F444131

General Info

Members Datasets Scaffolds Average Seq Length
439 222 433 354

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10091144|Ga0065707_100911443
Length 420
Sequence LRRSVHLSFHHWAIESQFIQSEAKDRILVHLVILFGFFRQWSVVNGEYGLVKTIDHSRLTTHNSPFTITFAQTLSMADMHYHDYLQLDKILNSQFPESEKQNLSAHDEMLFIIIHQTYELWFKQLHHEVDAVATIMSRPALNDNSPEVQTVVHRLNRCITILRVLVHQIDIMETMTPMDFLDFRDMLRPASGFQSWQFKELEAKLGLKFDNRHGKEYYTAQLRKEHVDVIKKAEGNRSLLELINSWLERMPLAPPLSDDPNSFWQIYRKSYQGSLADVEKGNLSALDEVFFNPEPQTSPKESSATNLKPSLSAAASRAALFIMLYRGYPLLQQPFQLLNCLLEIDEQLSSWRYRHMNMVHRMIGTRIGTGGSSGKDYLKAAADKHYIFREIAQLNSFLIERRKLPILSNEMETRLGFVHQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
3 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
4 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
5 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
222 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0
Rhizoplane 1.59
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_674391 2162886007 Bacteria 202920
2 CNXas_1000011 3300000545 Bacteria 39332
3 JGI25406J46586_10001278 3300003203 Bacteria 11822
4 JGI25406J46586_10005104 3300003203 Bacteria 6091
5 JGI25406J46586_10048832 3300003203 Bacteria 1432
6 rootH1_10051465 3300003316 Bacteria 3317
7 Ga0065704_10070132 3300005289 Bacteria 1955461
8 Ga0065712_10084227 3300005290 Unclassified 2762
9 Ga0065715_10101327 3300005293 Bacteria 3212
10 Ga0065707_10091144 3300005295 Bacteria 3997
11 Ga0065707_10135789 3300005295 Bacteria 1842
12 Ga0065707_10147765 3300005295 Unclassified 1693
13 Ga0070658_10112756 3300005327 Bacteria 2254
14 Ga0070676_10027219 3300005328 Bacteria 3241
15 Ga0070676_10062776 3300005328 Bacteria 2211
16 Ga0070676_10119843 3300005328 Bacteria 1650
17 Ga0070683_100161878 3300005329 Bacteria 2123
18 Ga0070690_100151687 3300005330 Bacteria 1582
19 Ga0070670_100002838 3300005331 Bacteria 14326
20 Ga0070670_100019496 3300005331 Bacteria 5821
21 Ga0070670_100034962 3300005331 Bacteria 4325
22 Ga0070670_100040286 3300005331 Bacteria 4017
23 Ga0070670_100107880 3300005331 Bacteria 2399
24 Ga0068869_100009428 3300005334 Bacteria 6335
25 Ga0068869_100023688 3300005334 Bacteria 4245
26 Ga0068869_100236394 3300005334 Bacteria 1454
27 Ga0070666_10003635 3300005335 Bacteria 9356
28 Ga0070666_10024490 3300005335 Bacteria 3932
29 Ga0070666_10035922 3300005335 Bacteria 3286
30 Ga0070666_10063851 3300005335 Bacteria 2496
31 Ga0070660_100134492 3300005339 Bacteria 1980
32 Ga0070689_100043673 3300005340 Bacteria 3446
33 Ga0070689_100107967 3300005340 Bacteria 2210
34 Ga0070687_100065191 3300005343 Bacteria 1937
35 Ga0070687_100090208 3300005343 Bacteria 1694
36 Ga0070661_100143846 3300005344 Bacteria 1798
37 Ga0070668_100147697 3300005347 Bacteria 1898
38 Ga0070669_100178104 3300005353 Bacteria 1661
39 Ga0070675_100001195 3300005354 Bacteria 18876
40 Ga0070675_100024809 3300005354 Bacteria 4803
41 Ga0070675_100076777 3300005354 Bacteria 2779
42 Ga0070675_100088308 3300005354 Bacteria 2594
43 Ga0070675_100150769 3300005354 Bacteria 1993
44 Ga0070675_100163366 3300005354 Bacteria 1916
45 Ga0070675_100225435 3300005354 Bacteria 1633
46 Ga0070675_100309300 3300005354 Bacteria 1394
47 Ga0070671_100002766 3300005355 Bacteria 13628
48 Ga0070671_100004461 3300005355 Bacteria 11082
49 Ga0070671_100031890 3300005355 Bacteria 4356
50 Ga0070671_100087685 3300005355 Bacteria 2604
51 Ga0070674_100032246 3300005356 Unclassified 3478
52 Ga0070674_100231589 3300005356 Bacteria 1442
53 Ga0070673_100012331 3300005364 Bacteria 5866
54 Ga0070673_100038399 3300005364 Bacteria 3656
55 Ga0070673_100044704 3300005364 Bacteria 3431
56 Ga0070673_100057723 3300005364 Bacteria 3067
57 Ga0070673_100135601 3300005364 Bacteria 2071
58 Ga0070673_100415995 3300005364 Bacteria 1204
59 Ga0070688_100009028 3300005365 Bacteria 5435
60 Ga0070688_100011239 3300005365 Bacteria 4970
61 Ga0070688_100038531 3300005365 Unclassified 2919
62 Ga0070667_100013848 3300005367 Bacteria 6667
63 Ga0070667_100161047 3300005367 Bacteria 1976
64 Ga0070714_100149891 3300005435 Bacteria 2101
65 Ga0070701_10067908 3300005438 Bacteria 1898
66 Ga0070708_100112126 3300005445 Bacteria 2508
67 Ga0070678_100199260 3300005456 Bacteria 1651
68 Ga0070678_100209390 3300005456 Bacteria 1615
69 Ga0070662_100041874 3300005457 Bacteria 3270
70 Ga0070681_10011891 3300005458 Bacteria 8632
71 Ga0070681_10181854 3300005458 Bacteria 2024
72 Ga0068867_100052198 3300005459 Bacteria 3017
73 Ga0068867_100134189 3300005459 Bacteria 1927
74 Ga0070685_10006363 3300005466 Bacteria 6019
75 Ga0070698_100002180 3300005471 Bacteria 21719
76 Ga0070699_100084691 3300005518 Bacteria 2767
77 Ga0068853_100037298 3300005539 Bacteria 4135
78 Ga0068853_100042316 3300005539 Bacteria 3895
79 Ga0068853_100122562 3300005539 Unclassified 2321
80 Ga0068853_100216098 3300005539 Unclassified 1749
81 Ga0070672_100032657 3300005543 Bacteria 3931
82 Ga0070672_100147944 3300005543 Bacteria 1942
83 Ga0070695_100000612 3300005545 Bacteria 18925
84 Ga0070695_100031413 3300005545 Bacteria 3313
85 Ga0070665_100004098 3300005548 Bacteria 15327
86 Ga0070665_100007464 3300005548 Bacteria 11119
87 Ga0070665_100165449 3300005548 Bacteria 2214
88 Ga0070704_100037276 3300005549 Bacteria 3320
89 Ga0070704_100070094 3300005549 Bacteria 2543
90 Ga0068855_100142572 3300005563 Bacteria 2729
91 Ga0070664_100029927 3300005564 Bacteria 4540
92 Ga0068857_100335982 3300005577 Unclassified 1397
93 Ga0068857_100383093 3300005577 Bacteria 1306
94 Ga0068854_100033255 3300005578 Bacteria 3595
95 Ga0068856_100009989 3300005614 Bacteria 9217
96 Ga0068856_100110046 3300005614 Bacteria 2751
97 Ga0070702_100091870 3300005615 Bacteria 1842
98 Ga0068852_100147806 3300005616 Bacteria 2182
99 Ga0068852_100336425 3300005616 Bacteria 1470
100 Ga0068859_100031388 3300005617 Bacteria 5335
101 Ga0068864_100088901 3300005618 Bacteria 2721
102 Ga0068864_100281633 3300005618 Bacteria 1552
103 Ga0068861_100036032 3300005719 Unclassified 3669
104 Ga0068851_10060390 3300005834 Bacteria 1940
105 Ga0068870_10001863 3300005840 Bacteria 8681
106 Ga0068870_10005615 3300005840 Bacteria 5485
107 Ga0068858_100176329 3300005842 Bacteria 2017
108 Ga0068858_100301678 3300005842 Bacteria 1528
109 Ga0068860_100302206 3300005843 Bacteria 1568
110 Ga0068862_100006480 3300005844 Bacteria 9718
111 Ga0081455_10081989 3300005937 Bacteria 2640
