metagRoot

F444220

General Info

Members	Datasets	Scaffolds	Average Seq Length
439	242	429	136

Family's Representative Sequence

Representative Sequence	3300025981\|Ga0207640_10775343\|Ga0207640_107753431
Length	138
Sequence	MRKIALTALVLAAGSLAACSTLGSVRSRQRPDEFAVQREAPLVVPPDFQLVPPAAGAPKPTEGTAAEQALQALFGGTAPRSQVETTTLRRAGTPEIGIRSTVGDPGTYSVDKGTATQAIVQAPEGDGQAARAAIPTQG

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2510917021	Novosphingobium sp. AP12	Isolate	Rhizosphere
3	2643221588	Altererythrobacter sp. Root672	Isolate	Unclassified
4	2818991438	Novosphingobium barchaimii 1192	Isolate	Unclassified
5	2848297114	Croceibacterium ferulae EGI 63111	Isolate	Unclassified
6	2882806704	Pelagerythrobacter rhizovicinus AY-3R	Isolate	Rhizosphere
7	2895880812	Frankia sp. BMG5.11	Isolate	Unclassified
8	2896184354	Aurantiacibacter suaedae GH3-15	Isolate	Rhizosphere
9	2896253425	Aurantiacibacter rhizosphaerae GH3-10	Isolate	Rhizosphere
10	3000865235	Altericroceibacterium indicum DSM 18604	Isolate	Rhizosphere
11	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
12	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
13	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
14	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
15	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
16	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
17	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
18	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
19	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
20	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
21	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
22	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
23	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
26	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
30	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
33	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
34	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
35	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
36	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
37	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
38	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
39	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
40	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
41	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
42	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
43	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
44	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
45	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
46	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
47	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
48	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
49	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
50	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
51	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
52	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
53	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
54	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
55	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
56	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
57	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
59	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
60	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
61	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
62	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
64	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
65	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
66	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
67	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
68	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
69	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
70	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
71	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
72	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
73	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
74	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
75	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
76	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
77	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
78	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
79	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
80	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
81	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
120	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
128	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
129	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
130	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
131	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
132	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
133	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
134	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
135	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
136	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
137	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
138	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
139	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
140	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
141	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
142	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
143	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
144	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
145	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
146	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
147	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
148	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
149	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
150	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
151	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
152	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
153	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
154	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
155	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
156	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
157	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
158	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
159	3300042116	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792	Metagenome	Rhizosphere
160	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
161	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
162	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
163	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
164	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
165	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
166	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
167	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
168	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
169	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
170	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
171	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
172	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
173	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
174	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
175	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
176	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
177	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
178	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
179	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
180	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
181	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
182	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
183	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
184	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
185	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
186	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
187	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
188	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
189	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
190	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
191	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
192	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
193	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
194	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
195	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
196	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
197	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
198	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
199	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
200	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
201	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
202	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
203	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
204	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
205	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
206	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
207	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
208	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
209	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
210	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
211	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
212	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
213	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
220	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
221	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
222	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
225	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
226	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
227	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
228	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
229	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
230	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
231	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
232	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
233	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
234	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
235	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
236	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
237	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
238	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
239	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
240	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
241	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
242	8054302542	Novosphingobium kaempferiae Sx8-5	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.72
Metatranscriptomes	0
Isolates	2.28

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.66
Nodule	0.46
Rhizoplane	5.47
Rhizosphere	76.08
Stem	0
Stem Tuber	0
Unclassified	9.34

