F444162

General Info

Members Datasets Scaffolds Average Seq Length
439 153 878 142

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10000210|Ga0081539_1000021088
Length 156
Sequence MTGVNEGGFGGSGTGPPNSIGFEQFEVEADVGIRAWGPTREEAFAQAALGVLSLVADPASVSPRETREVRAQADGPETLLVAWIDECLYVHEIEAFVVSRVEVISCSDNVVLGRLHGEPLDATRHRLGTVVKAATLHGVSVQRREGYDEVQIVVDV

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
100 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
103 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 99.54
Stem 0
Stem Tuber 0
Unclassified 19.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10000210 3300005985 Bacteria 136405
2 Ga0070676_10359972 3300005328 Bacteria 1002
3 Ga0070690_101526217 3300005330 Unclassified 540
4 Ga0068869_100016967 3300005334 Bacteria 4924
5 Ga0070680_100041520 3300005336 Bacteria 3730
6 Ga0070689_100544552 3300005340 Unclassified 999
7 Ga0070691_10013405 3300005341 Bacteria 3754
8 Ga0070692_10034580 3300005345 Bacteria 2553
9 Ga0070669_100002190 3300005353 Bacteria 14145
10 Ga0070669_100186976 3300005353 Bacteria 1623
11 Ga0070671_101100011 3300005355 Unclassified 698
12 Ga0070674_101774618 3300005356 Bacteria 559
13 Ga0070703_10045862 3300005406 Bacteria 1380
14 Ga0070701_10000447 3300005438 Bacteria 14069
15 Ga0070705_100007621 3300005440 Bacteria 5336
16 Ga0070705_100011957 3300005440 Bacteria 4396
17 Ga0070705_100016316 3300005440 Bacteria 3858
18 Ga0070694_100108737 3300005444 Bacteria 1972
19 Ga0070694_100147147 3300005444 Bacteria 1717
20 Ga0070694_100239752 3300005444 Unclassified 1367
21 Ga0070708_100006399 3300005445 Bacteria 9373
22 Ga0070708_100057245 3300005445 Bacteria 3470
23 Ga0070708_100076331 3300005445 Bacteria 3026
24 Ga0070708_100132644 3300005445 Bacteria 2306
25 Ga0070708_100303118 3300005445 Bacteria 1504
26 Ga0070662_100024382 3300005457 Unclassified 4167
27 Ga0070681_10056303 3300005458 Bacteria 3914
28 Ga0068867_100053766 3300005459 Bacteria 2974
29 Ga0068867_100180716 3300005459 Bacteria 1677
30 Ga0068867_100589560 3300005459 Unclassified 968
31 Ga0070706_100086233 3300005467 Bacteria 2909
32 Ga0070706_100718896 3300005467 Unclassified 926
33 Ga0070707_100141693 3300005468 Bacteria 2339
34 Ga0070707_100982636 3300005468 Unclassified 809
35 Ga0070698_100415407 3300005471 Bacteria 1279
36 Ga0070698_100720646 3300005471 Bacteria 940
37 Ga0070699_100022319 3300005518 Bacteria 5455
38 Ga0070699_100056361 3300005518 Bacteria 3403
39 Ga0070699_100095839 3300005518 Bacteria 2598
40 Ga0070699_100222689 3300005518 Bacteria 1681
41 Ga0070697_100130063 3300005536 Bacteria 2111
42 Ga0070697_100324910 3300005536 Bacteria 1325
43 Ga0070697_100337304 3300005536 Bacteria 1300
44 Ga0070697_100397294 3300005536 Bacteria 1196
45 Ga0070672_100162042 3300005543 Bacteria 1856
46 Ga0070695_100009624 3300005545 Bacteria 5756
47 Ga0070695_100828421 3300005545 Bacteria 743
48 Ga0070696_100008971 3300005546 Bacteria 6693
49 Ga0070696_100063330 3300005546 Bacteria 2590
50 Ga0070696_100222706 3300005546 Bacteria 1416
51 Ga0070696_100437856 3300005546 Bacteria 1029
52 Ga0070696_101123738 3300005546 Bacteria 661
53 Ga0070693_100270920 3300005547 Bacteria 1133
54 Ga0070704_100011318 3300005549 Bacteria 5466
55 Ga0070704_100098123 3300005549 Bacteria 2200
56 Ga0070704_100176097 3300005549 Unclassified 1706
57 Ga0070704_100546876 3300005549 Bacteria 1011
58 Ga0068857_100121299 3300005577 Bacteria 2354
59 Ga0070702_100539589 3300005615 Bacteria 864
60 Ga0068859_100154129 3300005617 Bacteria 2374
61 Ga0068866_10048875 3300005718 Bacteria 2141
62 Ga0068861_100084090 3300005719 Bacteria 2498
63 Ga0068861_100774843 3300005719 Bacteria 898
64 Ga0068863_100226250 3300005841 Unclassified 1803
65 Ga0068860_100124015 3300005843 Bacteria 2476
66 Ga0068860_100180791 3300005843 Bacteria 2038
67 Ga0068860_100955376 3300005843 Unclassified 874
68 Ga0068862_100014446 3300005844 Bacteria 6552
69 Ga0068862_100233632 3300005844 Unclassified 1669
70 Ga0068862_100642002 3300005844 Bacteria 1023
71 Ga0081455_10039644 3300005937 Bacteria 4160
72 Ga0081455_10310176 3300005937 Bacteria 1128
73 Ga0081538_10019380 3300005981 Bacteria 5058
74 Ga0081540_1016722 3300005983 Bacteria 4573
75 Ga0070716_100192373 3300006173 Bacteria 1349
76 Ga0075428_100000684 3300006844 Bacteria 34864