112 Ga0081538_10000325 3300005981 Bacteria 54572
113 Ga0081538_10001732 3300005981 Bacteria 22176
114 Ga0081538_10006603 3300005981 Bacteria 10176
115 Ga0081538_10039232 3300005981 Bacteria 3040
116 Ga0081540_1064317 3300005983 Bacteria 1731
117 Ga0081539_10000147 3300005985 Bacteria 164274
118 Ga0081539_10002062 3300005985 Bacteria 30115
119 Ga0081539_10005364 3300005985 Bacteria 13132
120 Ga0081539_10005759 3300005985 Bacteria 12366
121 Ga0075364_10014842 3300006051 Bacteria 4820
122 Ga0075366_10016882 3300006195 Bacteria 4195
123 Ga0097621_100061436 3300006237 Bacteria 3082
124 Ga0068871_100069099 3300006358 Bacteria 2900
125 Ga0068871_100073580 3300006358 Bacteria 2817
126 Ga0068871_100116146 3300006358 Bacteria 2256
127 Ga0075428_100047581 3300006844 Bacteria 4710
128 Ga0075428_100085703 3300006844 Bacteria 3436
129 Ga0075428_100091598 3300006844 Bacteria 3316
130 Ga0075430_100015202 3300006846 Bacteria 6553
131 Ga0075430_100194659 3300006846 Bacteria 1684
132 Ga0075433_10095523 3300006852 Bacteria 2630
133 Ga0075434_100059711 3300006871 Bacteria 3791
134 Ga0075434_100221466 3300006871 Bacteria 1912
135 Ga0075434_100239873 3300006871 Bacteria 1833
136 Ga0075429_100099408 3300006880 Bacteria 2538
137 Ga0075429_100152765 3300006880 Bacteria 2021
138 Ga0097620_100031386 3300006931 Bacteria 5335
139 Ga0105240_10000101 3300009093 Bacteria 175584
140 Ga0111539_10001846 3300009094 Bacteria 28176
141 Ga0111539_10033541 3300009094 Bacteria 6232
142 Ga0111539_10067938 3300009094 Bacteria 4208
143 Ga0111539_10671360 3300009094 Bacteria 1207
144 Ga0105245_10141018 3300009098 Bacteria 2270
145 Ga0114129_10029138 3300009147 Bacteria 7820
146 Ga0114129_10602242 3300009147 Unclassified 1423
147 Ga0105242_10023186 3300009176 Unclassified 4893
148 Ga0105237_10023518 3300009545 Bacteria 6313
149 Ga0105237_10152210 3300009545 Bacteria 2310
150 Ga0105237_10270555 3300009545 Bacteria 1702
151 Ga0105238_10021657 3300009551 Bacteria 6548
152 Ga0105249_10001673 3300009553 Bacteria 19449
153 Ga0105249_10021809 3300009553 Bacteria 5735
154 Ga0105249_10168881 3300009553 Bacteria 2120
155 Ga0105239_10000277 3300010375 Bacteria 75496
156 Ga0105239_10005666 3300010375 Bacteria 14591
157 Ga0105239_10212938 3300010375 Bacteria 2166
158 Ga0157373_10062649 3300013100 Bacteria 2634
159 Ga0157371_10009208 3300013102 Bacteria 7794
160 Ga0157371_10063869 3300013102 Bacteria 2609
161 Ga0157370_10313768 3300013104 Bacteria 1447
162 Ga0157369_10104868 3300013105 Bacteria 3010
163 Ga0157374_10289824 3300013296 Unclassified 1618
164 Ga0157374_10378270 3300013296 Bacteria 1410
165 Ga0157378_10006247 3300013297 Bacteria 10430
166 Ga0157378_10025119 3300013297 Bacteria 5249
167 Ga0157378_10035854 3300013297 Bacteria 4390
168 Ga0157378_10119181 3300013297 Bacteria 2430
169 Ga0157378_10125100 3300013297 Bacteria 2374
170 Ga0157378_10444711 3300013297 Bacteria 1285
171 Ga0163162_10035406 3300013306 Unclassified 4974
172 Ga0163162_10126978 3300013306 Bacteria 2657
173 Ga0163162_10243027 3300013306 Bacteria 1931
174 Ga0163162_10427778 3300013306 Unclassified 1456
175 Ga0157372_10037289 3300013307 Bacteria 5361
176 Ga0157372_10044662 3300013307 Bacteria 4910
177 Ga0157375_10002708 3300013308 Bacteria 15322
178 Ga0157375_10082067 3300013308 Unclassified 3265
179 Ga0157380_10015165 3300014326 Bacteria 5657
180 Ga0157380_10019431 3300014326 Bacteria 5063
181 Ga0157380_10170761 3300014326 Bacteria 1900
182 Ga0157377_10002160 3300014745 Bacteria 8640
183 Ga0157377_10098969 3300014745 Bacteria 1734
184 Ga0157376_10139520 3300014969 Bacteria 2173
185 Ga0163161_10060718 3300017792 Bacteria 2752
186 Ga0213876_10007398 3300021384 Bacteria 5971
187 Ga0207697_10000411 3300025315 Bacteria 24238
188 Ga0207682_10021284 3300025893 Bacteria 2551
189 Ga0207682_10050548 3300025893 Bacteria 1719
190 Ga0207642_10142275 3300025899 Bacteria 1266
191 Ga0207688_10005995 3300025901 Bacteria 6614
192 Ga0207688_10125348 3300025901 Bacteria 1502
193 Ga0207680_10004946 3300025903 Bacteria 6348
194 Ga0207680_10019728 3300025903 Bacteria 3612
195 Ga0207680_10032587 3300025903 Bacteria 2963
196 Ga0207647_10007137 3300025904 Bacteria 8101
197 Ga0207645_10026623 3300025907 Bacteria 3736
198 Ga0207705_10293162 3300025909 Bacteria 1246
199 Ga0207695_10000020 3300025913 Bacteria 723025
200 Ga0207695_10012575 3300025913 Bacteria 10143
201 Ga0207671_10000443 3300025914 Bacteria 57065
202 Ga0207657_10001473 3300025919 Bacteria 25157
203 Ga0207681_10058077 3300025923 Unclassified 2647
204 Ga0207681_10143247 3300025923 Bacteria 1782
205 Ga0207694_10240524 3300025924 Bacteria 1479
206 Ga0207650_10001707 3300025925 Bacteria 15596
207 Ga0207650_10021044 3300025925 Bacteria 4608
208 Ga0207650_10031736 3300025925 Bacteria 3817
209 Ga0207650_10180479 3300025925 Bacteria 1682
210 Ga0207659_10020737 3300025926 Bacteria 4350
211 Ga0207659_10026232 3300025926 Bacteria 3929
212 Ga0207659_10217803 3300025926 Bacteria 1533
213 Ga0207659_10318275 3300025926 Bacteria 1283
214 Ga0207644_10032910 3300025931 Bacteria 3620
215 Ga0207706_10001440 3300025933 Bacteria 23805
216 Ga0207706_10072857 3300025933 Bacteria 3020
217 Ga0207686_10004035 3300025934 Bacteria 7876
218 Ga0207670_10010063 3300025936 Bacteria 5428
219 Ga0207670_10099271 3300025936 Unclassified 2076
220 Ga0207670_10183676 3300025936 Bacteria 1577
221 Ga0207691_10014492 3300025940 Bacteria 7518
222 Ga0207691_10057122 3300025940 Bacteria 3553
223 Ga0207689_10012226 3300025942 Bacteria 7344
224 Ga0207689_10014494 3300025942 Bacteria 6707
225 Ga0207689_10020737 3300025942 Bacteria 5526
226 Ga0207661_10071747 3300025944 Bacteria 2831
227 Ga0207679_10019405 3300025945 Bacteria 4566
228 Ga0207679_10300539 3300025945 Bacteria 1383
229 Ga0207667_10238276 3300025949 Bacteria 1862
230 Ga0207667_10270311 3300025949 Bacteria 1738
231 Ga0207651_10001624 3300025960 Bacteria 10313
232 Ga0207651_10014708 3300025960 Bacteria 4527
233 Ga0207651_10049443 3300025960 Bacteria 2849
234 Ga0207651_10117535 3300025960 Bacteria 2009
235 Ga0207712_10000867 3300025961 Bacteria 22041
236 Ga0207712_10124240 3300025961 Bacteria 1957
237 Ga0207712_10316532 3300025961 Bacteria 1286
238 Ga0207668_10013321 3300025972 Bacteria 5059
239 Ga0207668_10224970 3300025972 Bacteria 1509
240 Ga0207640_10047482 3300025981 Unclassified 2770
241 Ga0207640_10078814 3300025981 Bacteria 2244
