070683_100702094
448 Ga0070690_100113811
449 Ga0070690_100114021
450 Ga0068869_100054746
451 Ga0068869_100396784
452 Ga0070666_10191850
453 Ga0070666_10253124
454 Ga0070666_10302434
455 Ga0068868_100246557
456 Ga0070689_100007345
457 Ga0070689_100028332
458 Ga0070689_100053023
459 Ga0070689_100168439
460 Ga0070689_100373708
461 Ga0070691_10007341
462 Ga0070691_10239812
463 Ga0070668_100051585
464 Ga0070669_100004952
465 Ga0070675_100025270
466 Ga0070675_100117312
467 Ga0070674_100006733
468 Ga0070673_100000752
469 Ga0070673_100050406
470 Ga0070673_100068329
471 Ga0070688_100022354
472 Ga0070688_100023938
473 Ga0070688_100165293
474 Ga0070667_100144867
475 Ga0070710_10438084
476 Ga0070700_100002984
477 Ga0070694_100059729
478 Ga0070694_100076163
479 Ga0070708_100380916
480 Ga0070678_100168502
481 Ga0070678_100187064
482 Ga0070662_100424742
483 Ga0070681_10108797
484 Ga0070681_10148221
485 Ga0070681_10243149
486 Ga0068867_100045975
487 Ga0068867_100494487
488 Ga0070685_10082684
489 Ga0070685_10087398
490 Ga0070698_100045402
491 Ga0070699_100767213
492 Ga0070679_100143062
493 Ga0070679_100149481
494 Ga0070684_100053557
495 Ga0068853_100050350
496 Ga0068853_100119312
497 Ga0070672_100062379
498 Ga0070672_100252638
499 Ga0070686_100004199
500 Ga0070696_100021884
501 Ga0070693_100326549
502 Ga0070665_100575252
503 Ga0068855_100022508
504 Ga0068855_100207620
505 Ga0068855_100315374
506 Ga0070664_100069126
507 Ga0068857_100004130
508 Ga0068857_100098671
509 Ga0068854_100050508
510 Ga0068854_100190655
511 Ga0068856_100270537
512 Ga0070702_100058162
513 Ga0068852_100006690
514 Ga0068852_100052535
515 Ga0068859_100072936
516 Ga0068859_100148550
517 Ga0068859_100320891
518 Ga0068859_100486242
519 Ga0068864_100052649
520 Ga0068864_100079011
521 Ga0068864_100092334
522 Ga0068864_100433954
523 Ga0068864_100736468
524 Ga0068866_10041568
525 Ga0068861_100035569
526 Ga0068861_100611310
527 Ga0068863_100342307
528 Ga0068858_100074895
529 Ga0068860_100048853
530 Ga0068860_100055973
531 Ga0068862_100020341
532 Ga0081455_10011945
533 Ga0097621_100683714
534 Ga0068871_100054700
535 Ga0068871_100113798
536 Ga0068871_100461434
537 Ga0075428_100005871
538 Ga0075430_100098732
539 Ga0075431_100063808
540 Ga0075431_100377020
541 Ga0075431_100750641
542 Ga0075429_100011359
543 Ga0075429_100107353
544 Ga0068865_100267956
545 Ga0097620_100072936
546 Ga0097620_100148553
547 Ga0097620_100320895
548 Ga0097620_100486219
549 Ga0075435_100031960
550 Ga0075435_100063774
551 Ga0105240_10001556
552 Ga0105240_10029153
553 Ga0105240_10108895
554 Ga0105240_10166142
555 Ga0105240_10480282
556 Ga0111539_10000092
557 Ga0111539_10003682
558 Ga0111539_10109213
559 Ga0111539_10149043
560 Ga0111539_10347177
561 Ga0105245_10004700
562 Ga0105247_10077413
563 Ga0105243_10119378
564 Ga0105243_10144831
565 Ga0105243_10726985
566 Ga0105241_10001477
567 Ga0105241_10082693
568 Ga0105241_10145224
569 Ga0105242_10645277
570 Ga0105242_10711289
571 Ga0105248_10015338
572 Ga0105248_10100344
573 Ga0105237_10006863
574 Ga0105237_10020524
575 Ga0105237_10044973
576 Ga0105237_10609806
577 Ga0105238_10001372
578 Ga0105238_10005727
579 Ga0105238_10005911
580 Ga0105238_10124199
581 Ga0105238_10158270
582 Ga0105238_10484383
583 Ga0105249_10034044
584 Ga0105239_10019563
585 Ga0105239_10036036
586 Ga0105239_10520144
587 Ga0105239_10555566
588 Ga0157370_10205234
589 Ga0157369_10184805
590 Ga0157374_10149388
591 Ga0157374_10155343
592 Ga0157378_10026143
593 Ga0157378_10077327
594 Ga0157372_10001284
595 Ga0157372_10015993
596 Ga0157372_10239298
597 Ga0157375_10102478
598 Ga0157375_10454351
599 Ga0163163_10125220
600 Ga0163163_10195585
601 Ga0157380_10008661
602 Ga0213876_10149124
603 Ga0209148_1001511
604 Ga0209455_1000760
605 Ga0209564_1011186
606 Ga0207642_10026921
607 Ga0207642_10143760
608 Ga0207710_10333353
609 Ga0207680_10085182
610 Ga0207647_10017140
611 Ga0207699_10225992