77 Ga0075428_100007142 3300006844 Bacteria 12373
78 Ga0075428_100020957 3300006844 Bacteria 7240
79 Ga0075428_100021464 3300006844 Bacteria 7146
80 Ga0075428_100028948 3300006844 Bacteria 6130
81 Ga0075428_100071709 3300006844 Bacteria 3786
82 Ga0075428_100187727 3300006844 Bacteria 2236
83 Ga0075428_100352703 3300006844 Bacteria 1579
84 Ga0075428_101695329 3300006844 Unclassified 659
85 Ga0075430_100000064 3300006846 Bacteria 57146
86 Ga0075430_100001183 3300006846 Bacteria 20938
87 Ga0075430_100003618 3300006846 Bacteria 12966
88 Ga0075430_100039781 3300006846 Bacteria 3980
89 Ga0075430_100118251 3300006846 Bacteria 2209
90 Ga0075430_100153362 3300006846 Bacteria 1918
91 Ga0075431_100000125 3300006847 Bacteria 50843
92 Ga0075431_100000159 3300006847 Bacteria 46966
93 Ga0075431_100000418 3300006847 Bacteria 34609
94 Ga0075431_100008561 3300006847 Bacteria 10244
95 Ga0075431_100034633 3300006847 Bacteria 5202
96 Ga0075431_100073879 3300006847 Bacteria 3518
97 Ga0075431_100105403 3300006847 Bacteria 2909
98 Ga0075431_100416046 3300006847 Bacteria 1344
99 Ga0075431_100459279 3300006847 Unclassified 1268
100 Ga0075431_101297990 3300006847 Bacteria 689
101 Ga0075431_101388385 3300006847 Unclassified 662
102 Ga0075433_10000687 3300006852 Bacteria 23054
103 Ga0075433_10002988 3300006852 Bacteria 12984
104 Ga0075433_10009893 3300006852 Bacteria 7645
105 Ga0075433_10016041 3300006852 Bacteria 6163
106 Ga0075433_10021713 3300006852 Bacteria 5385
107 Ga0075433_10033495 3300006852 Bacteria 4405
108 Ga0075433_10074145 3300006852 Bacteria 2994
109 Ga0075433_10373072 3300006852 Unclassified 1260
110 Ga0075433_10701901 3300006852 Bacteria 886
111 Ga0075433_11476076 3300006852 Unclassified 587
112 Ga0075434_100006597 3300006871 Bacteria 10649
113 Ga0075434_100013016 3300006871 Bacteria 7900
114 Ga0075434_100020213 3300006871 Bacteria 6452
115 Ga0075434_100026008 3300006871 Bacteria 5730
116 Ga0075434_100029243 3300006871 Bacteria 5419
117 Ga0075434_100048800 3300006871 Bacteria 4201
118 Ga0075434_100076672 3300006871 Bacteria 3338
119 Ga0075434_100076882 3300006871 Bacteria 3333
120 Ga0075434_100104229 3300006871 Bacteria 2846
121 Ga0075434_100223401 3300006871 Unclassified 1903
122 Ga0075434_100230327 3300006871 Bacteria 1872
123 Ga0075434_100292318 3300006871 Unclassified 1649
124 Ga0075434_100676789 3300006871 Bacteria 1050
125 Ga0075434_101893367 3300006871 Bacteria 602
126 Ga0075429_100000503 3300006880 Bacteria 29455
127 Ga0075429_100002947 3300006880 Bacteria 14435
128 Ga0075429_100005228 3300006880 Bacteria 11165
129 Ga0075429_100005754 3300006880 Bacteria 10703
130 Ga0075429_100006445 3300006880 Bacteria 10165
131 Ga0075429_100039808 3300006880 Bacteria 4091
132 Ga0075429_100061094 3300006880 Bacteria 3282
133 Ga0075429_100103388 3300006880 Bacteria 2488
134 Ga0075429_100128322 3300006880 Bacteria 2218
135 Ga0075429_100175202 3300006880 Bacteria 1879
136 Ga0075429_100646821 3300006880 Bacteria 926
137 Ga0075429_100786478 3300006880 Unclassified 833
138 Ga0068865_100183938 3300006881 Bacteria 1611
139 Ga0075436_100000150 3300006914 Bacteria 43045
140 Ga0075436_100728808 3300006914 Bacteria 735
141 Ga0097620_100154136 3300006931 Bacteria 2374
142 Ga0075435_100012527 3300007076 Bacteria 6283
143 Ga0075435_100014092 3300007076 Bacteria 5964
144 Ga0075435_100017268 3300007076 Bacteria 5458
145 Ga0075435_100023765 3300007076 Bacteria 4747
146 Ga0075435_100132038 3300007076 Bacteria 2090
147 Ga0075435_100152483 3300007076 Unclassified 1944
148 Ga0075435_100187589 3300007076 Bacteria 1749
149 Ga0075435_100249184 3300007076 Unclassified 1512
150 Ga0099794_10012831 3300007265 Unclassified 3631
151 Ga0099794_10052402 3300007265 Bacteria 1967
152 Ga0099794_10288657 3300007265 Bacteria 849
153 Ga0099794_10695788 3300007265 Bacteria 541
154 Ga0111539_10008391 3300009094 Bacteria 13145
155 Ga0111539_10041798 3300009094 Bacteria 5509
156 Ga0111539_10122496 3300009094 Bacteria 3047
157 Ga0114129_10000003 3300009147 Bacteria 183186
158 Ga0114129_10000044 3300009147 Bacteria 106171
159 Ga0114129_10000620 3300009147 Bacteria 44046
160 Ga0114129_10001246 3300009147 Bacteria 33925
161 Ga0114129_10001271 3300009147 Bacteria 33698
162 Ga0114129_10006136 3300009147 Bacteria 17037
163 Ga0114129_10018242 3300009147 Bacteria 9992
164 Ga0114129_10030920 3300009147 Bacteria 7572