242 Ga0207658_10041558 3300025986 Bacteria 3330
243 Ga0207658_10065950 3300025986 Bacteria 2721
244 Ga0207677_10009369 3300026023 Bacteria 5510
245 Ga0207677_10100380 3300026023 Bacteria 2128
246 Ga0207703_10134011 3300026035 Bacteria 2143
247 Ga0207639_10181204 3300026041 Unclassified 1792
248 Ga0207708_10100491 3300026075 Bacteria 2238
249 Ga0207702_10194997 3300026078 Bacteria 1874
250 Ga0207641_10001256 3300026088 Bacteria 25238
251 Ga0207648_10014195 3300026089 Bacteria 7367
252 Ga0207648_10033602 3300026089 Bacteria 4524
253 Ga0207648_10234565 3300026089 Bacteria 1633
254 Ga0207676_10043567 3300026095 Bacteria 3457
255 Ga0207676_10146029 3300026095 Bacteria 2032
256 Ga0207676_10148423 3300026095 Bacteria 2016
257 Ga0207676_10350597 3300026095 Bacteria 1365
258 Ga0207674_10019517 3300026116 Bacteria 7340
259 Ga0207674_10019624 3300026116 Bacteria 7320
260 Ga0207675_100000685 3300026118 Bacteria 33367
261 Ga0207675_100025431 3300026118 Bacteria 5511
262 Ga0207683_10013460 3300026121 Bacteria 6979
263 Ga0207698_10170127 3300026142 Bacteria 1917
264 Ga0207428_10071362 3300027907 Bacteria 2727
265 Ga0207428_10072562 3300027907 Unclassified 2702
266 Ga0268266_10003844 3300028379 Bacteria 14659
267 Ga0268266_10045930 3300028379 Bacteria 3738
268 Ga0268266_10333983 3300028379 Bacteria 1421
269 Ga0268265_10003213 3300028380 Bacteria 11865
270 Ga0268265_10188658 3300028380 Bacteria 1778
271 Ga0268264_10039060 3300028381 Bacteria 3921
272 Ga0265338_10124150 3300028800 Unclassified 2052
273 Ga0307511_10000307 3300030521 Bacteria 51905
274 Ga0265327_10000060 3300031251 Bacteria 234933
275 Ga0307516_10033179 3300031730 Bacteria 5196
276 Ga0373933_0050909 3300035724 Bacteria 2474
277 Ga0373947_0051440 3300035725 Bacteria 2479
278 Ga0373937_0234367 3300036401 Unclassified 1729
279 Ga0436365_0424004 3300039437 Bacteria 14497
280 Ga0436365_1420516 3300039437 Bacteria 6143
281 Ga0439431_0002526 3300041997 Bacteria 4046
282 Ga0439441_005219 3300042001 Bacteria 2006
283 Ga0439445_0017060 3300042004 Bacteria 1792
284 Ga0439449_0003179 3300042007 Bacteria 6400
285 Ga0450923_000730 3300042125 Bacteria 3895
286 Ga0439446_0013283 3300042156 Bacteria 2259
287 Ga0439446_0041554 3300042156 Bacteria 1356
288 Ga0439460_0008439 3300042461 Bacteria 2604
289 Ga0453683_0000827 3300044673 Bacteria 30023
290 Ga0453683_0010575 3300044673 Bacteria 6110
291 Ga0466964_0053237 3300044706 Bacteria 1665
292 Ga0466964_0065149 3300044706 Bacteria 1526
293 Ga0453684_0267889 3300044712 Unclassified 1954
294 Ga0495628_0031868 3300046516 Bacteria 4261
295 Ga0495643_0015712 3300046522 Bacteria 4465
296 Ga0495656_0002223 3300046615 Bacteria 6414
297 Ga0495659_0077913 3300046664 Bacteria 1253
298 Ga0495588_0151916 3300046674 Bacteria 1224
299 Ga0495613_0020391 3300046689 Bacteria 4941
300 Ga0495636_0000077 3300047318 Bacteria 40716
301 Ga0495686_0000005 3300047472 Bacteria 827143
302 Ga0496100_0324879 3300048903 Bacteria 1157
303 Ga0496110_0000116 3300048913 Bacteria 44033
304 Ga0496110_0002584 3300048913 Bacteria 13614
305 Ga0496111_0085747 3300048914 Bacteria 2303
306 Ga0496112_0026919 3300048915 Bacteria 5542
307 Ga0496112_0067315 3300048915 Bacteria 3535
308 Ga0496115_0036364 3300048918 Bacteria 3898
309 Ga0496124_0000003 3300048927 Bacteria 1300161
310 Ga0496126_0006975 3300048929 Bacteria 12491
311 Ga0496126_0020960 3300048929 Bacteria 6397
312 Ga0501031_0005756 3300049568 Bacteria 8074
313 Ga0501031_0010735 3300049568 Bacteria 5967
314 Ga0501036_0052880 3300049572 Bacteria 3440
315 Ga0501036_0055978 3300049572 Bacteria 3341
316 Ga0501036_0081567 3300049572 Bacteria 2733
317 Ga0501037_0021163 3300049573 Bacteria 4806
318 Ga0501037_0280757 3300049573 Unclassified 1160
319 Ga0501038_0001807 3300049574 Bacteria 19813
320 Ga0501038_0009440 3300049574 Bacteria 8954
321 Ga0501039_0005063 3300049575 Bacteria 9993
322 Ga0501039_0007079 3300049575 Bacteria 8545
323 Ga0501039_0029875 3300049575 Bacteria 4199
324 Ga0501039_0042793 3300049575 Bacteria 3499
325 Ga0501039_0237221 3300049575 Bacteria 1434
326 Ga0501040_0001405 3300049576 Bacteria 15219
327 Ga0501040_0001608 3300049576 Bacteria 14399
328 Ga0501040_0050334 3300049576 Bacteria 2849
329 Ga0501040_0136101 3300049576 Bacteria 1730
330 Ga0501041_0000441 3300049577 Bacteria 21027
331 Ga0501041_0001730 3300049577 Bacteria 12254
332 Ga0501041_0005778 3300049577 Bacteria 7230
333 Ga0501042_0005149 3300049578 Bacteria 8392
334 Ga0501042_0014185 3300049578 Bacteria 5435
335 Ga0501042_0032353 3300049578 Bacteria 3703
336 Ga0501042_0035570 3300049578 Bacteria 3533
337 Ga0501043_0033475 3300049579 Bacteria 4043
338 Ga0501043_0168104 3300049579 Bacteria 1712
339 Ga0501046_0033877 3300049580 Bacteria 4124
340 Ga0501047_0246267 3300049581 Bacteria 1637
341 Ga0501048_0002680 3300049582 Bacteria 13591
342 Ga0501048_0017034 3300049582 Bacteria 5354
343 Ga0501048_0233685 3300049582 Bacteria 1304
344 Ga0501068_0001106 3300049584 Bacteria 14288
345 Ga0501068_0026570 3300049584 Bacteria 3412
346 Ga0501069_0025817 3300049585 Bacteria 3213
347 Ga0501070_0040304 3300049586 Bacteria 3895
348 Ga0501071_0001900 3300049587 Bacteria 12434
349 Ga0501071_0002454 3300049587 Bacteria 11261
350 Ga0501071_0003788 3300049587 Bacteria 9502
351 Ga0501071_0028911 3300049587 Bacteria 3908
352 Ga0501072_0001079 3300049588 Bacteria 20269
353 Ga0501072_0002764 3300049588 Bacteria 13187
354 Ga0501072_0004498 3300049588 Bacteria 10596
355 Ga0501072_0081124 3300049588 Bacteria 2571
356 Ga0501072_0100253 3300049588 Bacteria 2302
357 Ga0501074_0010534 3300049590 Bacteria 6708
358 Ga0501074_0028831 3300049590 Bacteria 4021
359 Ga0501074_0050928 3300049590 Bacteria 2989
360 Ga0501074_0063887 3300049590 Bacteria 2651
361 Ga0501075_0001576 3300049591 Bacteria 14904
362 Ga0501075_0003334 3300049591 Bacteria 10733
363 Ga0501075_0016625 3300049591 Bacteria 5304
364 Ga0501075_0066519 3300049591 Bacteria 2719
365 Ga0501075_0318773 3300049591 Bacteria 1185
366 Ga0501076_0001986 3300049592 Bacteria 13978
367 Ga0501076_0008689 3300049592 Bacteria 7460
368 Ga0501076_0010917 3300049592 Bacteria 6757
369 Ga0501076_0040747 3300049592 Bacteria 3650
370 Ga0501076_0142646 3300049592 Bacteria 1946
371 Ga0501076_0147645 3300049592 Bacteria 1912
372 Ga0501076_0243336 3300049592 Bacteria 1472
373 Ga0501077_0073952 3300049593 Unclassified 2159
374 Ga0501077_0077912 3300049593 Bacteria 2100