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1716107	2162886007	Bacteria	2491
2	SwRhRL2b_contig_542131	2162886007	Bacteria	8298
3	JGI24751J29686_10000127	3300002459	Bacteria	38458
4	Ga0065704_10000306	3300005289	Bacteria	41833
5	Ga0065704_10004303	3300005289	Bacteria	3972
6	Ga0065707_10098416	3300005295	Bacteria	3087
7	Ga0070658_10000042	3300005327	Bacteria	132351
8	Ga0070658_10024280	3300005327	Bacteria	4864
9	Ga0070658_10038390	3300005327	Bacteria	3862
10	Ga0070683_100201017	3300005329	Bacteria	1892
11	Ga0070683_100422006	3300005329	Bacteria	1272
12	Ga0070690_100018258	3300005330	Bacteria	4234
13	Ga0070670_100025908	3300005331	Bacteria	5045
14	Ga0070666_10077777	3300005335	Bacteria	2264
15	Ga0070666_10174103	3300005335	Bacteria	1508
16	Ga0070666_10344444	3300005335	Bacteria	1065
17	Ga0070682_100124141	3300005337	Bacteria	1738
18	Ga0070660_100035277	3300005339	Bacteria	3785
19	Ga0070689_100449469	3300005340	Bacteria	1096
20	Ga0070668_100031375	3300005347	Bacteria	4043
21	Ga0070668_100114203	3300005347	Bacteria	2152
22	Ga0070668_100281334	3300005347	Bacteria	1389
23	Ga0070668_101443876	3300005347	Bacteria	628
24	Ga0070669_100000052	3300005353	Bacteria	114467
25	Ga0070669_100000683	3300005353	Bacteria	24831
26	Ga0070675_100761415	3300005354	Bacteria	884
27	Ga0070671_100000005	3300005355	Bacteria	256547
28	Ga0070671_100005733	3300005355	Bacteria	9888
29	Ga0070671_100086556	3300005355	Bacteria	2622
30	Ga0070688_100542346	3300005365	Bacteria	883
31	Ga0070659_100569659	3300005366	Bacteria	971
32	Ga0070667_100000269	3300005367	Bacteria	59045
33	Ga0070667_100081868	3300005367	Bacteria	2763
34	Ga0070667_100145166	3300005367	Bacteria	2080
35	Ga0070667_100764082	3300005367	Bacteria	896
36	Ga0070667_100915608	3300005367	Bacteria	816
37	Ga0070701_10202866	3300005438	Bacteria	1173
38	Ga0070700_100841466	3300005441	Bacteria	742
39	Ga0070663_101051911	3300005455	Bacteria	710
40	Ga0070663_101348079	3300005455	Unclassified	631
41	Ga0070679_100030820	3300005530	Bacteria	5298
42	Ga0070679_100076095	3300005530	Bacteria	3346
43	Ga0070679_100309164	3300005530	Bacteria	1531
44	Ga0068853_100232054	3300005539	Bacteria	1688
45	Ga0070686_100170021	3300005544	Bacteria	1541
46	Ga0070665_100000101	3300005548	Bacteria	159353
47	Ga0070665_100433518	3300005548	Bacteria	1323
48	Ga0070665_100747139	3300005548	Bacteria	991
49	Ga0068855_100006176	3300005563	Bacteria	14605
50	Ga0068855_100120030	3300005563	Bacteria	3009
51	Ga0068855_101287928	3300005563	Bacteria	757
52	Ga0068854_100002009	3300005578	Bacteria	12462
53	Ga0068854_100230631	3300005578	Bacteria	1469
54	Ga0068854_100818626	3300005578	Bacteria	813
55	Ga0068854_101198363	3300005578	Bacteria	680
56	Ga0068854_101647122	3300005578	Bacteria	586
57	Ga0068854_101977668	3300005578	Bacteria	537
58	Ga0068856_100924587	3300005614	Bacteria	891
59	Ga0068856_101304435	3300005614	Bacteria	741
60	Ga0070702_100907444	3300005615	Bacteria	690
61	Ga0068852_100009379	3300005616	Bacteria	7266
62	Ga0068852_100229235	3300005616	Bacteria	1770
63	Ga0068852_100250730	3300005616	Bacteria	1696
64	Ga0068852_100337076	3300005616	Bacteria	1469
65	Ga0068852_100553176	3300005616	Bacteria	1151
66	Ga0068852_100595228	3300005616	Bacteria	1110
67	Ga0068852_100862289	3300005616	Bacteria	921
68	Ga0068859_100095472	3300005617	Bacteria	3026
69	Ga0068859_101124894	3300005617	Bacteria	864
70	Ga0068864_100065288	3300005618	Bacteria	3158
71	Ga0068864_100154224	3300005618	Bacteria	2083
72	Ga0068861_100695994	3300005719	Bacteria	944
73	Ga0068851_10415547	3300005834	Bacteria	794
74	Ga0068863_100012805	3300005841	Bacteria	8089
75	Ga0068863_100015637	3300005841	Bacteria	7288
76	Ga0068863_102284045	3300005841	Bacteria	551
77	Ga0068858_100010153	3300005842	Bacteria	8937
78	Ga0068858_100070680	3300005842	Bacteria	3235
79	Ga0068860_100027880	3300005843	Bacteria	5438
80	Ga0068860_100054966	3300005843	Bacteria	3784
81	Ga0068860_100288861	3300005843	Bacteria	1604
82	Ga0068862_100004829	3300005844	Bacteria	11353
83	Ga0068862_100031769	3300005844	Bacteria	4459
84	Ga0068862_100343253	3300005844	Bacteria	1383
85	Ga0075368_10001607	3300006042	Bacteria	7258
86	Ga0075364_10017713	3300006051	Bacteria	4454
87	Ga0075364_10068534	3300006051	Bacteria	2333
88	Ga0075432_10005404	3300006058	Bacteria	4354
89	Ga0075432_10287629	3300006058	Bacteria	678
90	Ga0075362_10019328	3300006177	Bacteria	2831
91	Ga0075362_10026488	3300006177	Bacteria	2477
92	Ga0075369_10008410	3300006186	Bacteria	3968
93	Ga0075366_10380870	3300006195	Bacteria	867
94	Ga0075366_10827916	3300006195	Bacteria	576
95	Ga0075370_10036269	3300006353	Bacteria	2769
96	Ga0075436_100521733	3300006914	Bacteria	870
97	Ga0097620_100095471	3300006931	Bacteria	3026
98	Ga0097620_101125064	3300006931	Bacteria	864
99	Ga0079104_1024259	3300006946	Bacteria	1599
100	Ga0105251_10004722	3300009011	Bacteria	9140
101	Ga0105250_10042157	3300009092	Bacteria	1829
102	Ga0105240_10025230	3300009093	Bacteria	7817
103	Ga0105240_10426909	3300009093	Bacteria	1488
104	Ga0111539_11414184	3300009094	Bacteria	807
105	Ga0105247_10452599	3300009101	Bacteria	926
106	Ga0105247_11245576	3300009101	Bacteria	595
107	Ga0105241_11432228	3300009174	Bacteria	663
108	Ga0105248_10018135	3300009177	Bacteria	7772
109	Ga0105248_10038522	3300009177	Bacteria	5350
110	Ga0105248_10085037	3300009177	Bacteria	3560
111	Ga0105238_10231786	3300009551	Bacteria	1823
112	Ga0105238_10332519	3300009551	Bacteria	1506
113	Ga0105249_10051928	3300009553	Bacteria	3742
114	Ga0105249_12702151	3300009553	Bacteria	568
115	Ga0105239_11573586	3300010375	Bacteria	760
116	Ga0157327_1045488	3300012512	Bacteria	606
117	Ga0157371_10036713	3300013102	Bacteria	3509
118	Ga0157371_10210951	3300013102	Bacteria	1393
119	Ga0157370_10692496	3300013104	Bacteria	930
120	Ga0163162_10260017	3300013306	Bacteria	1868
121	Ga0163162_10431161	3300013306	Bacteria	1450
122	Ga0157372_10683332	3300013307	Bacteria	1195
123	Ga0157372_11407955	3300013307	Unclassified	804
124	Ga0163163_10571383	3300014325	Bacteria	1194
125	Ga0163163_10903838	3300014325	Bacteria	946
126	Ga0163163_13015113	3300014325	Bacteria	525
127	Ga0157380_10245141	3300014326	Bacteria	1618
128	Ga0157380_10432664	3300014326	Bacteria	1258
129	Ga0157380_11260882	3300014326	Bacteria	785
130	Ga0182008_10452291	3300014497	Bacteria	698
131	Ga0157377_10760177	3300014745	Bacteria	710
132	Ga0157379_10537270	3300014968	Bacteria	1087
133	Ga0163161_10002236	3300017792	Bacteria	13927
134	Ga0209050_1000267	3300025298	Bacteria	111656
135	Ga0207697_10094768	3300025315	Bacteria	1267
136	Ga0207656_10221372	3300025321	Bacteria	920
137	Ga0207713_1002683	3300025735	Bacteria	12726
138	Ga0207682_10224246	3300025893	Bacteria	870
139	Ga0207680_10178275	3300025903	Bacteria	1435
140	Ga0207680_10179116	3300025903	Bacteria	1432
141	Ga0207680_10393407	3300025903	Bacteria	979