165 Ga0114129_10107722 3300009147 Bacteria 3848
166 Ga0114129_10138032 3300009147 Bacteria 3344
167 Ga0114129_10212080 3300009147 Bacteria 2617
168 Ga0114129_10301248 3300009147 Bacteria 2136
169 Ga0114129_10342260 3300009147 Bacteria 1983
170 Ga0114129_11021412 3300009147 Bacteria 1040
171 Ga0114129_11605866 3300009147 Unclassified 796
172 Ga0114129_12006501 3300009147 Unclassified 700
173 Ga0114129_12067575 3300009147 Bacteria 688
174 Ga0114129_12691663 3300009147 Unclassified 593
175 Ga0114129_13188883 3300009147 Unclassified 534
176 Ga0114129_13327825 3300009147 Unclassified 519
177 Ga0105243_10001882 3300009148 Bacteria 17880
178 Ga0105243_10010737 3300009148 Bacteria 6938
179 Ga0105241_10010916 3300009174 Bacteria 6664
180 Ga0105242_10061311 3300009176 Bacteria 3093
181 Ga0105249_10151658 3300009553 Unclassified 2232
182 Ga0105249_10353387 3300009553 Bacteria 1489
183 Ga0105249_11587194 3300009553 Unclassified 727
184 Ga0105249_11927810 3300009553 Bacteria 663
185 Ga0157371_10103163 3300013102 Bacteria 2024
186 Ga0157371_10521023 3300013102 Bacteria 879
187 Ga0157378_10115559 3300013297 Bacteria 2466
188 Ga0157378_10295719 3300013297 Bacteria 1565
189 Ga0163162_10024149 3300013306 Bacteria 5999
190 Ga0157380_12786180 3300014326 Unclassified 555
191 Ga0207653_10003955 3300025885 Bacteria 4656
192 Ga0207684_10006369 3300025910 Bacteria 10760
193 Ga0207684_10448103 3300025910 Bacteria 1108
194 Ga0207684_10489030 3300025910 Unclassified 1055
195 Ga0207654_10032745 3300025911 Bacteria 2875
196 Ga0207660_10136550 3300025917 Bacteria 1872
197 Ga0207662_10649621 3300025918 Unclassified 737
198 Ga0207646_10079058 3300025922 Bacteria 2940
199 Ga0207681_10013000 3300025923 Bacteria 5146
200 Ga0207706_10253546 3300025933 Bacteria 1537
201 Ga0207686_10045569 3300025934 Bacteria 2699
202 Ga0207709_10025811 3300025935 Bacteria 3367
203 Ga0207669_11374194 3300025937 Bacteria 601
204 Ga0207704_10184075 3300025938 Bacteria 1512
205 Ga0207665_11168179 3300025939 Bacteria 614
206 Ga0207691_10029033 3300025940 Bacteria 5174
207 Ga0207689_10065790 3300025942 Bacteria 2981
208 Ga0207712_10475460 3300025961 Unclassified 1064
209 Ga0207712_10931506 3300025961 Unclassified 769
210 Ga0207712_11028190 3300025961 Bacteria 732
211 Ga0207712_11214643 3300025961 Unclassified 673
212 Ga0207708_10038592 3300026075 Bacteria 3638
213 Ga0207641_10276392 3300026088 Bacteria 1578
214 Ga0207648_10186184 3300026089 Bacteria 1839
215 Ga0207648_10489009 3300026089 Bacteria 1125
216 Ga0207648_10768699 3300026089 Bacteria 895
217 Ga0207674_10141408 3300026116 Bacteria 2366
218 Ga0207675_100023342 3300026118 Bacteria 5752
219 Ga0207675_102656936 3300026118 Bacteria 510
220 Ga0209971_1054737 3300027682 Unclassified 965
221 Ga0207428_10000177 3300027907 Bacteria 89397
222 Ga0207428_10001814 3300027907 Bacteria 21878
223 Ga0207428_10061065 3300027907 Bacteria 2985
224 Ga0207428_10170876 3300027907 Bacteria 1646
225 Ga0207428_10325472 3300027907 Bacteria 1135
226 Ga0207428_11083247 3300027907 Unclassified 561
227 Ga0268265_10012222 3300028380 Bacteria 5814
228 Ga0268265_10211547 3300028380 Unclassified 1690
229 Ga0268264_10078258 3300028381 Unclassified 2819
230 Ga0268264_11538842 3300028381 Unclassified 676
231 Ga0307405_10368555 3300031731 Bacteria 1114
232 Ga0307410_10758827 3300031852 Bacteria 822
233 Ga0307406_10053848 3300031901 Unclassified 2565
234 Ga0307407_10283702 3300031903 Bacteria 1148
235 Ga0307409_100051163 3300031995 Bacteria 3160
236 Ga0307416_100050438 3300032002 Bacteria 3317
237 Ga0307416_100298283 3300032002 Bacteria 1600
238 Ga0307416_100443611 3300032002 Unclassified 1349
239 Ga0307411_10024618 3300032005 Bacteria 3591
240 Ga0307415_100097890 3300032126 Bacteria 2143
241 Ga0373930_0031293 3300034816 Bacteria 1096
242 Ga0373928_0063205 3300035084 Unclassified 900
243 Ga0373940_0010967 3300035088 Bacteria 2143
244 Ga0373940_0146158 3300035088 Bacteria 750
245 Ga0373940_0224259 3300035088 Unclassified 625
246 Ga0373940_0296777 3300035088 Unclassified 555
247 Ga0373932_0002379 3300035112 Bacteria 4776
248 Ga0373932_0082890 3300035112 Bacteria 1016
249 Ga0373939_0085765 3300035114 Unclassified 1055
250 Ga0373941_0344809 3300035115 Unclassified 604
251 Ga0373961_0043081 3300035241 Bacteria 1311