612 Ga0207645_10014608
613 Ga0207705_10434836
614 Ga0207654_10002081
615 Ga0207654_10069381
616 Ga0207707_10042613
617 Ga0207695_10007678
618 Ga0207695_10016877
619 Ga0207695_10074174
620 Ga0207695_10341415
621 Ga0207671_10004223
622 Ga0207671_10024178
623 Ga0207671_10146618
624 Ga0207663_10038637
625 Ga0207657_10209598
626 Ga0207649_10159564
627 Ga0207652_10159866
628 Ga0207652_10254089
629 Ga0207681_10004867
630 Ga0207694_10009415
631 Ga0207694_10029255
632 Ga0207694_10153793
633 Ga0207659_10062053
634 Ga0207659_10140011
635 Ga0207687_10003671
636 Ga0207687_10239671
637 Ga0207687_10621291
638 Ga0207706_10148950
639 Ga0207706_10189360
640 Ga0207686_10116116
641 Ga0207709_10094508
642 Ga0207709_10161751
643 Ga0207709_10174735
644 Ga0207709_10430020
645 Ga0207670_10012898
646 Ga0207670_10019770
647 Ga0207670_10192961
648 Ga0207669_10001224
649 Ga0207704_10130894
650 Ga0207704_10319563
651 Ga0207691_10005250
652 Ga0207691_10720434
653 Ga0207711_10084487
654 Ga0207689_10068169
655 Ga0207689_10129166
656 Ga0207689_10176683
657 Ga0207661_10018191
658 Ga0207661_10047438
659 Ga0207661_10078940
660 Ga0207661_10510535
661 Ga0207667_10003610
662 Ga0207667_10208017
663 Ga0207651_10002764
664 Ga0207651_10034748
665 Ga0207651_10191213
666 Ga0207651_10333026
667 Ga0207651_10375156
668 Ga0207712_10019242
669 Ga0207668_10197785
670 Ga0207640_10332030
671 Ga0207640_10357938
672 Ga0207677_10224067
673 Ga0207703_10016234
674 Ga0207703_10049489
675 Ga0207639_10117469
676 Ga0207639_10169179
677 Ga0207639_10173965
678 Ga0207708_10000769
679 Ga0207702_10101230
680 Ga0207702_10378174
681 Ga0207641_10008301
682 Ga0207641_10241929
683 Ga0207648_10007063
684 Ga0207676_10843395
685 Ga0207674_10003537
686 Ga0207674_10071137
687 Ga0207675_100010276
688 Ga0207675_100357099
689 Ga0207683_10057921
690 Ga0207683_10060977
691 Ga0207683_10127717
692 Ga0207698_10009813
693 Ga0207698_10232762
694 Ga0209998_10015543
695 Ga0207428_10008948
696 Ga0207428_10049540
697 Ga0268264_10036381
698 Ga0268264_10097372
699 Ga0307515_10341621
700 Ga0265330_10106619
701 Ga0265325_10028585
702 Ga0265339_10003842
703 Ga0265316_10015329
704 Ga0307513_10133968
705 Ga0307509_10527075
706 Ga0307408_100101406
707 Ga0265314_10000001
708 Ga0265314_10142247
709 Ga0265342_10244766
710 Ga0307405_10656574
711 Ga0307410_10006112
712 Ga0307410_10036998
713 Ga0307406_10133269
714 Ga0307412_10053936
715 Ga0307416_100140974
716 Ga0307414_10063234
717 Ga0307411_10022907
718 Ga0307411_10028186
719 Ga0307411_10288628
720 Ga0373950_0024021
721 Ga0373934_0003923
722 Ga0373934_0145980
723 Ga0373940_0022330
724 Ga0373949_0000017
725 Ga0373951_0000658
726 Ga0373936_0102952
727 Ga0373953_0025744
728 Ga0373954_0086781
729 Ga0373956_0026530
730 Ga0373943_0164269
731 Ga0373943_0167187
732 Ga0373946_0052888
733 Ga0373946_0076353
734 Ga0373955_0062788
735 Ga0373961_0000139
736 Ga0373962_0062322
737 Ga0373931_0019539
738 Ga0373927_0336578
739 Ga0373933_0001203
740 Ga0373933_0384396
741 Ga0373947_0061577
742 Ga0373947_0134141
743 Ga0373937_0002329
744 Ga0373937_0072075
745 Ga0373937_0140541
746 Ga0373937_0426787
747 Ga0373925_0009124
748 Ga0373925_0499996
749 Ga0436365_0158450
750 Ga0451577_0686702
751 Ga0453683_0139080
752 Ga0453684_0657189
753 Ga0495580_0065254
754 Ga0495582_0004984
755 Ga0495664_0002820
756 Ga0495664_0347160
757 Ga0495618_0146188
758 Ga0495628_0267097
759 Ga0495630_0004147
760 Ga0495586_0003143
761 Ga0495586_0100354
762 Ga0495634_0000584
763 Ga0495658_0248866
764 Ga0495674_0015785
765 Ga0495674_0220454
766 Ga0495680_0345005
767 Ga0495684_0012239
768 Ga0495684_0485024
769 Ga0495686_0041369
770 Ga0496100_0059659
771 Ga0496100_0162416
772 Ga0496101_0005297
773 Ga0496101_0058343
774 Ga0496101_0303940
775 Ga0496102_0024613
776 Ga0496102_0180890
777 Ga0496104_0003557
778 Ga0496104_0108796
779 Ga0496106_0107964
780 Ga0496106_0136650
781 Ga0496106_0293105