375 Ga0501079_0026393 3300049741 Bacteria 4453
376 Ga0501079_0163241 3300049741 Bacteria 1737
377 Ga0501080_0002649 3300049742 Bacteria 15651
378 Ga0501080_0026064 3300049742 Bacteria 5430
379 Ga0501080_0104663 3300049742 Bacteria 2624
380 Ga0501081_0008606 3300049743 Bacteria 6632
381 Ga0501081_0015057 3300049743 Bacteria 5103
382 Ga0501081_0023512 3300049743 Bacteria 4131
383 Ga0501081_0056199 3300049743 Bacteria 2719
384 Ga0501081_0068165 3300049743 Bacteria 2476
385 Ga0501081_0083750 3300049743 Bacteria 2236
386 Ga0501081_0094562 3300049743 Bacteria 2106
387 Ga0501083_0011388 3300049744 Bacteria 6240
388 Ga0501083_0047412 3300049744 Bacteria 2903
389 Ga0501083_0100620 3300049744 Bacteria 1906
390 Ga0501035_0007693 3300049822 Bacteria 10066
391 Ga0501045_0000202 3300049824 Bacteria 33849
392 Ga0501045_0002066 3300049824 Bacteria 13558
393 Ga0501045_0012118 3300049824 Bacteria 6067
394 Ga0501045_0074637 3300049824 Bacteria 2497
395 Ga0501045_0169361 3300049824 Bacteria 1627
396 nmdc:mga0k408_36766_c1 3300050493 Bacteria 2811
397 nmdc:mga0k408_45741_c1 3300050493 Bacteria 2526
398 nmdc:mga06z11_107912_c1 3300050494 Bacteria 1537
399 nmdc:mga05p37_26476_c1 3300050507 Bacteria 5956
400 nmdc:mga05p37_409369_c1 3300050507 Bacteria 1581
401 nmdc:mga09592_11510_c1 3300050508 Bacteria 7199
402 nmdc:mga0qj67_20084_c1 3300050509 Bacteria 5113
403 nmdc:mga0qj67_57354_c1 3300050509 Bacteria 3087
404 nmdc:mga06r32_4756_c1 3300050510 Bacteria 11197
405 nmdc:mga06r32_79015_c1 3300050510 Bacteria 3199
406 nmdc:mga08y16_1783_c1 3300050511 Bacteria 21805
407 nmdc:mga08y16_35162_c1 3300050511 Bacteria 5263
408 nmdc:mga08y16_50884_c1 3300050511 Bacteria 4335
409 nmdc:mga08y16_64666_c1 3300050511 Bacteria 3819
410 nmdc:mga0n895_23098_c1 3300050512 Bacteria 5056
411 nmdc:mga0n895_51531_c1 3300050512 Bacteria 4038
412 nmdc:mga0a205_185607_c1 3300050515 Bacteria 1973
413 nmdc:mga0sz30_13747_c1 3300050516 Bacteria 3174
414 Ga0500641_0036123 3300053096 Bacteria 1975
415 Ga0500592_004105 3300053116 Unclassified 2323
416 Ga0500568_0012456 3300053139 Bacteria 3910
417 Ga0500604_0001530 3300053151 Bacteria 6467
418 Ga0501084_0001710 3300054114 Bacteria 17418
419 Ga0501084_0016845 3300054114 Bacteria 6071
420 Ga0501084_0027175 3300054114 Bacteria 4782
421 Ga0501084_0082264 3300054114 Bacteria 2701
422 Ga0501084_0090504 3300054114 Bacteria 2569
423 Ga0501084_0104492 3300054114 Bacteria 2379
424 Ga0501082_0003577 3300060353 Bacteria 13568
425 Ga0501082_0009884 3300060353 Bacteria 8221
426 Ga0501082_0023840 3300060353 Bacteria 5276
427 Ga0501082_0078581 3300060353 Bacteria 2846
428 Ga0501082_0103453 3300060353 Bacteria 2463
429 Ga0530510_0002187 3300061734 Bacteria 13406
430 Ga0530510_0002250 3300061734 Bacteria 13236
431 Ga0530510_0003357 3300061734 Bacteria 11013
432 Ga0530510_0025453 3300061734 Bacteria 4232
433 Ga0530510_0126598 3300061734 Bacteria 1878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10000060 Ga0265327_1000006095 295
2 3300026089 Ga0207648_10033602 Ga0207648_100336026 302
3 3300026095 Ga0207676_10146029 Ga0207676_101460291 302
4 3300046674 Ga0495588_0151916 Ga0495588_0151916_13_954 302
5 3300014745 Ga0157377_10098969 Ga0157377_100989692 308
6 3300005354 Ga0070675_100309300 Ga0070675_1003093001 309
7 3300005364 Ga0070673_100415995 Ga0070673_1004159951 309
8 3300005458 Ga0070681_10181854 Ga0070681_101818542 309
9 3300005616 Ga0068852_100147806 Ga0068852_1001478062 309
10 3300005834 Ga0068851_10060390 Ga0068851_100603902 309
11 3300006358 Ga0068871_100069099 Ga0068871_1000690992 309
12 3300013100 Ga0157373_10062649 Ga0157373_100626492 309
13 3300013105 Ga0157369_10104868 Ga0157369_101048683 309
14 3300014969 Ga0157376_10139520 Ga0157376_101395202 309
15 3300025926 Ga0207659_10318275 Ga0207659_103182751 309
16 3300025949 Ga0207667_10270311 Ga0207667_102703112 309
17 3300026023 Ga0207677_10100380 Ga0207677_101003801 309
18 3300026089 Ga0207648_10234565 Ga0207648_102345652 309
19 3300026142 Ga0207698_10170127 Ga0207698_101701272 309
20 3300005563 Ga0068855_100142572 Ga0068855_1001425723 310
21 3300013104 Ga0157370_10313768 Ga0157370_103137681 310
22 3300013297 Ga0157378_10119181 Ga0157378_101191812 310
23 3300009553 Ga0105249_10021809 Ga0105249_100218095 314
24 3300013308 Ga0157375_10082067 Ga0157375_100820672 314
25 3300014326 Ga0157380_10019431 Ga0157380_100194313 314
26 3300014745 Ga0157377_10002160 Ga0157377_100021607 314
27 3300050511 nmdc:mga08y16_1783_c1 nmdc:mga08y16_1783_c1_2165_3226 314
28 3300005334 Ga0068869_100009428 Ga0068869_1000094285 316
29 3300005340 Ga0070689_100043673 Ga0070689_1000436732 316
30 3300005354 Ga0070675_100001195 Ga0070675_1000011959 316
31 3300005365 Ga0070688_100038531 Ga0070688_1000385312 316
32 3300005578 Ga0068854_100033255 Ga0068854_1000332552 316
33 3300005617 Ga0068859_100031388 Ga0068859_1000313883 316
34 3300005719 Ga0068861_100036032 Ga0068861_1000360323 316
35 3300005840 Ga0068870_10001863 Ga0068870_100018639 316
36 3300005844 Ga0068862_100006480 Ga0068862_1000064809 316
37 3300006931 Ga0097620_100031386 Ga0097620_1000313863 316
38 3300025923 Ga0207681_10058077 Ga0207681_100580772 316
39 3300025936 Ga0207670_10099271 Ga0207670_100992712 316
40 3300025942 Ga0207689_10012226 Ga0207689_100122264 316
41 3300025961 Ga0207712_10316532 Ga0207712_103165321 316
42 3300025972 Ga0207668_10013321 Ga0207668_100133213 316
43 3300025981 Ga0207640_10047482 Ga0207640_100474823 316
44 3300026116 Ga0207674_10019624 Ga0207674_100196244 316
45 3300026118 Ga0207675_100000685 Ga0207675_10000068516 316
46 3300028380 Ga0268265_10003213 Ga0268265_100032139 316
47 3300044673 Ga0453683_0010575 Ga0453683_0010575_3147_4166 316
48 3300049591 Ga0501075_0318773 Ga0501075_0318773_10_984 316
49 3300049592 Ga0501076_0243336 Ga0501076_0243336_486_1460 316
50 3300050493 nmdc:mga0k408_45741_c1 nmdc:mga0k408_45741_c1_1184_2242 317
51 3300005985 Ga0081539_10005364 Ga0081539_100053649 318
52 3300013296 Ga0157374_10378270 Ga0157374_103782702 318
53 3300053139 Ga0500568_0012456 Ga0500568_0012456_234_1262 318
54 3300003203 JGI25406J46586_10048832 JGI25406J46586_100488321 319
55 3300050507 nmdc:mga05p37_26476_c1 nmdc:mga05p37_26476_c1_14_991 319
56 3300005330 Ga0070690_100151687 Ga0070690_1001516872 320
57 3300005343 Ga0070687_100065191 Ga0070687_1000651912 320
58 3300005355 Ga0070671_100004461 Ga0070671_1000044617 320