252 Ga0373961_0347081 3300035241 Unclassified 559
253 Ga0373962_0040415 3300035242 Unclassified 1312
254 Ga0373931_0000690 3300035691 Bacteria 13959
255 Ga0373931_0010158 3300035691 Bacteria 4519
256 Ga0373931_0010184 3300035691 Bacteria 4515
257 Ga0373931_0802019 3300035691 Bacteria 628
258 Ga0395899_0050160 3300037312 Bacteria 3100
259 Ga0395900_1749654 3300037418 Bacteria 532
260 Ga0395898_0009797 3300037466 Bacteria 10042
261 Ga0395901_0001690 3300038443 Bacteria 22760
262 Ga0439441_062507 3300042001 Unclassified 786
263 Ga0439460_0051809 3300042461 Bacteria 1232
264 Ga0451577_0006294 3300042876 Bacteria 11886
265 Ga0453683_0140044 3300044673 Bacteria 1526
266 Ga0453683_0192370 3300044673 Bacteria 1295
267 Ga0453684_0039181 3300044712 Unclassified 6463
268 Ga0453684_0604752 3300044712 Bacteria 1201
269 Ga0451576_0032804 3300045051 Bacteria 5523
270 Ga0451576_0091608 3300045051 Bacteria 3162
271 Ga0451576_0130018 3300045051 Bacteria 2624
272 Ga0451576_0142087 3300045051 Bacteria 2503
273 Ga0451576_0313383 3300045051 Unclassified 1641
274 Ga0495580_0006267 3300046472 Bacteria 9725
275 Ga0495580_0602736 3300046472 Unclassified 726
276 Ga0495642_0085082 3300046528 Bacteria 1335
277 Ga0495642_0170710 3300046528 Unclassified 945
278 Ga0495659_0122263 3300046664 Unclassified 1026
279 Ga0495659_0243436 3300046664 Unclassified 748
280 Ga0496102_0008063 3300048905 Bacteria 9011
281 Ga0496102_0484248 3300048905 Bacteria 1159
282 Ga0501036_0385241 3300049572 Bacteria 1170
283 Ga0501036_0487437 3300049572 Bacteria 1026
284 Ga0501036_0578823 3300049572 Unclassified 932
285 Ga0501036_1654641 3300049572 Unclassified 516
286 Ga0501038_1100771 3300049574 Bacteria 580
287 Ga0501038_1260304 3300049574 Unclassified 535
288 Ga0501040_0068731 3300049576 Bacteria 2443
289 Ga0501040_0125794 3300049576 Bacteria 1801
290 Ga0501040_0165731 3300049576 Bacteria 1563
291 Ga0501040_0165805 3300049576 Bacteria 1563
292 Ga0501040_0473294 3300049576 Bacteria 902
293 Ga0501040_0732683 3300049576 Bacteria 715
294 Ga0501041_0498941 3300049577 Bacteria 774
295 Ga0501041_0886767 3300049577 Unclassified 573
296 Ga0501042_0773203 3300049578 Bacteria 699
297 Ga0501042_0845291 3300049578 Unclassified 666
298 Ga0501046_0074981 3300049580 Bacteria 2624
299 Ga0501046_0161425 3300049580 Bacteria 1685
300 Ga0501048_0073795 3300049582 Bacteria 2408
301 Ga0501048_0094402 3300049582 Bacteria 2110
302 Ga0501048_0158976 3300049582 Bacteria 1599
303 Ga0501048_0299559 3300049582 Unclassified 1144
304 Ga0501067_0003979 3300049583 Bacteria 8154
305 Ga0501068_0386667 3300049584 Bacteria 901
306 Ga0501068_0431184 3300049584 Bacteria 852
307 Ga0501068_0490892 3300049584 Bacteria 796
308 Ga0501068_0504634 3300049584 Unclassified 785
309 Ga0501068_1205272 3300049584 Unclassified 502
310 Ga0501069_0098643 3300049585 Unclassified 1657
311 Ga0501070_1053978 3300049586 Bacteria 629
312 Ga0501071_0069604 3300049587 Bacteria 2563
313 Ga0501071_0168524 3300049587 Bacteria 1639
314 Ga0501071_1526519 3300049587 Unclassified 516
315 Ga0501072_0044619 3300049588 Bacteria 3485
316 Ga0501072_0313978 3300049588 Unclassified 1246
317 Ga0501072_0617801 3300049588 Bacteria 854
318 Ga0501073_0885044 3300049589 Bacteria 615
319 Ga0501075_0049131 3300049591 Bacteria 3171
320 Ga0501075_0081900 3300049591 Bacteria 2444
321 Ga0501075_0538886 3300049591 Bacteria 891
322 Ga0501076_0020035 3300049592 Bacteria 5116
323 Ga0501076_0033034 3300049592 Bacteria 4040
324 Ga0501076_0526637 3300049592 Bacteria 974
325 Ga0501076_1144145 3300049592 Unclassified 641
326 Ga0501077_0037715 3300049593 Bacteria 3077
327 Ga0501077_0596904 3300049593 Bacteria 709
328 Ga0501079_0015271 3300049741 Bacteria 5857
329 Ga0501079_0144902 3300049741 Bacteria 1851
330 Ga0501079_0345818 3300049741 Bacteria 1165
331 Ga0501079_0557662 3300049741 Unclassified 901
332 Ga0501079_0924012 3300049741 Bacteria 687
333 Ga0501081_0000888 3300049743 Bacteria 17689
334 Ga0501081_0055409 3300049743 Bacteria 2740
335 Ga0501081_0693710 3300049743 Bacteria 764
336 Ga0501081_0805779 3300049743 Unclassified 707
337 Ga0501278_015619 3300049774 Bacteria 655
338 Ga0501278_036894 3300049774 Viruses 518
339 Ga0501035_1252316 3300049822 Bacteria 574
340 Ga0501045_1057907 3300049824 Unclassified 594
341 nmdc:mga05p37_1145381_c1 3300050507 Bacteria 810