142	Ga0207647_10013869	3300025904	Bacteria	5579
143	Ga0207705_10000007	3300025909	Bacteria	597387
144	Ga0207705_10003496	3300025909	Bacteria	11958
145	Ga0207705_10010082	3300025909	Bacteria	6878
146	Ga0207705_10397304	3300025909	Bacteria	1066
147	Ga0207654_10289513	3300025911	Bacteria	1110
148	Ga0207695_10401136	3300025913	Bacteria	1256
149	Ga0207657_10017323	3300025919	Bacteria	6912
150	Ga0207649_10321115	3300025920	Bacteria	1138
151	Ga0207652_10001463	3300025921	Bacteria	20896
152	Ga0207652_10061782	3300025921	Bacteria	3236
153	Ga0207652_10156773	3300025921	Bacteria	2040
154	Ga0207652_10202190	3300025921	Bacteria	1788
155	Ga0207652_11452762	3300025921	Bacteria	589
156	Ga0207681_10000186	3300025923	Bacteria	50375
157	Ga0207681_10000538	3300025923	Bacteria	26143
158	Ga0207681_10357999	3300025923	Bacteria	1170
159	Ga0207694_10156099	3300025924	Bacteria	1841
160	Ga0207650_10291249	3300025925	Bacteria	1331
161	Ga0207650_11636716	3300025925	Bacteria	546
162	Ga0207644_10000008	3300025931	Bacteria	354219
163	Ga0207644_10000780	3300025931	Bacteria	20214
164	Ga0207644_10125586	3300025931	Bacteria	1958
165	Ga0207690_10148258	3300025932	Bacteria	1737
166	Ga0207670_10239625	3300025936	Bacteria	1397
167	Ga0207691_10667733	3300025940	Bacteria	877
168	Ga0207711_10009742	3300025941	Bacteria	7992
169	Ga0207711_10140637	3300025941	Bacteria	2171
170	Ga0207711_10151917	3300025941	Bacteria	2090
171	Ga0207711_10177906	3300025941	Bacteria	1933
172	Ga0207661_10879040	3300025944	Bacteria	825
173	Ga0207661_12112571	3300025944	Bacteria	509
174	Ga0207667_10012387	3300025949	Bacteria	9828
175	Ga0207667_10025431	3300025949	Bacteria	6479
176	Ga0207667_10949141	3300025949	Bacteria	850
177	Ga0207667_11525821	3300025949	Bacteria	638
178	Ga0207712_10100454	3300025961	Bacteria	2149
179	Ga0207712_10499646	3300025961	Bacteria	1039
180	Ga0207668_10029571	3300025972	Bacteria	3592
181	Ga0207668_10138124	3300025972	Bacteria	1870
182	Ga0207640_10001323	3300025981	Bacteria	13441
183	Ga0207640_10372430	3300025981	Bacteria	1154
184	Ga0207640_10775343	3300025981	Bacteria	829
185	Ga0207640_10848979	3300025981	Bacteria	794
186	Ga0207658_10004690	3300025986	Bacteria	9471
187	Ga0207658_10008452	3300025986	Bacteria	7006
188	Ga0207658_10613095	3300025986	Bacteria	978
189	Ga0207703_10116601	3300026035	Bacteria	2287
190	Ga0207703_10142038	3300026035	Bacteria	2084
191	Ga0207703_10847034	3300026035	Bacteria	874
192	Ga0207639_10152455	3300026041	Bacteria	1937
193	Ga0207639_10585562	3300026041	Bacteria	1027
194	Ga0207639_11457509	3300026041	Bacteria	642
195	Ga0207678_10056028	3300026067	Bacteria	3395
196	Ga0207678_10431450	3300026067	Bacteria	1144
197	Ga0207708_10414492	3300026075	Bacteria	1116
198	Ga0207702_11023498	3300026078	Bacteria	819
199	Ga0207702_11823228	3300026078	Bacteria	600
200	Ga0207641_10031784	3300026088	Bacteria	4379
201	Ga0207641_10052714	3300026088	Bacteria	3446
202	Ga0207641_10161772	3300026088	Bacteria	2036
203	Ga0207648_12216375	3300026089	Bacteria	510
204	Ga0207676_10081332	3300026095	Bacteria	2632
205	Ga0207676_10123425	3300026095	Bacteria	2188
206	Ga0207676_11138549	3300026095	Bacteria	772
207	Ga0207674_10069437	3300026116	Bacteria	3544
208	Ga0207675_100357290	3300026118	Bacteria	1433
209	Ga0207683_10513499	3300026121	Bacteria	1107
210	Ga0207698_10007950	3300026142	Bacteria	6683
211	Ga0207698_10043977	3300026142	Bacteria	3351
212	Ga0207698_10195657	3300026142	Bacteria	1806
213	Ga0207698_10215548	3300026142	Bacteria	1731
214	Ga0207698_10454562	3300026142	Bacteria	1237
215	Ga0207698_10664391	3300026142	Bacteria	1034
216	Ga0207698_10676986	3300026142	Bacteria	1024
217	Ga0209281_1053097	3300027111	Bacteria	641
218	Ga0209371_1018467	3300027312	Bacteria	1771
219	Ga0209983_1041179	3300027665	Bacteria	999
220	Ga0209983_1073211	3300027665	Bacteria	764
221	Ga0209971_1024982	3300027682	Bacteria	1427
222	Ga0209813_10000129	3300027866	Bacteria	27547
223	Ga0268266_10000314	3300028379	Bacteria	76554
224	Ga0268266_10622691	3300028379	Bacteria	1037
225	Ga0268265_10002448	3300028380	Bacteria	13979
226	Ga0268265_10018086	3300028380	Bacteria	4880
227	Ga0268265_10612087	3300028380	Bacteria	1042
228	Ga0268265_12673443	3300028380	Bacteria	504
229	Ga0268264_10023795	3300028381	Bacteria	4996
230	Ga0268264_10046186	3300028381	Bacteria	3617
231	Ga0268264_10059938	3300028381	Bacteria	3190
232	Ga0268264_10073459	3300028381	Bacteria	2903
233	Ga0268256_1020653	3300030500	Bacteria	1771
234	Ga0307408_100187173	3300031548	Bacteria	1665
235	Ga0307508_10056483	3300031616	Bacteria	3475
236	Ga0316576_10653886	3300031727	Bacteria	764
237	Ga0307405_10002815	3300031731	Bacteria	7810
238	Ga0316577_10607565	3300031733	Bacteria	622
239	Ga0307413_10134101	3300031824	Bacteria	1700
240	Ga0307413_10156416	3300031824	Bacteria	1595
241	Ga0307413_10216284	3300031824	Bacteria	1396
242	Ga0307413_10216926	3300031824	Bacteria	1394
243	Ga0307413_11334924	3300031824	Bacteria	629
244	Ga0307413_11784202	3300031824	Bacteria	550
245	Ga0307410_10630008	3300031852	Bacteria	897
246	Ga0307410_10728252	3300031852	Bacteria	838
247	Ga0307410_10950046	3300031852	Bacteria	739
248	Ga0307410_11051249	3300031852	Bacteria	704
249	Ga0307406_10273212	3300031901	Bacteria	1285
250	Ga0307407_10645986	3300031903	Bacteria	792
251	Ga0307412_10098132	3300031911	Bacteria	2065
252	Ga0307412_10180384	3300031911	Bacteria	1588
253	Ga0307412_10243421	3300031911	Bacteria	1392
254	Ga0307412_10572111	3300031911	Bacteria	952
255	Ga0307409_100591073	3300031995	Bacteria	1096
256	Ga0307416_100136674	3300032002	Bacteria	2219
257	Ga0307416_103339110	3300032002	Bacteria	537
258	Ga0307414_10429758	3300032004	Bacteria	1153
259	Ga0307414_10686965	3300032004	Bacteria	925
260	Ga0307414_10718135	3300032004	Bacteria	906
261	Ga0307414_11613312	3300032004	Bacteria	605
262	Ga0307411_10228777	3300032005	Bacteria	1448
263	Ga0307411_10264458	3300032005	Bacteria	1360
264	Ga0307411_10419953	3300032005	Bacteria	1111
265	Ga0307415_100853121	3300032126	Bacteria	836
266	Ga0307415_100948755	3300032126	Bacteria	796
267	Ga0316583_10054931	3300032133	Bacteria	1401
268	Ga0307510_10375650	3300033180	Bacteria	867
269	Ga0373956_0648979	3300035119	Bacteria	504
270	Ga0316582_0004083	3300036647	Bacteria	7301
271	Ga0316584_0034757	3300036712	Bacteria	3737
272	Ga0316584_0153368	3300036712	Bacteria	1714
273	Ga0316584_0283099	3300036712	Bacteria	1204
274	Ga0316581_0062983	3300037588	Bacteria	1138
275	Ga0436363_0548841	3300039450	Bacteria	1046
276	Ga0439436_0070698	3300041404	Bacteria	973
277	Ga0451833_1483160	3300041491	Bacteria	764
278	Ga0451837_1501992	3300041494	Bacteria	671
279	Ga0451845_0557996	3300041501	Bacteria	817
280	Ga0451847_0755914	3300041503	Bacteria	960
281	Ga0451843_0706346	3300041509	Bacteria	537
282	Ga0451853_2338010	3300041512	Bacteria	510
283	Ga0439431_0085719	3300041997	Bacteria	853
284	Ga0439462_0000063	3300042015	Bacteria	15632