59 3300005438 Ga0070701_10067908 Ga0070701_100679082 320
60 3300005459 Ga0068867_100052198 Ga0068867_1000521982 320
61 3300005543 Ga0070672_100147944 Ga0070672_1001479442 320
62 3300005564 Ga0070664_100029927 Ga0070664_1000299272 320
63 3300005615 Ga0070702_100091870 Ga0070702_1000918702 320
64 3300005618 Ga0068864_100281633 Ga0068864_1002816332 320
65 3300013297 Ga0157378_10006247 Ga0157378_100062478 320
66 3300025907 Ga0207645_10026623 Ga0207645_100266233 320
67 3300025940 Ga0207691_10057122 Ga0207691_100571222 320
68 3300025945 Ga0207679_10019405 Ga0207679_100194053 320
69 3300026023 Ga0207677_10009369 Ga0207677_100093691 320
70 3300026089 Ga0207648_10014195 Ga0207648_100141953 320
71 3300026095 Ga0207676_10350597 Ga0207676_103505972 320
72 3300026121 Ga0207683_10013460 Ga0207683_100134602 320
73 3300006880 Ga0075429_100099408 Ga0075429_1000994082 321
74 3300044673 Ga0453683_0000827 Ga0453683_0000827_116_1159 321
75 3300044712 Ga0453684_0267889 Ga0453684_0267889_84_1127 321
76 3300003316 rootH1_10051465 rootH1_100514652 322
77 3300005335 Ga0070666_10024490 Ga0070666_100244903 322
78 3300005343 Ga0070687_100090208 Ga0070687_1000902082 322
79 3300005539 Ga0068853_100122562 Ga0068853_1001225621 322
80 3300014326 Ga0157380_10170761 Ga0157380_101707612 322
81 3300025903 Ga0207680_10019728 Ga0207680_100197282 322
82 3300026118 Ga0207675_100025431 Ga0207675_1000254314 322
83 3300005293 Ga0065715_10101327 Ga0065715_101013272 323
84 3300005334 Ga0068869_100023688 Ga0068869_1000236884 323
85 3300005354 Ga0070675_100076777 Ga0070675_1000767772 323
86 3300005364 Ga0070673_100012331 Ga0070673_1000123313 323
87 3300005364 Ga0070673_100135601 Ga0070673_1001356012 323
88 3300005365 Ga0070688_100009028 Ga0070688_1000090283 323
89 3300005466 Ga0070685_10006363 Ga0070685_100063633 323
90 3300005539 Ga0068853_100037298 Ga0068853_1000372983 323
91 3300005618 Ga0068864_100088901 Ga0068864_1000889012 323
92 3300005840 Ga0068870_10005615 Ga0068870_100056153 323
93 3300005843 Ga0068860_100302206 Ga0068860_1003022062 323
94 3300006358 Ga0068871_100073580 Ga0068871_1000735802 323
95 3300006844 Ga0075428_100091598 Ga0075428_1000915982 323
96 3300006880 Ga0075429_100152765 Ga0075429_1001527651 323
97 3300009094 Ga0111539_10671360 Ga0111539_106713601 323
98 3300009176 Ga0105242_10023186 Ga0105242_100231864 323
99 3300013296 Ga0157374_10289824 Ga0157374_102898241 323
100 3300013306 Ga0163162_10427778 Ga0163162_104277782 323
101 3300025899 Ga0207642_10142275 Ga0207642_101422751 323
102 3300025901 Ga0207688_10125348 Ga0207688_101253482 323
103 3300025926 Ga0207659_10020737 Ga0207659_100207372 323
104 3300025934 Ga0207686_10004035 Ga0207686_100040356 323
105 3300025936 Ga0207670_10010063 Ga0207670_100100632 323
106 3300025940 Ga0207691_10014492 Ga0207691_100144922 323
107 3300025942 Ga0207689_10014494 Ga0207689_100144944 323
108 3300025942 Ga0207689_10020737 Ga0207689_100207374 323
109 3300025960 Ga0207651_10001624 Ga0207651_100016243 323
110 3300025960 Ga0207651_10117535 Ga0207651_101175352 323
111 3300025961 Ga0207712_10124240 Ga0207712_101242402 323
112 3300025981 Ga0207640_10078814 Ga0207640_100788142 323
113 3300026075 Ga0207708_10100491 Ga0207708_101004912 323
114 3300026095 Ga0207676_10148423 Ga0207676_101484232 323
115 3300027907 Ga0207428_10071362 Ga0207428_100713623 323
116 3300028380 Ga0268265_10188658 Ga0268265_101886582 323
117 3300050508 nmdc:mga09592_11510_c1 nmdc:mga09592_11510_c1_3344_4357 323
118 3300050512 nmdc:mga0n895_23098_c1 nmdc:mga0n895_23098_c1_2641_3654 323
119 3300053096 Ga0500641_0036123 Ga0500641_0036123_821_1849 323
120 3300005471 Ga0070698_100002180 Ga0070698_1000021806 324
121 3300006844 Ga0075428_100047581 Ga0075428_1000475811 324
122 3300006846 Ga0075430_100015202 Ga0075430_1000152024 324
123 3300009147 Ga0114129_10602242 Ga0114129_106022421 324
124 3300009553 Ga0105249_10001673 Ga0105249_1000167317 324
125 3300025961 Ga0207712_10000867 Ga0207712_1000086713 324
126 3300026088 Ga0207641_10001256 Ga0207641_1000125615 324
127 3300026116 Ga0207674_10019517 Ga0207674_100195172 324
128 3300031730 Ga0307516_10033179 Ga0307516_100331793 324
129 3300042001 Ga0439441_005219 Ga0439441_005219_741_1757 324
130 3300044706 Ga0466964_0053237 Ga0466964_0053237_503_1534 324
131 3300049741 Ga0501079_0163241 Ga0501079_0163241_24_1004 324
132 3300050507 nmdc:mga05p37_409369_c1 nmdc:mga05p37_409369_c1_345_1370 324
133 3300050509 nmdc:mga0qj67_20084_c1 nmdc:mga0qj67_20084_c1_2852_3877 324
134 3300050510 nmdc:mga06r32_4756_c1 nmdc:mga06r32_4756_c1_8136_9161 324
135 3300003203 JGI25406J46586_10001278 JGI25406J46586_1000127810 325
136 3300005327 Ga0070658_10112756 Ga0070658_101127562 325
137 3300005329 Ga0070683_100161878 Ga0070683_1001618783 325
138 3300005339 Ga0070660_100134492 Ga0070660_1001344923 325
139 3300005344 Ga0070661_100143846 Ga0070661_1001438462 325
140 3300005457 Ga0070662_100041874 Ga0070662_1000418742 325
141 3300005539 Ga0068853_100042316 Ga0068853_1000423162 325
142 3300005614 Ga0068856_100110046 Ga0068856_1001100462 325
143 3300005985 Ga0081539_10000147 Ga0081539_10000147124 325
144 3300013102 Ga0157371_10063869 Ga0157371_100638692 325
145 3300013306 Ga0163162_10126978 Ga0163162_101269782 325
146 3300013307 Ga0157372_10044662 Ga0157372_100446622 325
147 3300025909 Ga0207705_10293162 Ga0207705_102931622 325
148 3300025919 Ga0207657_10001473 Ga0207657_1000147325 325
149 3300025944 Ga0207661_10071747 Ga0207661_100717472 325
150 3300025945 Ga0207679_10300539 Ga0207679_103005392 325
151 3300026078 Ga0207702_10194997 Ga0207702_101949971 325
152 3300026095 Ga0207676_10043567 Ga0207676_100435671 325
153 iso_pu_bacteria 2881955468 2881956226 325
154 3300005295 Ga0065707_10091144 Ga0065707_100911443 326
155 3300005295 Ga0065707_10147765 Ga0065707_101477652 326
156 3300005985 Ga0081539_10005759 Ga0081539_1000575910 326
157 3300025933 Ga0207706_10001440 Ga0207706_100014405 326
158 3300035725 Ga0373947_0051440 Ga0373947_0051440_55_1083 326
159 3300041997 Ga0439431_0002526 Ga0439431_0002526_665_1792 326
160 3300042004 Ga0439445_0017060 Ga0439445_0017060_79_1164 326
161 3300042125 Ga0450923_000730 Ga0450923_000730_1197_2273 326
162 3300042156 Ga0439446_0041554 Ga0439446_0041554_131_1258 326
163 3300047472 Ga0495686_0000005 Ga0495686_0000005_294216_295250 326
164 3300005290 Ga0065712_10084227 Ga0065712_100842272 327