342 nmdc:mga05p37_1235631_c1 3300050507 Bacteria 768
343 nmdc:mga05p37_136716_c1 3300050507 Bacteria 3004
344 nmdc:mga05p37_1450114_c1 3300050507 Unclassified 687
345 nmdc:mga05p37_167250_c1 3300050507 Bacteria 2683
346 nmdc:mga05p37_188_c1 3300050507 Bacteria 61157
347 nmdc:mga05p37_198_c1 3300050507 Bacteria 59977
348 nmdc:mga05p37_25396_c1 3300050507 Bacteria 7205
349 nmdc:mga05p37_3790_c1 3300050507 Bacteria 17693
350 nmdc:mga05p37_38934_c1 3300050507 Bacteria 5833
351 nmdc:mga05p37_417_c1 3300050507 Bacteria 46047
352 nmdc:mga05p37_53715_c1 3300050507 Bacteria 4956
353 nmdc:mga05p37_6667_c1 3300050507 Bacteria 13619
354 nmdc:mga05p37_67974_c1 3300050507 Bacteria 4383
355 nmdc:mga09592_15830_c1 3300050508 Bacteria 6163
356 nmdc:mga09592_22655_c1 3300050508 Bacteria 5184
357 nmdc:mga09592_274687_c1 3300050508 Bacteria 1462
358 nmdc:mga09592_29218_c1 3300050508 Bacteria 4585
359 nmdc:mga09592_37468_c1 3300050508 Bacteria 4068
360 nmdc:mga09592_3844_c1 3300050508 Bacteria 12096
361 nmdc:mga09592_46940_c1 3300050508 Bacteria 3639
362 nmdc:mga09592_6561_c1 3300050508 Bacteria 9474
363 nmdc:mga09592_731004_c1 3300050508 Unclassified 841
364 nmdc:mga09592_74870_c1 3300050508 Bacteria 2877
365 nmdc:mga09592_82391_c1 3300050508 Bacteria 2741
366 nmdc:mga0qj67_110340_c1 3300050509 Bacteria 2220
367 nmdc:mga0qj67_110554_c1 3300050509 Bacteria 2218
368 nmdc:mga0qj67_1323868_c1 3300050509 Unclassified 558
369 nmdc:mga0qj67_165768_c1 3300050509 Bacteria 1794
370 nmdc:mga0qj67_171976_c1 3300050509 Bacteria 1759
371 nmdc:mga0qj67_280_c1 3300050509 Bacteria 35461
372 nmdc:mga0qj67_496_c1 3300050509 Bacteria 26809
373 nmdc:mga06r32_104782_c1 3300050510 Bacteria 2778
374 nmdc:mga06r32_11283_c1 3300050510 Bacteria 8048
375 nmdc:mga06r32_3375_c1 3300050510 Bacteria 14276
376 nmdc:mga06r32_369841_c1 3300050510 Unclassified 1417
377 nmdc:mga06r32_405960_c1 3300050510 Bacteria 1344
378 nmdc:mga06r32_6342_c1 3300050510 Bacteria 10625
379 nmdc:mga06r32_757518_c1 3300050510 Bacteria 934
380 nmdc:mga06r32_87_c1 3300050510 Bacteria 63774
381 nmdc:mga06r32_93861_c1 3300050510 Bacteria 2935
382 nmdc:mga08y16_10549_c1 3300050511 Bacteria 9697
383 nmdc:mga08y16_1343_c1 3300050511 Bacteria 24548
384 nmdc:mga08y16_1420498_c1 3300050511 Unclassified 657
385 nmdc:mga08y16_26994_c1 3300050511 Bacteria 6052
386 nmdc:mga08y16_36535_c1 3300050511 Bacteria 5159
387 nmdc:mga08y16_671508_c1 3300050511 Bacteria 1038
388 nmdc:mga08y16_72339_c1 3300050511 Bacteria 3593
389 nmdc:mga0n895_137236_c1 3300050512 Bacteria 2473
390 nmdc:mga0n895_1531879_c1 3300050512 Unclassified 632
391 nmdc:mga0n895_1542775_c1 3300050512 Unclassified 630
392 nmdc:mga0n895_18804_c1 3300050512 Bacteria 6404
393 nmdc:mga0n895_208530_c1 3300050512 Bacteria 1985
394 nmdc:mga0n895_27549_c1 3300050512 Bacteria 5400
395 nmdc:mga0n895_342620_c1 3300050512 Bacteria 1514
396 nmdc:mga0n895_3436_c1 3300050512 Bacteria 12784
397 nmdc:mga0n895_3703_c1 3300050512 Bacteria 12359
398 nmdc:mga0n895_44367_c1 3300050512 Bacteria 4335
399 nmdc:mga0n895_47694_c1 3300050512 Bacteria 4189
400 nmdc:mga0n895_518639_c1 3300050512 Unclassified 1199
401 nmdc:mga0n895_6075_c1 3300050512 Bacteria 10187
402 nmdc:mga0n895_93358_c1 3300050512 Bacteria 3013
403 nmdc:mga0n895_972021_c1 3300050512 Bacteria 832
404 nmdc:mga0rr50_120436_c1 3300050513 Bacteria 2088
405 nmdc:mga0rr50_21507_c1 3300050513 Bacteria 4405
406 nmdc:mga0rr50_236586_c1 3300050513 Bacteria 1513
407 nmdc:mga0rr50_25698_c1 3300050513 Bacteria 4098
408 nmdc:mga0rr50_514268_c1 3300050513 Bacteria 1018
409 nmdc:mga0rr50_53082_c1 3300050513 Bacteria 3015
410 nmdc:mga0rr50_71717_c1 3300050513 Bacteria 2644
411 nmdc:mga0rr50_86782_c1 3300050513 Bacteria 2428
412 nmdc:mga0rr50_88720_c1 3300050513 Bacteria 2403
413 nmdc:mga08x19_169354_c1 3300050514 Unclassified 1487
414 nmdc:mga08x19_223180_c1 3300050514 Unclassified 1295
415 nmdc:mga08x19_274_c1 3300050514 Bacteria 38873
416 nmdc:mga08x19_588973_c1 3300050514 Bacteria 788
417 nmdc:mga0a205_104680_c1 3300050515 Bacteria 2729
418 nmdc:mga0a205_108793_c1 3300050515 Bacteria 2670
419 nmdc:mga0a205_11793_c1 3300050515 Bacteria 8065
420 nmdc:mga0a205_117_c1 3300050515 Bacteria 47476
421 nmdc:mga0a205_1182_c1 3300050515 Bacteria 21797
422 nmdc:mga0a205_13630_c1 3300050515 Bacteria 7572
423 nmdc:mga0a205_140338_c1 3300050515 Bacteria 2317