285	Ga0450912_001314	3300042116	Bacteria	1488
286	Ga0450893_0089757	3300042532	Bacteria	616
287	Ga0451577_0433906	3300042876	Bacteria	1193
288	Ga0453684_0261002	3300044712	Bacteria	1984
289	Ga0453684_0811291	3300044712	Bacteria	1008
290	Ga0451576_0000024	3300045051	Bacteria	470499
291	Ga0451576_0476937	3300045051	Bacteria	1310
292	Ga0451576_1140979	3300045051	Bacteria	815
293	Ga0495627_000430	3300046453	Bacteria	36446
294	Ga0495638_0022366	3300046460	Bacteria	4151
295	Ga0495638_0114972	3300046460	Bacteria	1595
296	Ga0495638_0115587	3300046460	Bacteria	1590
297	Ga0495650_0000366	3300046471	Bacteria	79144
298	Ga0495596_0000247	3300046500	Bacteria	36077
299	Ga0495596_0000789	3300046500	Bacteria	19241
300	Ga0495607_0006439	3300046501	Bacteria	8267
301	Ga0495606_0073627	3300046507	Bacteria	2143
302	Ga0495606_0112612	3300046507	Bacteria	1639
303	Ga0495610_0000050	3300046512	Bacteria	143781
304	Ga0495610_0000418	3300046512	Bacteria	43639
305	Ga0495610_0002220	3300046512	Bacteria	16431
306	Ga0495620_0035137	3300046515	Bacteria	2257
307	Ga0495620_0248529	3300046515	Bacteria	678
308	Ga0495632_0000519	3300046519	Bacteria	36305
309	Ga0495632_0044684	3300046519	Bacteria	2210
310	Ga0495632_0284054	3300046519	Bacteria	736
311	Ga0495632_0391253	3300046519	Bacteria	608
312	Ga0495643_0000126	3300046522	Bacteria	123807
313	Ga0495643_0005029	3300046522	Bacteria	9056
314	Ga0495643_0028628	3300046522	Bacteria	3121
315	Ga0495643_0075824	3300046522	Bacteria	1759
316	Ga0495654_0047879	3300046530	Bacteria	2100
317	Ga0495654_0061311	3300046530	Bacteria	1806
318	Ga0495598_0009937	3300046537	Bacteria	2264
319	Ga0495609_0003234	3300046538	Bacteria	9446
320	Ga0495621_0095932	3300046539	Bacteria	1123
321	Ga0495621_0209494	3300046539	Bacteria	786
322	Ga0495633_0079539	3300046558	Bacteria	1526
323	Ga0495611_0304144	3300046648	Bacteria	735
324	Ga0495625_0012807	3300046660	Bacteria	6780
325	Ga0495671_0106502	3300046692	Bacteria	1369
326	Ga0495683_0181147	3300047323	Bacteria	962
327	Ga0495681_0000089	3300047470	Bacteria	79789
328	Ga0495686_0117497	3300047472	Bacteria	1589
329	Ga0495615_0000130	3300048090	Bacteria	18969
330	Ga0495626_0000255	3300048091	Bacteria	61151
331	Ga0496100_0047459	3300048903	Bacteria	2767
332	Ga0496101_0015609	3300048904	Bacteria	5123
333	Ga0496101_1352933	3300048904	Bacteria	556
334	Ga0496102_0094942	3300048905	Bacteria	2763
335	Ga0496103_0005350	3300048906	Bacteria	7694
336	Ga0496103_0289421	3300048906	Bacteria	1054
337	Ga0496104_0359844	3300048907	Bacteria	1367
338	Ga0496104_0503020	3300048907	Bacteria	1123
339	Ga0496105_0123344	3300048908	Bacteria	2135
340	Ga0496105_0688659	3300048908	Bacteria	786
341	Ga0496106_0001587	3300048909	Bacteria	17080
342	Ga0496106_0481019	3300048909	Bacteria	998
343	Ga0496107_0010606	3300048910	Bacteria	6406
344	Ga0496108_0048569	3300048911	Bacteria	3548
345	Ga0496108_0547853	3300048911	Bacteria	1009
346	Ga0496109_0162676	3300048912	Bacteria	2091
347	Ga0496110_0114047	3300048913	Bacteria	2431
348	Ga0496110_0239119	3300048913	Bacteria	1652
349	Ga0496111_0475805	3300048914	Bacteria	920
350	Ga0496112_0160649	3300048915	Bacteria	2213
351	Ga0496113_0006142	3300048916	Bacteria	7582
352	Ga0496113_0151744	3300048916	Bacteria	1828
353	Ga0496114_0513136	3300048917	Bacteria	1060
354	Ga0496115_0420908	3300048918	Bacteria	1082
355	Ga0496116_0000045	3300048919	Bacteria	324307
356	Ga0496116_0058344	3300048919	Bacteria	2517
357	Ga0496117_0075327	3300048920	Bacteria	2242
358	Ga0496117_0102607	3300048920	Bacteria	1805
359	Ga0496117_0118592	3300048920	Bacteria	1631
360	Ga0496118_0070010	3300048921	Bacteria	2536
361	Ga0496118_0088625	3300048921	Bacteria	2139
362	Ga0496118_0149650	3300048921	Bacteria	1463
363	Ga0496119_0060128	3300048922	Bacteria	2277
364	Ga0496121_0003762	3300048924	Bacteria	21233
365	Ga0496121_0005721	3300048924	Bacteria	15788
366	Ga0496121_0369143	3300048924	Bacteria	950
367	Ga0496122_0043146	3300048925	Bacteria	3537
368	Ga0496122_0102950	3300048925	Bacteria	1901
369	Ga0496123_0000830	3300048926	Bacteria	49505
370	Ga0496123_0005750	3300048926	Bacteria	12341
371	Ga0496123_0040936	3300048926	Bacteria	3219
372	Ga0496124_0005294	3300048927	Bacteria	14586
373	Ga0496124_0005731	3300048927	Bacteria	13836
374	Ga0496124_0052468	3300048927	Bacteria	3463
375	Ga0496124_0065337	3300048927	Bacteria	3034
376	Ga0496125_0003252	3300048928	Bacteria	20009
377	Ga0496125_0021112	3300048928	Bacteria	6085
378	Ga0496125_0170515	3300048928	Bacteria	1464
379	Ga0496125_0244626	3300048928	Bacteria	1136
380	Ga0496126_0000641	3300048929	Bacteria	65115
381	Ga0496126_0032141	3300048929	Bacteria	4948
382	Ga0496126_0102536	3300048929	Bacteria	2501
383	Ga0501033_0233291	3300049570	Bacteria	1307
384	Ga0501034_1027396	3300049571	Bacteria	707
385	Ga0501034_1059534	3300049571	Bacteria	693
386	Ga0501037_0330437	3300049573	Bacteria	1054
387	Ga0501042_0915196	3300049578	Bacteria	639
388	Ga0501043_0207017	3300049579	Bacteria	1521
389	Ga0501043_0260126	3300049579	Bacteria	1335
390	Ga0501047_0073372	3300049581	Bacteria	3295
391	Ga0501047_0164746	3300049581	Bacteria	2088
392	Ga0501047_0334099	3300049581	Bacteria	1354
393	Ga0501047_1252034	3300049581	Bacteria	556
394	Ga0501070_0780727	3300049586	Bacteria	751
395	Ga0501224_003042	3300049664	Bacteria	2321
396	Ga0501249_012986	3300049679	Bacteria	1766
397	Ga0501080_0288398	3300049742	Bacteria	1491
398	Ga0501044_0000250	3300049823	Bacteria	68405
399	Ga0501044_0132389	3300049823	Bacteria	2487
400	Ga0501044_0142391	3300049823	Bacteria	2386
401	Ga0501044_0573303	3300049823	Bacteria	1024
402	nmdc:mga03683_12902_c1	3300050489	Bacteria	3062
403	nmdc:mga03683_877_c1	3300050489	Bacteria	8671
404	nmdc:mga03n38_146666_c1	3300050490	Bacteria	1184
405	nmdc:mga00v17_13081_c1	3300050491	Bacteria	4598
406	nmdc:mga00v17_13741_c1	3300050491	Bacteria	4500
407	nmdc:mga00v17_2528_c1	3300050491	Bacteria	9360
408	nmdc:mga0k408_28307_c1	3300050493	Bacteria	2508
409	nmdc:mga0k408_288977_c1	3300050493	Bacteria	979
410	nmdc:mga0k408_650158_c1	3300050493	Bacteria	620
411	nmdc:mga06z11_77_c1	3300050494	Bacteria	41112
412	nmdc:mga04h51_543_c1	3300050495	Bacteria	8978
413	nmdc:mga07m45_1351_c1	3300050496	Bacteria	10882
414	nmdc:mga07m45_17_c1	3300050496	Bacteria	140936
415	nmdc:mga07m45_358174_c1	3300050496	Bacteria	848
416	nmdc:mga07m45_64917_c1	3300050496	Bacteria	2072
417	nmdc:mga08y16_1462881_c1	3300050511	Bacteria	645
418	nmdc:mga0sz30_7029_c2	3300050516	Bacteria	3067
419	nmdc:mga0sz30_73_c1	3300050516	Bacteria	38998
420	Ga0500643_000005	3300053087	Bacteria	539775
421	Ga0500643_011149	3300053087	Bacteria	3297
422	Ga0500644_0264180	3300053088	Bacteria	729
423	Ga0500641_0043501	3300053096	Bacteria	1823
424	Ga0500595_060051	3300053119	Bacteria	1151
425	Ga0500607_001228	3300053121	Bacteria	23562
426	Ga0500652_307727	3300053131	Bacteria	611