165 3300005328 Ga0070676_10119843 Ga0070676_101198431 327
166 3300005331 Ga0070670_100002838 Ga0070670_10000283812 327
167 3300005331 Ga0070670_100034962 Ga0070670_1000349623 327
168 3300005335 Ga0070666_10063851 Ga0070666_100638511 327
169 3300005354 Ga0070675_100088308 Ga0070675_1000883082 327
170 3300005355 Ga0070671_100002766 Ga0070671_10000276610 327
171 3300005364 Ga0070673_100044704 Ga0070673_1000447042 327
172 3300005367 Ga0070667_100013848 Ga0070667_1000138483 327
173 3300005456 Ga0070678_100199260 Ga0070678_1001992601 327
174 3300005548 Ga0070665_100165449 Ga0070665_1001654492 327
175 3300005577 Ga0068857_100335982 Ga0068857_1003359822 327
176 3300005842 Ga0068858_100176329 Ga0068858_1001763292 327
177 3300006237 Ga0097621_100061436 Ga0097621_1000614364 327
178 3300013308 Ga0157375_10002708 Ga0157375_1000270814 327
179 3300014326 Ga0157380_10015165 Ga0157380_100151653 327
180 3300025893 Ga0207682_10050548 Ga0207682_100505482 327
181 3300025903 Ga0207680_10032587 Ga0207680_100325871 327
182 3300025925 Ga0207650_10001707 Ga0207650_1000170712 327
183 3300025925 Ga0207650_10021044 Ga0207650_100210443 327
184 3300025926 Ga0207659_10026232 Ga0207659_100262323 327
185 3300025931 Ga0207644_10032910 Ga0207644_100329104 327
186 3300025936 Ga0207670_10183676 Ga0207670_101836761 327
187 3300025960 Ga0207651_10049443 Ga0207651_100494432 327
188 3300025986 Ga0207658_10041558 Ga0207658_100415582 327
189 3300028379 Ga0268266_10333983 Ga0268266_103339832 327
190 3300042007 Ga0439449_0003179 Ga0439449_0003179_3415_4482 327
191 iso_pu_bacteria 2840677318 2840678509 327
192 iso_pu_bacteria 2896085136 2896086327 327
193 3300000545 CNXas_1000011 CNXas_100001126 328
194 3300005328 Ga0070676_10027219 Ga0070676_100272193 328
195 3300005328 Ga0070676_10062776 Ga0070676_100627762 328
196 3300005331 Ga0070670_100019496 Ga0070670_1000194963 328
197 3300005331 Ga0070670_100040286 Ga0070670_1000402863 328
198 3300005331 Ga0070670_100107880 Ga0070670_1001078803 328
199 3300005335 Ga0070666_10035922 Ga0070666_100359223 328
200 3300005340 Ga0070689_100107967 Ga0070689_1001079672 328
201 3300005347 Ga0070668_100147697 Ga0070668_1001476972 328
202 3300005353 Ga0070669_100178104 Ga0070669_1001781041 328
203 3300005354 Ga0070675_100024809 Ga0070675_1000248093 328
204 3300005354 Ga0070675_100150769 Ga0070675_1001507693 328
205 3300005354 Ga0070675_100225435 Ga0070675_1002254352 328
206 3300005355 Ga0070671_100031890 Ga0070671_1000318903 328
207 3300005355 Ga0070671_100087685 Ga0070671_1000876852 328
208 3300005356 Ga0070674_100032246 Ga0070674_1000322465 328
209 3300005356 Ga0070674_100231589 Ga0070674_1002315891 328
210 3300005364 Ga0070673_100038399 Ga0070673_1000383995 328
211 3300005364 Ga0070673_100057723 Ga0070673_1000577232 328
212 3300005365 Ga0070688_100011239 Ga0070688_1000112392 328
213 3300005367 Ga0070667_100161047 Ga0070667_1001610473 328
214 3300005456 Ga0070678_100209390 Ga0070678_1002093902 328
215 3300005459 Ga0068867_100134189 Ga0068867_1001341892 328
216 3300005543 Ga0070672_100032657 Ga0070672_1000326573 328
217 3300005548 Ga0070665_100007464 Ga0070665_1000074645 328
218 3300005616 Ga0068852_100336425 Ga0068852_1003364252 328
219 3300005842 Ga0068858_100301678 Ga0068858_1003016782 328
220 3300006358 Ga0068871_100116146 Ga0068871_1001161463 328
221 3300006871 Ga0075434_100221466 Ga0075434_1002214663 328
222 3300009553 Ga0105249_10168881 Ga0105249_101688812 328
223 3300013102 Ga0157371_10009208 Ga0157371_100092086 328
224 3300013297 Ga0157378_10035854 Ga0157378_100358543 328
225 3300013297 Ga0157378_10125100 Ga0157378_101251003 328
226 3300013297 Ga0157378_10444711 Ga0157378_104447112 328
227 3300013306 Ga0163162_10035406 Ga0163162_100354062 328
228 3300013306 Ga0163162_10243027 Ga0163162_102430272 328
229 3300013307 Ga0157372_10037289 Ga0157372_100372894 328
230 3300017792 Ga0163161_10060718 Ga0163161_100607182 328
231 3300025315 Ga0207697_10000411 Ga0207697_100004115 328
232 3300025893 Ga0207682_10021284 Ga0207682_100212843 328
233 3300025901 Ga0207688_10005995 Ga0207688_100059955 328
234 3300025923 Ga0207681_10143247 Ga0207681_101432472 328
235 3300025925 Ga0207650_10031736 Ga0207650_100317363 328
236 3300025925 Ga0207650_10180479 Ga0207650_101804792 328
237 3300025926 Ga0207659_10217803 Ga0207659_102178032 328
238 3300025933 Ga0207706_10072857 Ga0207706_100728573 328
239 3300025960 Ga0207651_10014708 Ga0207651_100147082 328
240 3300025972 Ga0207668_10224970 Ga0207668_102249701 328
241 3300025986 Ga0207658_10065950 Ga0207658_100659502 328
242 3300026035 Ga0207703_10134011 Ga0207703_101340112 328
243 3300028379 Ga0268266_10045930 Ga0268266_100459301 328
244 3300035724 Ga0373933_0050909 Ga0373933_0050909_218_1342 328
245 3300036401 Ga0373937_0234367 Ga0373937_0234367_206_1354 328
246 3300046516 Ga0495628_0031868 Ga0495628_0031868_2766_3890 328
247 3300046689 Ga0495613_0020391 Ga0495613_0020391_3284_4408 328
248 3300047318 Ga0495636_0000077 Ga0495636_0000077_12835_13866 328
249 3300048903 Ga0496100_0324879 Ga0496100_0324879_20_1132 328
250 3300048915 Ga0496112_0026919 Ga0496112_0026919_270_1400 328
251 3300048915 Ga0496112_0067315 Ga0496112_0067315_1109_2200 328
252 3300048918 Ga0496115_0036364 Ga0496115_0036364_2559_3695 328
253 3300053116 Ga0500592_004105 Ga0500592_004105_745_1764 328
254 3300005539 Ga0068853_100216098 Ga0068853_1002160982 329
255 3300005548 Ga0070665_100004098 Ga0070665_1000040982 329
256 3300005577 Ga0068857_100383093 Ga0068857_1003830932 329
257 3300009093 Ga0105240_10000101 Ga0105240_1000010152 329
258 3300009545 Ga0105237_10023518 Ga0105237_100235187 329
259 3300010375 Ga0105239_10000277 Ga0105239_1000027760 329
260 3300010375 Ga0105239_10212938 Ga0105239_102129383 329
261 3300013297 Ga0157378_10025119 Ga0157378_100251195 329
262 3300021384 Ga0213876_10007398 Ga0213876_100073986 329
263 3300025904 Ga0207647_10007137 Ga0207647_100071377 329
264 3300025913 Ga0207695_10000020 Ga0207695_10000020647 329
265 3300025913 Ga0207695_10012575 Ga0207695_100125752 329
266 3300025914 Ga0207671_10000443 Ga0207671_100004437 329
267 3300026041 Ga0207639_10181204 Ga0207639_101812042 329
268 3300028379 Ga0268266_10003844 Ga0268266_100038442 329
269 3300028800 Ga0265338_10124150 Ga0265338_101241502 329
270 3300039437 Ga0436365_1420516 Ga0436365_1420516_4394_5437 329