424 nmdc:mga0a205_1514_c1 3300050515 Bacteria 19854
425 nmdc:mga0a205_160507_c1 3300050515 Bacteria 2145
426 nmdc:mga0a205_27525_c1 3300050515 Bacteria 5429
427 nmdc:mga0a205_308520_c1 3300050515 Unclassified 1455
428 nmdc:mga0a205_412803_c1 3300050515 Unclassified 1213
429 nmdc:mga0a205_46136_c1 3300050515 Bacteria 3401
430 nmdc:mga0a205_47885_c1 3300050515 Bacteria 4125
431 nmdc:mga0a205_656401_c1 3300050515 Bacteria 900
432 Ga0501084_0023144 3300054114 Bacteria 5186
433 Ga0501084_0023460 3300054114 Bacteria 5147
434 Ga0501084_0135104 3300054114 Bacteria 2076
435 Ga0590077_014944 3300059426 Bacteria 1620
436 Ga0501082_0066633 3300060353 Bacteria 3101
437 Ga0501082_0206378 3300060353 Bacteria 1709
438 Ga0501082_1232148 3300060353 Unclassified 654
439 Ga0530510_0021938 3300061734 Bacteria 4546
440 Ga0081539_10000210
441 Ga0070676_10359972
442 Ga0070690_101526217
443 Ga0068869_100016967
444 Ga0070680_100041520
445 Ga0070689_100544552
446 Ga0070691_10013405
447 Ga0070692_10034580
448 Ga0070669_100002190
449 Ga0070669_100186976
450 Ga0070671_101100011
451 Ga0070674_101774618
452 Ga0070703_10045862
453 Ga0070701_10000447
454 Ga0070705_100007621
455 Ga0070705_100011957
456 Ga0070705_100016316
457 Ga0070694_100108737
458 Ga0070694_100147147
459 Ga0070694_100239752
460 Ga0070708_100006399
461 Ga0070708_100057245
462 Ga0070708_100076331
463 Ga0070708_100132644
464 Ga0070708_100303118
465 Ga0070662_100024382
466 Ga0070681_10056303
467 Ga0068867_100053766
468 Ga0068867_100180716
469 Ga0068867_100589560
470 Ga0070706_100086233
471 Ga0070706_100718896
472 Ga0070707_100141693
473 Ga0070707_100982636
474 Ga0070698_100415407
475 Ga0070698_100720646
476 Ga0070699_100022319
477 Ga0070699_100056361
478 Ga0070699_100095839
479 Ga0070699_100222689
480 Ga0070697_100130063
481 Ga0070697_100324910
482 Ga0070697_100337304
483 Ga0070697_100397294
484 Ga0070672_100162042
485 Ga0070695_100009624
486 Ga0070695_100828421
487 Ga0070696_100008971
488 Ga0070696_100063330
489 Ga0070696_100222706
490 Ga0070696_100437856
491 Ga0070696_101123738
492 Ga0070693_100270920
493 Ga0070704_100011318
494 Ga0070704_100098123
495 Ga0070704_100176097
496 Ga0070704_100546876
497 Ga0068857_100121299
498 Ga0070702_100539589
499 Ga0068859_100154129
500 Ga0068866_10048875
501 Ga0068861_100084090
502 Ga0068861_100774843
503 Ga0068863_100226250
504 Ga0068860_100124015
505 Ga0068860_100180791
506 Ga0068860_100955376
507 Ga0068862_100014446
508 Ga0068862_100233632
509 Ga0068862_100642002
510 Ga0081455_10039644
511 Ga0081455_10310176
512 Ga0081538_10019380
513 Ga0081540_1016722
514 Ga0070716_100192373
515 Ga0075428_100000684
516 Ga0075428_100007142
517 Ga0075428_100020957
518 Ga0075428_100021464
519 Ga0075428_100028948
520 Ga0075428_100071709
521 Ga0075428_100187727
522 Ga0075428_100352703
523 Ga0075428_101695329
524 Ga0075430_100000064
525 Ga0075430_100001183
526 Ga0075430_100003618
527 Ga0075430_100039781
528 Ga0075430_100118251
529 Ga0075430_100153362
530 Ga0075431_100000125
531 Ga0075431_100000159
532 Ga0075431_100000418
533 Ga0075431_100008561
534 Ga0075431_100034633
535 Ga0075431_100073879
536 Ga0075431_100105403
537 Ga0075431_100416046
538 Ga0075431_100459279
539 Ga0075431_101297990
540 Ga0075431_101388385
541 Ga0075433_10000687
542 Ga0075433_10002988
543 Ga0075433_10009893
544 Ga0075433_10016041
545 Ga0075433_10021713
546 Ga0075433_10033495
547 Ga0075433_10074145
548 Ga0075433_10373072
549 Ga0075433_10701901
550 Ga0075433_11476076
551 Ga0075434_100006597
552 Ga0075434_100013016
553 Ga0075434_100020213
554 Ga0075434_100026008
555 Ga0075434_100029243
556 Ga0075434_100048800
557 Ga0075434_100076672
558 Ga0075434_100076882
559 Ga0075434_100104229
560 Ga0075434_100223401
561 Ga0075434_100230327
562 Ga0075434_100292318
563 Ga0075434_100676789
564 Ga0075434_101893367
565 Ga0075429_100000503
566 Ga0075429_100002947
567 Ga0075429_100005228
568 Ga0075429_100005754
569 Ga0075429_100006445
570 Ga0075429_100039808
571 Ga0075429_100061094
572 Ga0075429_100103388
573 Ga0075429_100128322
574 Ga0075429_100175202
575 Ga0075429_100646821
576 Ga0075429_100786478
577 Ga0068865_100183938
578 Ga0075436_100000150
579 Ga0075436_100728808
580 Ga0097620_100154136
581 Ga0075435_100012527
582 Ga0075435_100014092
583 Ga0075435_100017268
584 Ga0075435_100023765