427	Ga0500588_0007610	3300053146	Bacteria	2503
428	Ga0500622_0001171	3300053156	Bacteria	21707
429	Ga0500645_018374	3300053730	Bacteria	2184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300028380	Ga0268265_12673443	Ga0268265_126734431	118
2	3300053119	Ga0500595_060051	Ga0500595_060051_114_530	118
3	3300053156	Ga0500622_0001171	Ga0500622_0001171_12085_12501	118
4	3300046460	Ga0495638_0022366	Ga0495638_0022366_37_453	119
5	3300046515	Ga0495620_0248529	Ga0495620_0248529_13_429	119
6	3300046530	Ga0495654_0061311	Ga0495654_0061311_504_920	119
7	3300053087	Ga0500643_011149	Ga0500643_011149_2373_2789	119
8	3300053088	Ga0500644_0264180	Ga0500644_0264180_184_594	119
9	3300053131	Ga0500652_307727	Ga0500652_307727_115_537	119
10	3300053146	Ga0500588_0007610	Ga0500588_0007610_574_996	119
11	3300041512	Ga0451853_2338010	Ga0451853_2338010_45_476	120
12	3300005616	Ga0068852_100553176	Ga0068852_1005531762	121
13	3300005843	Ga0068860_100288861	Ga0068860_1002888612	121
14	3300006058	Ga0075432_10005404	Ga0075432_100054043	121
15	3300006914	Ga0075436_100521733	Ga0075436_1005217332	121
16	3300026142	Ga0207698_10664391	Ga0207698_106643912	121
17	3300028381	Ga0268264_10059938	Ga0268264_100599382	121
18	3300041494	Ga0451837_1501992	Ga0451837_1501992_276_641	121
19	3300046692	Ga0495671_0106502	Ga0495671_0106502_907_1329	121
20	3300050496	nmdc:mga07m45_64917_c1	nmdc:mga07m45_64917_c1_259_675	121
21	3300045051	Ga0451576_1140979	Ga0451576_1140979_431_799	122
22	3300046648	Ga0495611_0304144	Ga0495611_0304144_43_459	122
23	3300046460	Ga0495638_0115587	Ga0495638_0115587_695_1135	123
24	3300046500	Ga0495596_0000247	Ga0495596_0000247_10256_10696	123
25	3300046501	Ga0495607_0006439	Ga0495607_0006439_6740_7177	123
26	3300046507	Ga0495606_0073627	Ga0495606_0073627_679_1116	123
27	3300046519	Ga0495632_0044684	Ga0495632_0044684_264_704	123
28	3300046522	Ga0495643_0005029	Ga0495643_0005029_5065_5502	123
29	3300046522	Ga0495643_0028628	Ga0495643_0028628_2324_2764	123
30	3300046538	Ga0495609_0003234	Ga0495609_0003234_6005_6445	123
31	3300046660	Ga0495625_0012807	Ga0495625_0012807_3717_4157	123
32	3300046519	Ga0495632_0391253	Ga0495632_0391253_63_479	124
33	3300026118	Ga0207675_100357290	Ga0207675_1003572902	125
34	3300047472	Ga0495686_0117497	Ga0495686_0117497_759_1175	125
35	3300041509	Ga0451843_0706346	Ga0451843_0706346_75_491	127
36	iso_pu_bacteria	2848297114	2848298087	128
37	3300006051	Ga0075364_10017713	Ga0075364_100177133	129
38	3300006177	Ga0075362_10026488	Ga0075362_100264883	129
39	3300006186	Ga0075369_10008410	Ga0075369_100084103	129
40	3300050489	nmdc:mga03683_12902_c1	nmdc:mga03683_12902_c1_241_654	129
41	3300050491	nmdc:mga00v17_13741_c1	nmdc:mga00v17_13741_c1_2239_2652	129
42	3300050516	nmdc:mga0sz30_7029_c2	nmdc:mga0sz30_7029_c2_2273_2686	129
43	3300032133	Ga0316583_10054931	Ga0316583_100549312	130
44	3300036712	Ga0316584_0283099	Ga0316584_0283099_560_988	130
45	iso_pu_bacteria	2895880812	2895881160	130
46	iso_pu_bacteria	2896184354	2896186081	131
47	iso_pu_bacteria	2896253425	2896255919	131
48	iso_pu_bacteria	3000865235	3000868173	132
49	3300013104	Ga0157370_10692496	Ga0157370_106924961	133
50	3300031824	Ga0307413_10156416	Ga0307413_101564162	133
51	3300031852	Ga0307410_10728252	Ga0307410_107282521	133
52	3300031852	Ga0307410_10950046	Ga0307410_109500461	133
53	3300032005	Ga0307411_10419953	Ga0307411_104199531	133
54	iso_pu_bacteria	2643221588	2643951012	133
55	3300027665	Ga0209983_1073211	Ga0209983_10732112	134
56	iso_pu_bacteria	2818991438	2819551142	134
57	iso_pu_bacteria	2882806704	2882809370	134
58	iso_pu_bacteria	8054302542	8054303971	134
59	3300005354	Ga0070675_100761415	Ga0070675_1007614152	135
60	3300005438	Ga0070701_10202866	Ga0070701_102028661	135
61	3300005441	Ga0070700_100841466	Ga0070700_1008414661	135
62	3300005578	Ga0068854_100818626	Ga0068854_1008186261	135
63	3300005616	Ga0068852_100229235	Ga0068852_1002292353	135
64	3300006042	Ga0075368_10001607	Ga0075368_100016077	135
65	3300006177	Ga0075362_10019328	Ga0075362_100193283	135
66	3300006195	Ga0075366_10380870	Ga0075366_103808702	135
67	3300013102	Ga0157371_10036713	Ga0157371_100367133	135
68	3300025923	Ga0207681_10357999	Ga0207681_103579993	135
69	3300025981	Ga0207640_10775343	Ga0207640_107753431	135
70	3300025981	Ga0207640_10848979	Ga0207640_108489792	135
71	3300026075	Ga0207708_10414492	Ga0207708_104144922	135
72	3300027682	Ga0209971_1024982	Ga0209971_10249822	135
73	3300027866	Ga0209813_10000129	Ga0209813_1000012911	135
74	3300031733	Ga0316577_10607565	Ga0316577_106075652	135
75	3300031824	Ga0307413_11334924	Ga0307413_113349242	135
76	3300046537	Ga0495598_0009937	Ga0495598_0009937_1724_2131	135
77	3300046539	Ga0495621_0209494	Ga0495621_0209494_197_604	135
78	3300050489	nmdc:mga03683_877_c1	nmdc:mga03683_877_c1_6468_6875	135
79	3300050490	nmdc:mga03n38_146666_c1	nmdc:mga03n38_146666_c1_297_704	135
80	3300050491	nmdc:mga00v17_13081_c1	nmdc:mga00v17_13081_c1_852_1259	135
81	3300050491	nmdc:mga00v17_2528_c1	nmdc:mga00v17_2528_c1_3852_4259	135
82	3300050493	nmdc:mga0k408_288977_c1	nmdc:mga0k408_288977_c1_375_782	135
83	3300050494	nmdc:mga06z11_77_c1	nmdc:mga06z11_77_c1_11793_12200	135
84	3300050495	nmdc:mga04h51_543_c1	nmdc:mga04h51_543_c1_2464_2871	135
85	3300050496	nmdc:mga07m45_17_c1	nmdc:mga07m45_17_c1_50181_50588	135
86	3300050516	nmdc:mga0sz30_73_c1	nmdc:mga0sz30_73_c1_14413_14820	135
87	3300053121	Ga0500607_001228	Ga0500607_001228_20799_21206	135
88	3300053730	Ga0500645_018374	Ga0500645_018374_494_901	135
89	2162886007	SwRhRL2b_contig_542131	SwRhRL2b_0146.00004470	136
90	3300005289	Ga0065704_10000306	Ga0065704_1000030646	136
91	3300005295	Ga0065707_10098416	Ga0065707_100984162	136
92	3300005327	Ga0070658_10024280	Ga0070658_100242803	136
93	3300005327	Ga0070658_10038390	Ga0070658_100383903	136
94	3300005329	Ga0070683_100201017	Ga0070683_1002010172	136
95	3300005329	Ga0070683_100422006	Ga0070683_1004220063	136
96	3300005331	Ga0070670_100025908	Ga0070670_1000259085	136
97	3300005335	Ga0070666_10077777	Ga0070666_100777772	136
98	3300005337	Ga0070682_100124141	Ga0070682_1001241411	136
99	3300005339	Ga0070660_100035277	Ga0070660_1000352773	136
100	3300005347	Ga0070668_100281334	Ga0070668_1002813342	136
101	3300005347	Ga0070668_101443876	Ga0070668_1014438761	136
102	3300005353	Ga0070669_100000683	Ga0070669_10000068325	136
103	3300005355	Ga0070671_100005733	Ga0070671_1000057332	136
104	3300005355	Ga0070671_100086556	Ga0070671_1000865563	136
105	3300005365	Ga0070688_100542346	Ga0070688_1005423462	136
106	3300005366	Ga0070659_100569659	Ga0070659_1005696592	136
107	3300005367	Ga0070667_100000269	Ga0070667_10000026942	136
108	3300005367	Ga0070667_100145166	Ga0070667_1001451663	136
109	3300005367	Ga0070667_100764082	Ga0070667_1007640821	136
110	3300005455	Ga0070663_101051911	Ga0070663_1010519111	136