271 3300046522 Ga0495643_0015712 Ga0495643_0015712_2008_3090 329
272 3300050510 nmdc:mga06r32_79015_c1 nmdc:mga06r32_79015_c1_1436_2476 333
273 3300006871 Ga0075434_100059711 Ga0075434_1000597114 334
274 3300050512 nmdc:mga0n895_51531_c1 nmdc:mga0n895_51531_c1_2128_3225 334
275 iso_pu_bacteria 8001522603 8001524492 347
276 3300005981 Ga0081538_10039232 Ga0081538_100392324 348
277 3300006846 Ga0075430_100194659 Ga0075430_1001946592 350
278 3300049744 Ga0501083_0047412 Ga0501083_0047412_1210_2283 351
279 3300006852 Ga0075433_10095523 Ga0075433_100955232 352
280 3300006871 Ga0075434_100239873 Ga0075434_1002398732 352
281 3300009094 Ga0111539_10033541 Ga0111539_100335412 352
282 3300050511 nmdc:mga08y16_50884_c1 nmdc:mga08y16_50884_c1_324_1397 352
283 3300050515 nmdc:mga0a205_185607_c1 nmdc:mga0a205_185607_c1_423_1529 352
284 3300003203 JGI25406J46586_10005104 JGI25406J46586_100051042 353
285 3300005985 Ga0081539_10002062 Ga0081539_1000206214 353
286 3300005545 Ga0070695_100000612 Ga0070695_1000006127 354
287 3300005549 Ga0070704_100037276 Ga0070704_1000372764 354
288 3300005981 Ga0081538_10001732 Ga0081538_1000173216 354
289 3300005981 Ga0081538_10006603 Ga0081538_100066038 354
290 3300005983 Ga0081540_1064317 Ga0081540_10643172 354
291 3300006844 Ga0075428_100085703 Ga0075428_1000857033 354
292 3300009147 Ga0114129_10029138 Ga0114129_100291382 354
293 3300009551 Ga0105238_10021657 Ga0105238_100216572 354
294 3300046664 Ga0495659_0077913 Ga0495659_0077913_144_1241 354
295 3300005295 Ga0065707_10135789 Ga0065707_101357892 355
296 3300005354 Ga0070675_100163366 Ga0070675_1001633662 355
297 3300005937 Ga0081455_10081989 Ga0081455_100819893 355
298 3300006051 Ga0075364_10014842 Ga0075364_100148425 355
299 3300006195 Ga0075366_10016882 Ga0075366_100168823 355
300 3300009094 Ga0111539_10067938 Ga0111539_100679382 355
301 3300042461 Ga0439460_0008439 Ga0439460_0008439_1292_2374 355
302 3300050493 nmdc:mga0k408_36766_c1 nmdc:mga0k408_36766_c1_1410_2531 355
303 3300050494 nmdc:mga06z11_107912_c1 nmdc:mga06z11_107912_c1_441_1523 355
304 3300050511 nmdc:mga08y16_64666_c1 nmdc:mga08y16_64666_c1_2368_3471 355
305 iso_pu_bacteria 8015556637 8015557489 355
306 3300005435 Ga0070714_100149891 Ga0070714_1001498912 356
307 3300005458 Ga0070681_10011891 Ga0070681_100118918 356
308 3300005545 Ga0070695_100031413 Ga0070695_1000314133 356
309 3300005549 Ga0070704_100070094 Ga0070704_1000700941 356
310 3300009545 Ga0105237_10152210 Ga0105237_101522102 356
311 3300025924 Ga0207694_10240524 Ga0207694_102405242 356
312 3300025949 Ga0207667_10238276 Ga0207667_102382762 356
313 3300028381 Ga0268264_10039060 Ga0268264_100390602 356
314 3300042156 Ga0439446_0013283 Ga0439446_0013283_1024_2109 356
315 3300044706 Ga0466964_0065149 Ga0466964_0065149_68_1153 356
316 3300050509 nmdc:mga0qj67_57354_c1 nmdc:mga0qj67_57354_c1_1148_2233 356
317 iso_pu_bacteria 2837183177 2837185212 356
318 3300005334 Ga0068869_100236394 Ga0068869_1002363942 357
319 3300005518 Ga0070699_100084691 Ga0070699_1000846914 357
320 3300009098 Ga0105245_10141018 Ga0105245_101410183 357
321 3300009545 Ga0105237_10270555 Ga0105237_102705551 357
322 3300010375 Ga0105239_10005666 Ga0105239_100056665 357
323 3300039437 Ga0436365_0424004 Ga0436365_0424004_4211_5308 357
324 3300049568 Ga0501031_0005756 Ga0501031_0005756_128_1210 357
325 3300049568 Ga0501031_0010735 Ga0501031_0010735_3426_4511 357
326 3300049572 Ga0501036_0052880 Ga0501036_0052880_1354_2439 357
327 3300049572 Ga0501036_0055978 Ga0501036_0055978_922_2004 357
328 3300049572 Ga0501036_0081567 Ga0501036_0081567_124_1206 357
329 3300049573 Ga0501037_0021163 Ga0501037_0021163_1508_2593 357
330 3300049573 Ga0501037_0280757 Ga0501037_0280757_18_1100 357
331 3300049574 Ga0501038_0009440 Ga0501038_0009440_451_1536 357
332 3300049575 Ga0501039_0005063 Ga0501039_0005063_4927_6012 357
333 3300049575 Ga0501039_0007079 Ga0501039_0007079_7334_8416 357
334 3300049575 Ga0501039_0029875 Ga0501039_0029875_2306_3391 357
335 3300049575 Ga0501039_0042793 Ga0501039_0042793_924_2006 357
336 3300049575 Ga0501039_0237221 Ga0501039_0237221_315_1397 357
337 3300049576 Ga0501040_0001405 Ga0501040_0001405_8871_9953 357
338 3300049576 Ga0501040_0001608 Ga0501040_0001608_126_1208 357
339 3300049576 Ga0501040_0050334 Ga0501040_0050334_986_2071 357
340 3300049577 Ga0501041_0000441 Ga0501041_0000441_2625_3707 357
341 3300049577 Ga0501041_0001730 Ga0501041_0001730_2118_3203 357
342 3300049577 Ga0501041_0005778 Ga0501041_0005778_4385_5470 357
343 3300049578 Ga0501042_0032353 Ga0501042_0032353_1039_2124 357
344 3300049578 Ga0501042_0035570 Ga0501042_0035570_2420_3502 357
345 3300049579 Ga0501043_0033475 Ga0501043_0033475_242_1327 357
346 3300049579 Ga0501043_0168104 Ga0501043_0168104_318_1400 357
347 3300049580 Ga0501046_0033877 Ga0501046_0033877_2166_3251 357
348 3300049582 Ga0501048_0002680 Ga0501048_0002680_80_1162 357
349 3300049582 Ga0501048_0017034 Ga0501048_0017034_2242_3327 357
350 3300049584 Ga0501068_0001106 Ga0501068_0001106_1307_2389 357
351 3300049584 Ga0501068_0026570 Ga0501068_0026570_1104_2189 357
352 3300049585 Ga0501069_0025817 Ga0501069_0025817_2109_3194 357
353 3300049586 Ga0501070_0040304 Ga0501070_0040304_1505_2590 357
354 3300049587 Ga0501071_0001900 Ga0501071_0001900_11236_12318 357
355 3300049587 Ga0501071_0002454 Ga0501071_0002454_819_1904 357
356 3300049587 Ga0501071_0003788 Ga0501071_0003788_6882_7967 357
357 3300049587 Ga0501071_0028911 Ga0501071_0028911_1783_2865 357
358 3300049588 Ga0501072_0001079 Ga0501072_0001079_12295_13377 357
359 3300049588 Ga0501072_0002764 Ga0501072_0002764_8374_9459 357
360 3300049588 Ga0501072_0100253 Ga0501072_0100253_694_1776 357
361 3300049590 Ga0501074_0010534 Ga0501074_0010534_3087_4172 357
362 3300049590 Ga0501074_0028831 Ga0501074_0028831_1325_2407 357
363 3300049590 Ga0501074_0050928 Ga0501074_0050928_1581_2663 357
364 3300049591 Ga0501075_0001576 Ga0501075_0001576_11973_13058 357
365 3300049591 Ga0501075_0003334 Ga0501075_0003334_1105_2190 357
366 3300049591 Ga0501075_0066519 Ga0501075_0066519_130_1212 357
367 3300049592 Ga0501076_0001986 Ga0501076_0001986_6943_8025 357
368 3300049592 Ga0501076_0008689 Ga0501076_0008689_1332_2417 357
369 3300049592 Ga0501076_0010917 Ga0501076_0010917_1260_2342 357
370 3300049592 Ga0501076_0040747 Ga0501076_0040747_597_1682 357
371 3300049592 Ga0501076_0142646 Ga0501076_0142646_337_1419 357