585 Ga0075435_100132038
586 Ga0075435_100152483
587 Ga0075435_100187589
588 Ga0075435_100249184
589 Ga0099794_10012831
590 Ga0099794_10052402
591 Ga0099794_10288657
592 Ga0099794_10695788
593 Ga0111539_10008391
594 Ga0111539_10041798
595 Ga0111539_10122496
596 Ga0114129_10000003
597 Ga0114129_10000044
598 Ga0114129_10000620
599 Ga0114129_10001246
600 Ga0114129_10001271
601 Ga0114129_10006136
602 Ga0114129_10018242
603 Ga0114129_10030920
604 Ga0114129_10107722
605 Ga0114129_10138032
606 Ga0114129_10212080
607 Ga0114129_10301248
608 Ga0114129_10342260
609 Ga0114129_11021412
610 Ga0114129_11605866
611 Ga0114129_12006501
612 Ga0114129_12067575
613 Ga0114129_12691663
614 Ga0114129_13188883
615 Ga0114129_13327825
616 Ga0105243_10001882
617 Ga0105243_10010737
618 Ga0105241_10010916
619 Ga0105242_10061311
620 Ga0105249_10151658
621 Ga0105249_10353387
622 Ga0105249_11587194
623 Ga0105249_11927810
624 Ga0157371_10103163
625 Ga0157371_10521023
626 Ga0157378_10115559
627 Ga0157378_10295719
628 Ga0163162_10024149
629 Ga0157380_12786180
630 Ga0207653_10003955
631 Ga0207684_10006369
632 Ga0207684_10448103
633 Ga0207684_10489030
634 Ga0207654_10032745
635 Ga0207660_10136550
636 Ga0207662_10649621
637 Ga0207646_10079058
638 Ga0207681_10013000
639 Ga0207706_10253546
640 Ga0207686_10045569
641 Ga0207709_10025811
642 Ga0207669_11374194
643 Ga0207704_10184075
644 Ga0207665_11168179
645 Ga0207691_10029033
646 Ga0207689_10065790
647 Ga0207712_10475460
648 Ga0207712_10931506
649 Ga0207712_11028190
650 Ga0207712_11214643
651 Ga0207708_10038592
652 Ga0207641_10276392
653 Ga0207648_10186184
654 Ga0207648_10489009
655 Ga0207648_10768699
656 Ga0207674_10141408
657 Ga0207675_100023342
658 Ga0207675_102656936
659 Ga0209971_1054737
660 Ga0207428_10000177
661 Ga0207428_10001814
662 Ga0207428_10061065
663 Ga0207428_10170876
664 Ga0207428_10325472
665 Ga0207428_11083247
666 Ga0268265_10012222
667 Ga0268265_10211547
668 Ga0268264_10078258
669 Ga0268264_11538842
670 Ga0307405_10368555
671 Ga0307410_10758827
672 Ga0307406_10053848
673 Ga0307407_10283702
674 Ga0307409_100051163
675 Ga0307416_100050438
676 Ga0307416_100298283
677 Ga0307416_100443611
678 Ga0307411_10024618
679 Ga0307415_100097890
680 Ga0373930_0031293
681 Ga0373928_0063205
682 Ga0373940_0010967
683 Ga0373940_0146158
684 Ga0373940_0224259
685 Ga0373940_0296777
686 Ga0373932_0002379
687 Ga0373932_0082890
688 Ga0373939_0085765
689 Ga0373941_0344809
690 Ga0373961_0043081
691 Ga0373961_0347081
692 Ga0373962_0040415
693 Ga0373931_0000690
694 Ga0373931_0010158
695 Ga0373931_0010184
696 Ga0373931_0802019
697 Ga0395899_0050160
698 Ga0395900_1749654
699 Ga0395898_0009797
700 Ga0395901_0001690
701 Ga0439441_062507
702 Ga0439460_0051809
703 Ga0451577_0006294
704 Ga0453683_0140044
705 Ga0453683_0192370
706 Ga0453684_0039181
707 Ga0453684_0604752
708 Ga0451576_0032804
709 Ga0451576_0091608
710 Ga0451576_0130018
711 Ga0451576_0142087
712 Ga0451576_0313383
713 Ga0495580_0006267
714 Ga0495580_0602736
715 Ga0495642_0085082
716 Ga0495642_0170710
717 Ga0495659_0122263
718 Ga0495659_0243436
719 Ga0496102_0008063
720 Ga0496102_0484248
721 Ga0501036_0385241
722 Ga0501036_0487437
723 Ga0501036_0578823
724 Ga0501036_1654641
725 Ga0501038_1100771
726 Ga0501038_1260304
727 Ga0501040_0068731
728 Ga0501040_0125794
729 Ga0501040_0165731
730 Ga0501040_0165805
731 Ga0501040_0473294
732 Ga0501040_0732683
733 Ga0501041_0498941
734 Ga0501041_0886767
735 Ga0501042_0773203
736 Ga0501042_0845291
737 Ga0501046_0074981
738 Ga0501046_0161425
739 Ga0501048_0073795
740 Ga0501048_0094402
741 Ga0501048_0158976
742 Ga0501048_0299559
743 Ga0501067_0003979
744 Ga0501068_0386667
745 Ga0501068_0431184
746 Ga0501068_0490892
747 Ga0501068_0504634
748 Ga0501068_1205272
749 Ga0501069_0098643
750 Ga0501070_1053978
751 Ga0501071_0069604
752 Ga0501071_0168524
753 Ga0501071_1526519
754 Ga0501072_0044619
755 Ga0501072_0313978
756 Ga0501072_0617801
757 Ga0501073_0885044
758 Ga0501075_0049131
759 Ga0501075_0081900
760 Ga0501075_0538886
761 Ga0501076_0020035
762 Ga0501076_0033034
763 Ga0501076_0526637
764 Ga0501076_1144145
765 Ga0501077_0037715
766 Ga0501077_0596904
767 Ga0501079_0015271
768 Ga0501079_0144902
769 Ga0501079_0345818
770 Ga0501079_0557662
771 Ga0501079_0924012
772 Ga0501081_0000888
773 Ga0501081_0055409
774 Ga0501081_0693710