111	3300005455	Ga0070663_101348079	Ga0070663_1013480791	136
112	3300005530	Ga0070679_100030820	Ga0070679_1000308203	136
113	3300005530	Ga0070679_100309164	Ga0070679_1003091643	136
114	3300005548	Ga0070665_100000101	Ga0070665_10000010122	136
115	3300005548	Ga0070665_100747139	Ga0070665_1007471392	136
116	3300005563	Ga0068855_101287928	Ga0068855_1012879282	136
117	3300005578	Ga0068854_101198363	Ga0068854_1011983632	136
118	3300005578	Ga0068854_101647122	Ga0068854_1016471221	136
119	3300005578	Ga0068854_101977668	Ga0068854_1019776681	136
120	3300005614	Ga0068856_100924587	Ga0068856_1009245872	136
121	3300005616	Ga0068852_100862289	Ga0068852_1008622892	136
122	3300005617	Ga0068859_101124894	Ga0068859_1011248942	136
123	3300005719	Ga0068861_100695994	Ga0068861_1006959942	136
124	3300005834	Ga0068851_10415547	Ga0068851_104155472	136
125	3300005841	Ga0068863_100012805	Ga0068863_1000128059	136
126	3300005841	Ga0068863_100015637	Ga0068863_1000156375	136
127	3300005841	Ga0068863_102284045	Ga0068863_1022840451	136
128	3300005842	Ga0068858_100070680	Ga0068858_1000706803	136
129	3300005843	Ga0068860_100054966	Ga0068860_1000549664	136
130	3300005844	Ga0068862_100004829	Ga0068862_10000482911	136
131	3300005844	Ga0068862_100031769	Ga0068862_1000317694	136
132	3300006051	Ga0075364_10068534	Ga0075364_100685342	136
133	3300006058	Ga0075432_10287629	Ga0075432_102876291	136
134	3300006195	Ga0075366_10827916	Ga0075366_108279162	136
135	3300006353	Ga0075370_10036269	Ga0075370_100362692	136
136	3300006931	Ga0097620_101125064	Ga0097620_1011250642	136
137	3300006946	Ga0079104_1024259	Ga0079104_10242592	136
138	3300009011	Ga0105251_10004722	Ga0105251_100047223	136
139	3300009092	Ga0105250_10042157	Ga0105250_100421572	136
140	3300009094	Ga0111539_11414184	Ga0111539_114141842	136
141	3300009101	Ga0105247_10452599	Ga0105247_104525991	136
142	3300009177	Ga0105248_10018135	Ga0105248_100181353	136
143	3300009551	Ga0105238_10332519	Ga0105238_103325192	136
144	3300009553	Ga0105249_12702151	Ga0105249_127021511	136
145	3300012512	Ga0157327_1045488	Ga0157327_10454881	136
146	3300013102	Ga0157371_10210951	Ga0157371_102109512	136
147	3300013306	Ga0163162_10260017	Ga0163162_102600173	136
148	3300013307	Ga0157372_10683332	Ga0157372_106833322	136
149	3300014325	Ga0163163_10903838	Ga0163163_109038382	136
150	3300014325	Ga0163163_13015113	Ga0163163_130151131	136
151	3300014326	Ga0157380_10432664	Ga0157380_104326642	136
152	3300014326	Ga0157380_11260882	Ga0157380_112608822	136
153	3300014497	Ga0182008_10452291	Ga0182008_104522911	136
154	3300014745	Ga0157377_10760177	Ga0157377_107601772	136
155	3300017792	Ga0163161_10002236	Ga0163161_100022363	136
156	3300025298	Ga0209050_1000267	Ga0209050_100026781	136
157	3300025321	Ga0207656_10221372	Ga0207656_102213722	136
158	3300025735	Ga0207713_1002683	Ga0207713_10026832	136
159	3300025893	Ga0207682_10224246	Ga0207682_102242462	136
160	3300025903	Ga0207680_10178275	Ga0207680_101782752	136
161	3300025903	Ga0207680_10179116	Ga0207680_101791163	136
162	3300025909	Ga0207705_10003496	Ga0207705_100034963	136
163	3300025909	Ga0207705_10010082	Ga0207705_100100823	136
164	3300025919	Ga0207657_10017323	Ga0207657_100173237	136
165	3300025920	Ga0207649_10321115	Ga0207649_103211151	136
166	3300025921	Ga0207652_10061782	Ga0207652_100617823	136
167	3300025921	Ga0207652_10156773	Ga0207652_101567732	136
168	3300025921	Ga0207652_10202190	Ga0207652_102021903	136
169	3300025923	Ga0207681_10000186	Ga0207681_1000018635	136
170	3300025925	Ga0207650_10291249	Ga0207650_102912492	136
171	3300025931	Ga0207644_10000780	Ga0207644_100007809	136
172	3300025931	Ga0207644_10125586	Ga0207644_101255861	136
173	3300025932	Ga0207690_10148258	Ga0207690_101482583	136
174	3300025940	Ga0207691_10667733	Ga0207691_106677332	136
175	3300025941	Ga0207711_10009742	Ga0207711_100097423	136
176	3300025941	Ga0207711_10151917	Ga0207711_101519173	136
177	3300025944	Ga0207661_10879040	Ga0207661_108790401	136
178	3300025944	Ga0207661_12112571	Ga0207661_121125711	136
179	3300025949	Ga0207667_11525821	Ga0207667_115258212	136
180	3300025961	Ga0207712_10499646	Ga0207712_104996461	136
181	3300025986	Ga0207658_10004690	Ga0207658_100046906	136
182	3300025986	Ga0207658_10008452	Ga0207658_100084523	136
183	3300026035	Ga0207703_10142038	Ga0207703_101420381	136
184	3300026067	Ga0207678_10056028	Ga0207678_100560283	136
185	3300026067	Ga0207678_10431450	Ga0207678_104314501	136
186	3300026078	Ga0207702_11823228	Ga0207702_118232281	136
187	3300026088	Ga0207641_10031784	Ga0207641_100317843	136
188	3300026088	Ga0207641_10052714	Ga0207641_100527142	136
189	3300026089	Ga0207648_12216375	Ga0207648_122163751	136
190	3300026121	Ga0207683_10513499	Ga0207683_105134992	136
191	3300026142	Ga0207698_10454562	Ga0207698_104545622	136
192	3300027111	Ga0209281_1053097	Ga0209281_10530971	136
193	3300027312	Ga0209371_1018467	Ga0209371_10184672	136
194	3300028379	Ga0268266_10000314	Ga0268266_1000031438	136
195	3300028380	Ga0268265_10002448	Ga0268265_100024483	136
196	3300028380	Ga0268265_10018086	Ga0268265_100180863	136
197	3300028381	Ga0268264_10023795	Ga0268264_100237955	136
198	3300028381	Ga0268264_10046186	Ga0268264_100461864	136
199	3300030500	Ga0268256_1020653	Ga0268256_10206533	136
200	3300031548	Ga0307408_100187173	Ga0307408_1001871733	136
201	3300031616	Ga0307508_10056483	Ga0307508_100564833	136
202	3300031824	Ga0307413_10216284	Ga0307413_102162842	136
203	3300031824	Ga0307413_10216926	Ga0307413_102169262	136
204	3300031824	Ga0307413_11784202	Ga0307413_117842021	136
205	3300031852	Ga0307410_11051249	Ga0307410_110512492	136
206	3300031901	Ga0307406_10273212	Ga0307406_102732122	136
207	3300031903	Ga0307407_10645986	Ga0307407_106459862	136
208	3300031911	Ga0307412_10098132	Ga0307412_100981322	136
209	3300031911	Ga0307412_10572111	Ga0307412_105721112	136
210	3300031995	Ga0307409_100591073	Ga0307409_1005910732	136
211	3300032002	Ga0307416_100136674	Ga0307416_1001366742	136
212	3300032004	Ga0307414_10429758	Ga0307414_104297582	136
213	3300032004	Ga0307414_10718135	Ga0307414_107181352	136
214	3300032004	Ga0307414_11613312	Ga0307414_116133121	136
215	3300032005	Ga0307411_10264458	Ga0307411_102644582	136
216	3300032126	Ga0307415_100853121	Ga0307415_1008531211	136
217	3300032126	Ga0307415_100948755	Ga0307415_1009487552	136
218	3300033180	Ga0307510_10375650	Ga0307510_103756502	136
219	3300035119	Ga0373956_0648979	Ga0373956_0648979_27_437	136
220	3300036647	Ga0316582_0004083	Ga0316582_0004083_3890_4318	136
221	3300036712	Ga0316584_0034757	Ga0316584_0034757_1634_2044	136
222	3300036712	Ga0316584_0153368	Ga0316584_0153368_338_766	136
223	3300037588	Ga0316581_0062983	Ga0316581_0062983_169_597	136
224	3300039450	Ga0436363_0548841	Ga0436363_0548841_119_553	136
225	3300041404	Ga0439436_0070698	Ga0439436_0070698_511_921	136
226	3300041491	Ga0451833_1483160	Ga0451833_1483160_31_444	136