372 3300049592 Ga0501076_0147645 Ga0501076_0147645_411_1493 357
373 3300049593 Ga0501077_0077912 Ga0501077_0077912_80_1162 357
374 3300049741 Ga0501079_0026393 Ga0501079_0026393_2264_3349 357
375 3300049742 Ga0501080_0002649 Ga0501080_0002649_10833_11915 357
376 3300049742 Ga0501080_0026064 Ga0501080_0026064_1989_3074 357
377 3300049742 Ga0501080_0104663 Ga0501080_0104663_863_1948 357
378 3300049743 Ga0501081_0008606 Ga0501081_0008606_3202_4287 357
379 3300049743 Ga0501081_0023512 Ga0501081_0023512_647_1729 357
380 3300049743 Ga0501081_0056199 Ga0501081_0056199_1508_2590 357
381 3300049743 Ga0501081_0068165 Ga0501081_0068165_583_1668 357
382 3300049743 Ga0501081_0094562 Ga0501081_0094562_914_1996 357
383 3300049744 Ga0501083_0011388 Ga0501083_0011388_273_1358 357
384 3300049822 Ga0501035_0007693 Ga0501035_0007693_4668_5753 357
385 3300049824 Ga0501045_0000202 Ga0501045_0000202_945_2030 357
386 3300049824 Ga0501045_0002066 Ga0501045_0002066_12362_13444 357
387 3300049824 Ga0501045_0012118 Ga0501045_0012118_818_1903 357
388 3300049824 Ga0501045_0169361 Ga0501045_0169361_173_1255 357
389 3300054114 Ga0501084_0001710 Ga0501084_0001710_9811_10896 357
390 3300054114 Ga0501084_0016845 Ga0501084_0016845_2630_3715 357
391 3300054114 Ga0501084_0027175 Ga0501084_0027175_1942_3024 357
392 3300054114 Ga0501084_0082264 Ga0501084_0082264_1508_2590 357
393 3300054114 Ga0501084_0104492 Ga0501084_0104492_1247_2329 357
394 3300060353 Ga0501082_0003577 Ga0501082_0003577_2073_3158 357
395 3300060353 Ga0501082_0009884 Ga0501082_0009884_7038_8120 357
396 3300060353 Ga0501082_0023840 Ga0501082_0023840_1989_3074 357
397 3300060353 Ga0501082_0103453 Ga0501082_0103453_327_1409 357
398 3300061734 Ga0530510_0002250 Ga0530510_0002250_12056_13138 357
399 3300061734 Ga0530510_0003357 Ga0530510_0003357_8331_9416 357
400 3300061734 Ga0530510_0025453 Ga0530510_0025453_1032_2114 357
401 3300061734 Ga0530510_0126598 Ga0530510_0126598_668_1750 357
402 3300049574 Ga0501038_0001807 Ga0501038_0001807_181_1293 358
403 3300049578 Ga0501042_0005149 Ga0501042_0005149_75_1187 358
404 3300049578 Ga0501042_0014185 Ga0501042_0014185_1680_2768 358
405 3300049582 Ga0501048_0233685 Ga0501048_0233685_133_1221 358
406 3300049588 Ga0501072_0004498 Ga0501072_0004498_7896_8984 358
407 3300049590 Ga0501074_0063887 Ga0501074_0063887_1089_2177 358
408 3300049591 Ga0501075_0016625 Ga0501075_0016625_2878_3966 358
409 3300049593 Ga0501077_0073952 Ga0501077_0073952_761_1849 358
410 3300049743 Ga0501081_0015057 Ga0501081_0015057_1570_2658 358
411 3300049744 Ga0501083_0100620 Ga0501083_0100620_379_1467 358
412 3300049824 Ga0501045_0074637 Ga0501045_0074637_235_1323 358
413 3300054114 Ga0501084_0090504 Ga0501084_0090504_630_1718 358
414 3300060353 Ga0501082_0078581 Ga0501082_0078581_728_1816 358
415 3300061734 Ga0530510_0002187 Ga0530510_0002187_2805_3893 358
416 2162886007 SwRhRL2b_contig_674391 SwRhRL2b_0813.00001800 359
417 3300005289 Ga0065704_10070132 Ga0065704_1007013257 359
418 3300005335 Ga0070666_10003635 Ga0070666_100036352 359
419 3300005445 Ga0070708_100112126 Ga0070708_1001121262 359
420 3300005614 Ga0068856_100009989 Ga0068856_10000998912 359
421 3300005981 Ga0081538_10000325 Ga0081538_1000032554 359
422 3300009094 Ga0111539_10001846 Ga0111539_100018462 359
423 3300025903 Ga0207680_10004946 Ga0207680_100049462 359
424 3300027907 Ga0207428_10072562 Ga0207428_100725622 359
425 3300030521 Ga0307511_10000307 Ga0307511_1000030720 359
426 3300046615 Ga0495656_0002223 Ga0495656_0002223_1667_2746 359
427 3300048913 Ga0496110_0000116 Ga0496110_0000116_10694_11773 359
428 3300048913 Ga0496110_0002584 Ga0496110_0002584_11194_12276 359
429 3300048914 Ga0496111_0085747 Ga0496111_0085747_363_1445 359
430 3300048927 Ga0496124_0000003 Ga0496124_0000003_934306_935388 359
431 3300048929 Ga0496126_0006975 Ga0496126_0006975_2917_3996 359
432 3300048929 Ga0496126_0020960 Ga0496126_0020960_1050_2129 359
433 3300049576 Ga0501040_0136101 Ga0501040_0136101_72_1193 359
434 3300049581 Ga0501047_0246267 Ga0501047_0246267_94_1185 359
435 3300049588 Ga0501072_0081124 Ga0501072_0081124_1272_2393 359
436 3300049743 Ga0501081_0083750 Ga0501081_0083750_964_2085 359
437 3300050511 nmdc:mga08y16_35162_c1 nmdc:mga08y16_35162_c1_3271_4377 359
438 3300050516 nmdc:mga0sz30_13747_c1 nmdc:mga0sz30_13747_c1_1543_2652 359
439 3300053151 Ga0500604_0001530 Ga0500604_0001530_1359_2468 359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03301

Trp_dioxygenase

Tryptophan 2,3-dioxygenase

69

398

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lu7-assembly1.cif.gz_CCC human tdo (htdo) in complex with nlg919 analog 0.9239 5 356
6pyz-assembly1.cif.gz_D crystal structure of human tryptophan 2,3-dioxygenase in complex with pf-06840003 in active site 0.9236 5 356
6pyy-assembly1.cif.gz_C crystal structure of human tryptophan 2,3-dioxygenase in complex with pf-06840003 in active site and exo site 0.9236 5 357
6pyz-assembly1.cif.gz_C crystal structure of human tryptophan 2,3-dioxygenase in complex with pf-06840003 in active site 0.9235 5 357
5ti9-assembly1.cif.gz_D crystal structure of human tdo in complex with trp and dioxygen, northeast structural genomics consortium target hr6161 0.9229 5 348
ID Description Score Start End Superfamily
4hkaA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9441 5 349 1.20.58.480
4hkaA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.941 5 349 1.20.58.480
4pw8B01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9323 6 348 1.20.58.480
4pw8B01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9288 6 348 1.20.58.480
2noxJ00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8112 4 338 1.20.58.480
ID Description Score Start End GO Terms
AF-A0A2A2JMB7-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9879 14 109 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A0C2CAS7-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9871 9 109 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A382MJW9-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9711 37 173 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A7D9LNN3-F1-model_v4 deleted 0.968 15 133
AF-A0A4Q6BYE5-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9653 1 115 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.75 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map