775 Ga0501081_0805779
776 Ga0501278_015619
777 Ga0501278_036894
778 Ga0501035_1252316
779 Ga0501045_1057907
780 nmdc:mga05p37_1145381_c1
781 nmdc:mga05p37_1235631_c1
782 nmdc:mga05p37_136716_c1
783 nmdc:mga05p37_1450114_c1
784 nmdc:mga05p37_167250_c1
785 nmdc:mga05p37_188_c1
786 nmdc:mga05p37_198_c1
787 nmdc:mga05p37_25396_c1
788 nmdc:mga05p37_3790_c1
789 nmdc:mga05p37_38934_c1
790 nmdc:mga05p37_417_c1
791 nmdc:mga05p37_53715_c1
792 nmdc:mga05p37_6667_c1
793 nmdc:mga05p37_67974_c1
794 nmdc:mga09592_15830_c1
795 nmdc:mga09592_22655_c1
796 nmdc:mga09592_274687_c1
797 nmdc:mga09592_29218_c1
798 nmdc:mga09592_37468_c1
799 nmdc:mga09592_3844_c1
800 nmdc:mga09592_46940_c1
801 nmdc:mga09592_6561_c1
802 nmdc:mga09592_731004_c1
803 nmdc:mga09592_74870_c1
804 nmdc:mga09592_82391_c1
805 nmdc:mga0qj67_110340_c1
806 nmdc:mga0qj67_110554_c1
807 nmdc:mga0qj67_1323868_c1
808 nmdc:mga0qj67_165768_c1
809 nmdc:mga0qj67_171976_c1
810 nmdc:mga0qj67_280_c1
811 nmdc:mga0qj67_496_c1
812 nmdc:mga06r32_104782_c1
813 nmdc:mga06r32_11283_c1
814 nmdc:mga06r32_3375_c1
815 nmdc:mga06r32_369841_c1
816 nmdc:mga06r32_405960_c1
817 nmdc:mga06r32_6342_c1
818 nmdc:mga06r32_757518_c1
819 nmdc:mga06r32_87_c1
820 nmdc:mga06r32_93861_c1
821 nmdc:mga08y16_10549_c1
822 nmdc:mga08y16_1343_c1
823 nmdc:mga08y16_1420498_c1
824 nmdc:mga08y16_26994_c1
825 nmdc:mga08y16_36535_c1
826 nmdc:mga08y16_671508_c1
827 nmdc:mga08y16_72339_c1
828 nmdc:mga0n895_137236_c1
829 nmdc:mga0n895_1531879_c1
830 nmdc:mga0n895_1542775_c1
831 nmdc:mga0n895_18804_c1
832 nmdc:mga0n895_208530_c1
833 nmdc:mga0n895_27549_c1
834 nmdc:mga0n895_342620_c1
835 nmdc:mga0n895_3436_c1
836 nmdc:mga0n895_3703_c1
837 nmdc:mga0n895_44367_c1
838 nmdc:mga0n895_47694_c1
839 nmdc:mga0n895_518639_c1
840 nmdc:mga0n895_6075_c1
841 nmdc:mga0n895_93358_c1
842 nmdc:mga0n895_972021_c1
843 nmdc:mga0rr50_120436_c1
844 nmdc:mga0rr50_21507_c1
845 nmdc:mga0rr50_236586_c1
846 nmdc:mga0rr50_25698_c1
847 nmdc:mga0rr50_514268_c1
848 nmdc:mga0rr50_53082_c1
849 nmdc:mga0rr50_71717_c1
850 nmdc:mga0rr50_86782_c1
851 nmdc:mga0rr50_88720_c1
852 nmdc:mga08x19_169354_c1
853 nmdc:mga08x19_223180_c1
854 nmdc:mga08x19_274_c1
855 nmdc:mga08x19_588973_c1
856 nmdc:mga0a205_104680_c1
857 nmdc:mga0a205_108793_c1
858 nmdc:mga0a205_11793_c1
859 nmdc:mga0a205_117_c1
860 nmdc:mga0a205_1182_c1
861 nmdc:mga0a205_13630_c1
862 nmdc:mga0a205_140338_c1
863 nmdc:mga0a205_1514_c1
864 nmdc:mga0a205_160507_c1
865 nmdc:mga0a205_27525_c1
866 nmdc:mga0a205_308520_c1
867 nmdc:mga0a205_412803_c1
868 nmdc:mga0a205_46136_c1
869 nmdc:mga0a205_47885_c1
870 nmdc:mga0a205_656401_c1
871 Ga0501084_0023144
872 Ga0501084_0023460
873 Ga0501084_0135104
874 Ga0590077_014944
875 Ga0501082_0066633
876 Ga0501082_0206378
877 Ga0501082_1232148
878 Ga0530510_0021938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01951

Archease

Archease protein family (MTH1598/TM1083)

22

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8btx-assembly1.cif.gz_A structure of human archease 0.9125 1 147
5yzl-assembly1.cif.gz_B crystal structure of human archease d178a 0.8984 6 145
5yzj-assembly1.cif.gz_B crystal structure of human archease mutant d51a 0.8973 6 145
8btx-assembly1.cif.gz_A structure of human archease 0.8709 1 147
4n2p-assembly1.cif.gz_A structure of archease from pyrococcus horikoshii 0.8654 1 147
ID Description Score Start End Superfamily
af_Q60334_1_139_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9504 5 147 3.55.10.10
af_Q60334_1_139_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9373 5 147 3.55.10.10
af_Q8ILH4_99_237_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9356 4 147 3.55.10.10
af_Q1LYJ7_30_130_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9346 4 19 3.10.450.10
af_Q9TZN1_15_155_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9345 5 147 3.55.10.10
ID Description Score Start End GO Terms
AF-A0A7C2ICK2-F1-model_v4 Archease 0.9716 3 147 GO:0008033
GO:0046872
AF-A0A2V7DBB6-F1-model_v4 Archease domain-containing protein 0.9672 3 147 GO:0008033
GO:0046872
AF-A0A0G4EFB0-F1-model_v4 Archease domain-containing protein 0.9653 4 147 GO:0006388
GO:0046872
GO:0072669
AF-A0A535RRM2-F1-model_v4 Archease 0.965 5 147 GO:0008033
GO:0046872
AF-A0A1F5V2I9-F1-model_v4 Archease domain-containing protein 0.9629 20 147 GO:0008033
GO:0046872

Map