227	3300041501	Ga0451845_0557996	Ga0451845_0557996_334_750	136
228	3300041503	Ga0451847_0755914	Ga0451847_0755914_104_514	136
229	3300041997	Ga0439431_0085719	Ga0439431_0085719_57_467	136
230	3300042015	Ga0439462_0000063	Ga0439462_0000063_10883_11293	136
231	3300042532	Ga0450893_0089757	Ga0450893_0089757_133_543	136
232	3300042876	Ga0451577_0433906	Ga0451577_0433906_480_893	136
233	3300044712	Ga0453684_0261002	Ga0453684_0261002_857_1267	136
234	3300044712	Ga0453684_0811291	Ga0453684_0811291_163_576	136
235	3300045051	Ga0451576_0476937	Ga0451576_0476937_684_1094	136
236	3300046453	Ga0495627_000430	Ga0495627_000430_12931_13353	136
237	3300046460	Ga0495638_0114972	Ga0495638_0114972_1154_1564	136
238	3300046471	Ga0495650_0000366	Ga0495650_0000366_66409_66831	136
239	3300046500	Ga0495596_0000789	Ga0495596_0000789_8569_8985	136
240	3300046507	Ga0495606_0112612	Ga0495606_0112612_1128_1544	136
241	3300046512	Ga0495610_0000050	Ga0495610_0000050_72624_73046	136
242	3300046512	Ga0495610_0000418	Ga0495610_0000418_129_545	136
243	3300046512	Ga0495610_0002220	Ga0495610_0002220_5359_5775	136
244	3300046515	Ga0495620_0035137	Ga0495620_0035137_988_1410	136
245	3300046519	Ga0495632_0000519	Ga0495632_0000519_33073_33495	136
246	3300046519	Ga0495632_0284054	Ga0495632_0284054_157_573	136
247	3300046522	Ga0495643_0000126	Ga0495643_0000126_6756_7172	136
248	3300046522	Ga0495643_0075824	Ga0495643_0075824_1072_1488	136
249	3300046530	Ga0495654_0047879	Ga0495654_0047879_586_1008	136
250	3300046539	Ga0495621_0095932	Ga0495621_0095932_634_1044	136
251	3300046558	Ga0495633_0079539	Ga0495633_0079539_578_994	136
252	3300047323	Ga0495683_0181147	Ga0495683_0181147_27_449	136
253	3300047470	Ga0495681_0000089	Ga0495681_0000089_12980_13402	136
254	3300048090	Ga0495615_0000130	Ga0495615_0000130_182_625	136
255	3300048091	Ga0495626_0000255	Ga0495626_0000255_12864_13280	136
256	3300048904	Ga0496101_1352933	Ga0496101_1352933_16_429	136
257	3300048906	Ga0496103_0005350	Ga0496103_0005350_5347_5760	136
258	3300048906	Ga0496103_0289421	Ga0496103_0289421_39_458	136
259	3300048907	Ga0496104_0503020	Ga0496104_0503020_493_906	136
260	3300048917	Ga0496114_0513136	Ga0496114_0513136_452_862	136
261	3300048919	Ga0496116_0000045	Ga0496116_0000045_12564_12980	136
262	3300048919	Ga0496116_0058344	Ga0496116_0058344_1590_2003	136
263	3300048920	Ga0496117_0075327	Ga0496117_0075327_1437_1850	136
264	3300048920	Ga0496117_0102607	Ga0496117_0102607_1112_1531	136
265	3300048920	Ga0496117_0118592	Ga0496117_0118592_636_1052	136
266	3300048921	Ga0496118_0070010	Ga0496118_0070010_1000_1416	136
267	3300048921	Ga0496118_0088625	Ga0496118_0088625_942_1355	136
268	3300048921	Ga0496118_0149650	Ga0496118_0149650_1018_1437	136
269	3300048922	Ga0496119_0060128	Ga0496119_0060128_90_503	136
270	3300048924	Ga0496121_0003762	Ga0496121_0003762_12055_12471	136
271	3300048924	Ga0496121_0005721	Ga0496121_0005721_5431_5844	136
272	3300048925	Ga0496122_0043146	Ga0496122_0043146_2999_3442	136
273	3300048925	Ga0496122_0102950	Ga0496122_0102950_1322_1738	136
274	3300048926	Ga0496123_0000830	Ga0496123_0000830_187_630	136
275	3300048926	Ga0496123_0005750	Ga0496123_0005750_4340_4756	136
276	3300048926	Ga0496123_0040936	Ga0496123_0040936_1995_2408	136
277	3300048927	Ga0496124_0005294	Ga0496124_0005294_12491_12907	136
278	3300048927	Ga0496124_0005731	Ga0496124_0005731_12187_12603	136
279	3300048927	Ga0496124_0052468	Ga0496124_0052468_205_618	136
280	3300048927	Ga0496124_0065337	Ga0496124_0065337_89_532	136
281	3300048928	Ga0496125_0003252	Ga0496125_0003252_8320_8733	136
282	3300048928	Ga0496125_0021112	Ga0496125_0021112_3977_4393	136
283	3300048928	Ga0496125_0244626	Ga0496125_0244626_211_624	136
284	3300048929	Ga0496126_0000641	Ga0496126_0000641_42036_42452	136
285	3300048929	Ga0496126_0032141	Ga0496126_0032141_2028_2441	136
286	3300049570	Ga0501033_0233291	Ga0501033_0233291_781_1200	136
287	3300049571	Ga0501034_1059534	Ga0501034_1059534_236_646	136
288	3300049573	Ga0501037_0330437	Ga0501037_0330437_91_516	136
289	3300049579	Ga0501043_0207017	Ga0501043_0207017_579_1004	136
290	3300049581	Ga0501047_0073372	Ga0501047_0073372_745_1155	136
291	3300049581	Ga0501047_0164746	Ga0501047_0164746_545_964	136
292	3300049581	Ga0501047_0334099	Ga0501047_0334099_418_843	136
293	3300049581	Ga0501047_1252034	Ga0501047_1252034_131_541	136
294	3300049586	Ga0501070_0780727	Ga0501070_0780727_154_579	136
295	3300049664	Ga0501224_003042	Ga0501224_003042_1064_1477	136
296	3300049679	Ga0501249_012986	Ga0501249_012986_276_689	136
297	3300049742	Ga0501080_0288398	Ga0501080_0288398_250_660	136
298	3300049823	Ga0501044_0000250	Ga0501044_0000250_56785_57210	136
299	3300049823	Ga0501044_0132389	Ga0501044_0132389_339_779	136
300	3300049823	Ga0501044_0573303	Ga0501044_0573303_572_982	136
301	3300050493	nmdc:mga0k408_28307_c1	nmdc:mga0k408_28307_c1_808_1224	136
302	3300050493	nmdc:mga0k408_650158_c1	nmdc:mga0k408_650158_c1_171_581	136
303	3300050496	nmdc:mga07m45_1351_c1	nmdc:mga07m45_1351_c1_4476_4892	136
304	3300050496	nmdc:mga07m45_358174_c1	nmdc:mga07m45_358174_c1_364_786	136
305	3300050511	nmdc:mga08y16_1462881_c1	nmdc:mga08y16_1462881_c1_43_453	136
306	3300053087	Ga0500643_000005	Ga0500643_000005_412867_413277	136
307	3300053096	Ga0500641_0043501	Ga0500641_0043501_499_918	136
308	iso_pu_bacteria	2510917021	2511125900	136
309	2162886007	SwRhRL2b_contig_1716107	SwRhRL2b_0775.00000060	137
310	3300002459	JGI24751J29686_10000127	JGI24751J29686_1000012735	137
311	3300005289	Ga0065704_10004303	Ga0065704_100043033	137
312	3300005327	Ga0070658_10000042	Ga0070658_1000004233	137
313	3300005330	Ga0070690_100018258	Ga0070690_1000182584	137
314	3300005335	Ga0070666_10174103	Ga0070666_101741031	137
315	3300005335	Ga0070666_10344444	Ga0070666_103444441	137
316	3300005340	Ga0070689_100449469	Ga0070689_1004494692	137
317	3300005347	Ga0070668_100031375	Ga0070668_1000313753	137
318	3300005347	Ga0070668_100114203	Ga0070668_1001142031	137
319	3300005353	Ga0070669_100000052	Ga0070669_10000005255	137
320	3300005355	Ga0070671_100000005	Ga0070671_100000005187	137
321	3300005367	Ga0070667_100081868	Ga0070667_1000818682	137
322	3300005367	Ga0070667_100915608	Ga0070667_1009156081	137
323	3300005530	Ga0070679_100076095	Ga0070679_1000760953	137
324	3300005539	Ga0068853_100232054	Ga0068853_1002320542	137
325	3300005544	Ga0070686_100170021	Ga0070686_1001700212	137
326	3300005548	Ga0070665_100433518	Ga0070665_1004335182	137
327	3300005563	Ga0068855_100006176	Ga0068855_10000617614	137
328	3300005563	Ga0068855_100120030	Ga0068855_1001200303	137
329	3300005578	Ga0068854_100002009	Ga0068854_10000200910	137
330	3300005578	Ga0068854_100230631	Ga0068854_1002306311	137
331	3300005614	Ga0068856_101304435	Ga0068856_1013044352	137
332	3300005615	Ga0070702_100907444	Ga0070702_1009074441	137