782 Ga0496107_0097554
783 Ga0496108_0000820
784 Ga0496108_0006593
785 Ga0496108_0123444
786 Ga0496109_0002317
787 Ga0496109_0002692
788 Ga0496109_0078968
789 Ga0496110_0005572
790 Ga0496110_0026198
791 Ga0496112_0215588
792 Ga0496113_0000153
793 Ga0496113_0144038
794 Ga0496114_0000646
795 Ga0496115_0090762
796 Ga0501034_0031518
797 Ga0501034_0107680
798 Ga0501038_0440544
799 Ga0501042_0263176
800 Ga0501043_0020775
801 Ga0501046_0114346
802 Ga0501046_0297782
803 Ga0501047_0003323
804 Ga0501047_0011314
805 Ga0501047_0035786
806 Ga0501067_0001182
807 Ga0501067_0004284
808 Ga0501067_0018504
809 Ga0501067_0140283
810 Ga0501068_0000394
811 Ga0501068_0101949
812 Ga0501068_0101950
813 Ga0501069_0000211
814 Ga0501069_0000810
815 Ga0501069_0043693
816 Ga0501070_0002969
817 Ga0501070_0025932
818 Ga0501070_0074344
819 Ga0501070_0082073
820 Ga0501070_0196762
821 Ga0501070_0268171
822 Ga0501070_0324458
823 Ga0501071_0028613
824 Ga0501071_0036151
825 Ga0501071_0036682
826 Ga0501072_0000016
827 Ga0501072_0060180
828 Ga0501073_0004660
829 Ga0501073_0012647
830 Ga0501073_0025056
831 Ga0501073_0056734
832 Ga0501073_0060702
833 Ga0501074_0003292
834 Ga0501074_0012423
835 Ga0501074_0216920
836 Ga0501074_0411006
837 Ga0501075_0010780
838 Ga0501076_0025945
839 Ga0501076_0034243
840 Ga0501077_0001049
841 Ga0501077_0001542
842 Ga0501079_0005386
843 Ga0501079_0036108
844 Ga0501080_0013898
845 Ga0501080_0213004
846 Ga0501080_0276463
847 Ga0501081_0049056
848 Ga0501081_0577460
849 Ga0501083_0005162
850 Ga0501083_0034431
851 Ga0501044_0002394
852 Ga0501044_0124743
853 Ga0501045_0077926
854 nmdc:mga09592_145705_c1
855 nmdc:mga09592_35262_c1
856 nmdc:mga09592_36726_c1
857 nmdc:mga0qj67_62235_c1
858 nmdc:mga06r32_71402_c1
859 nmdc:mga06r32_807326_c1
860 nmdc:mga06r32_878350_c1
861 nmdc:mga08y16_166166_c1
862 nmdc:mga08y16_16722_c1
863 nmdc:mga08y16_5465_c1
864 nmdc:mga0n895_11332_c1
865 nmdc:mga0n895_726668_c1
866 nmdc:mga0rr50_121494_c1
867 nmdc:mga0rr50_323794_c1
868 nmdc:mga08x19_107257_c1
869 nmdc:mga0a205_428957_c1
870 nmdc:mga0a205_455792_c1
871 nmdc:mga0a205_825627_c1
872 Ga0495601_0388545
873 Ga0501084_0000028
874 Ga0501084_0454027
875 Ga0501084_0536340
876 Ga0501082_0000787
877 Ga0501082_0028304
878 Ga0501082_0065414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

27

136

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

171

247

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zy2-assembly1.cif.gz_A crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.9882 1 119
1zy2-assembly1.cif.gz_B crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.9861 1 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9781 1 118
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9759 1 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9756 1 118
ID Description Score Start End Superfamily
1zy2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9882 1 119 3.40.50.2300
1zy2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9861 1 120 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9723 1 80 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9676 1 80 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9673 2 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7R8QGJ1-F1-model_v4 Uncultured bacterium genome assembly Metasoil_fosmids_resub 0.9207 2 225 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7R8QGJ1-F1-model_v4 Uncultured bacterium genome assembly Metasoil_fosmids_resub 0.913 2 225 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0G9LAY5-F1-model_v4 Stage 0 sporulation protein A homolog 0.8728 2 225 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0G9LAY5-F1-model_v4 Stage 0 sporulation protein A homolog 0.8621 2 225 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A259SR80-F1-model_v4 DNA-binding response regulator 0.8105 1 225 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map