333	3300005616	Ga0068852_100009379	Ga0068852_1000093797	137
334	3300005616	Ga0068852_100250730	Ga0068852_1002507303	137
335	3300005616	Ga0068852_100337076	Ga0068852_1003370762	137
336	3300005616	Ga0068852_100595228	Ga0068852_1005952282	137
337	3300005617	Ga0068859_100095472	Ga0068859_1000954723	137
338	3300005618	Ga0068864_100065288	Ga0068864_1000652883	137
339	3300005618	Ga0068864_100154224	Ga0068864_1001542242	137
340	3300005842	Ga0068858_100010153	Ga0068858_1000101533	137
341	3300005843	Ga0068860_100027880	Ga0068860_1000278803	137
342	3300005844	Ga0068862_100343253	Ga0068862_1003432533	137
343	3300006931	Ga0097620_100095471	Ga0097620_1000954713	137
344	3300009093	Ga0105240_10025230	Ga0105240_100252302	137
345	3300009093	Ga0105240_10426909	Ga0105240_104269092	137
346	3300009101	Ga0105247_11245576	Ga0105247_112455761	137
347	3300009174	Ga0105241_11432228	Ga0105241_114322282	137
348	3300009177	Ga0105248_10038522	Ga0105248_100385224	137
349	3300009177	Ga0105248_10085037	Ga0105248_100850373	137
350	3300009551	Ga0105238_10231786	Ga0105238_102317862	137
351	3300009553	Ga0105249_10051928	Ga0105249_100519283	137
352	3300010375	Ga0105239_11573586	Ga0105239_115735862	137
353	3300013306	Ga0163162_10431161	Ga0163162_104311612	137
354	3300013307	Ga0157372_11407955	Ga0157372_114079552	137
355	3300014325	Ga0163163_10571383	Ga0163163_105713832	137
356	3300014326	Ga0157380_10245141	Ga0157380_102451412	137
357	3300014968	Ga0157379_10537270	Ga0157379_105372702	137
358	3300025315	Ga0207697_10094768	Ga0207697_100947682	137
359	3300025903	Ga0207680_10393407	Ga0207680_103934071	137
360	3300025904	Ga0207647_10013869	Ga0207647_100138693	137
361	3300025909	Ga0207705_10000007	Ga0207705_10000007368	137
362	3300025909	Ga0207705_10397304	Ga0207705_103973042	137
363	3300025911	Ga0207654_10289513	Ga0207654_102895132	137
364	3300025913	Ga0207695_10401136	Ga0207695_104011362	137
365	3300025921	Ga0207652_10001463	Ga0207652_1000146324	137
366	3300025921	Ga0207652_11452762	Ga0207652_114527622	137
367	3300025923	Ga0207681_10000538	Ga0207681_1000053823	137
368	3300025924	Ga0207694_10156099	Ga0207694_101560993	137
369	3300025925	Ga0207650_11636716	Ga0207650_116367161	137
370	3300025931	Ga0207644_10000008	Ga0207644_10000008138	137
371	3300025936	Ga0207670_10239625	Ga0207670_102396252	137
372	3300025941	Ga0207711_10140637	Ga0207711_101406372	137
373	3300025941	Ga0207711_10177906	Ga0207711_101779063	137
374	3300025949	Ga0207667_10012387	Ga0207667_100123875	137
375	3300025949	Ga0207667_10025431	Ga0207667_100254313	137
376	3300025949	Ga0207667_10949141	Ga0207667_109491412	137
377	3300025961	Ga0207712_10100454	Ga0207712_101004543	137
378	3300025972	Ga0207668_10029571	Ga0207668_100295713	137
379	3300025972	Ga0207668_10138124	Ga0207668_101381243	137
380	3300025981	Ga0207640_10001323	Ga0207640_1000132310	137
381	3300025981	Ga0207640_10372430	Ga0207640_103724302	137
382	3300025986	Ga0207658_10613095	Ga0207658_106130952	137
383	3300026035	Ga0207703_10116601	Ga0207703_101166013	137
384	3300026035	Ga0207703_10847034	Ga0207703_108470341	137
385	3300026041	Ga0207639_10152455	Ga0207639_101524552	137
386	3300026041	Ga0207639_10585562	Ga0207639_105855622	137
387	3300026041	Ga0207639_11457509	Ga0207639_114575091	137
388	3300026078	Ga0207702_11023498	Ga0207702_110234982	137
389	3300026088	Ga0207641_10161772	Ga0207641_101617722	137
390	3300026095	Ga0207676_10081332	Ga0207676_100813323	137
391	3300026095	Ga0207676_10123425	Ga0207676_101234252	137
392	3300026095	Ga0207676_11138549	Ga0207676_111385491	137
393	3300026116	Ga0207674_10069437	Ga0207674_100694373	137
394	3300026142	Ga0207698_10007950	Ga0207698_100079503	137
395	3300026142	Ga0207698_10043977	Ga0207698_100439774	137
396	3300026142	Ga0207698_10195657	Ga0207698_101956572	137
397	3300026142	Ga0207698_10215548	Ga0207698_102155481	137
398	3300026142	Ga0207698_10676986	Ga0207698_106769862	137
399	3300027665	Ga0209983_1041179	Ga0209983_10411791	137
400	3300028379	Ga0268266_10622691	Ga0268266_106226912	137
401	3300028380	Ga0268265_10612087	Ga0268265_106120872	137
402	3300028381	Ga0268264_10073459	Ga0268264_100734593	137
403	3300031727	Ga0316576_10653886	Ga0316576_106538862	137
404	3300031731	Ga0307405_10002815	Ga0307405_100028155	137
405	3300031824	Ga0307413_10134101	Ga0307413_101341013	137
406	3300031852	Ga0307410_10630008	Ga0307410_106300082	137
407	3300031911	Ga0307412_10180384	Ga0307412_101803842	137
408	3300031911	Ga0307412_10243421	Ga0307412_102434211	137
409	3300032002	Ga0307416_103339110	Ga0307416_1033391101	137
410	3300032004	Ga0307414_10686965	Ga0307414_106869652	137
411	3300032005	Ga0307411_10228777	Ga0307411_102287772	137
412	3300042116	Ga0450912_001314	Ga0450912_001314_650_1063	137
413	3300045051	Ga0451576_0000024	Ga0451576_0000024_181948_182364	137
414	3300048903	Ga0496100_0047459	Ga0496100_0047459_213_626	137
415	3300048904	Ga0496101_0015609	Ga0496101_0015609_1536_1949	137
416	3300048905	Ga0496102_0094942	Ga0496102_0094942_1901_2314	137
417	3300048907	Ga0496104_0359844	Ga0496104_0359844_435_848	137
418	3300048908	Ga0496105_0123344	Ga0496105_0123344_567_980	137
419	3300048908	Ga0496105_0688659	Ga0496105_0688659_81_494	137
420	3300048909	Ga0496106_0001587	Ga0496106_0001587_1932_2345	137
421	3300048909	Ga0496106_0481019	Ga0496106_0481019_241_654	137
422	3300048910	Ga0496107_0010606	Ga0496107_0010606_1517_1930	137
423	3300048911	Ga0496108_0048569	Ga0496108_0048569_339_752	137
424	3300048911	Ga0496108_0547853	Ga0496108_0547853_21_434	137
425	3300048912	Ga0496109_0162676	Ga0496109_0162676_1215_1628	137
426	3300048913	Ga0496110_0114047	Ga0496110_0114047_1658_2071	137
427	3300048913	Ga0496110_0239119	Ga0496110_0239119_1218_1631	137
428	3300048914	Ga0496111_0475805	Ga0496111_0475805_218_631	137
429	3300048915	Ga0496112_0160649	Ga0496112_0160649_648_1061	137
430	3300048916	Ga0496113_0006142	Ga0496113_0006142_1187_1600	137
431	3300048916	Ga0496113_0151744	Ga0496113_0151744_272_685	137
432	3300048918	Ga0496115_0420908	Ga0496115_0420908_482_895	137
433	3300048924	Ga0496121_0369143	Ga0496121_0369143_451_864	137
434	3300048928	Ga0496125_0170515	Ga0496125_0170515_211_624	137
435	3300048929	Ga0496126_0102536	Ga0496126_0102536_579_992	137
436	3300049571	Ga0501034_1027396	Ga0501034_1027396_261_677	137
437	3300049578	Ga0501042_0915196	Ga0501042_0915196_45_461	137
438	3300049579	Ga0501043_0260126	Ga0501043_0260126_645_1058	137
439	3300049823	Ga0501044_0142391	Ga0501044_0142391_185_601	137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11233

DUF3035

Protein of unknown function (DUF3035)

20

134

0.81 Feature Viewer

pLDDT	pTM	Quality
63.23	0.18	Low

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F444220

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF11233

DUF3035

Protein of unknown function (DUF3035)

20

134

0.81

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map