F444123

General Info

Members Datasets Scaffolds Average Seq Length
439 254 385 451

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10006920|rootH1_100069208
Length 491
Sequence MINCGGPASWFCGNIPNHKPYLISESFLSFGPKPTRLSALKIMTIYQKYKTHYRDNLRLAIPVVISQAGHQLVQFSDSVVVGHFAGTISLAAVSLASSIFSYGSTPLIAQLNGRDDYRECGKLLSNSLFINVITGILLFAAVALCSAYILEHLHQTPAVIEQAKPFLILLGLSIIPMLIFNTFKQFAEGLGFTKQAMLISIWGNVINIVLGVVFVKGMFGITPMGIRGVGYSTLIDRCLMATVMGLYVFRSARFKKYLADFSFIQINKSRCMQILRIGAPVALQYTFEISAFSGAAVLIGAIGYHEQAAHQVAINLASITYMMASGLSAAAAIKSGNYFGTKDHGNLRHSAISSYHIVVAFMSVTALIFMLGNHLLPWLYTTDKEVIAIAAQLLIIAALFQLFDGTQVVGLGILRGMGDVNIPTILTFLAYWVVGLPIGYLLGITLNLGVKGIWYGLTLGLMTSSILCFFRFQFISRKHRRDQAVPVIQQD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
15 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
16 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
17 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
18 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
19 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
20 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
21 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
22 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
23 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
24 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
25 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
26 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
27 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
28 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
29 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
30 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
31 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
32 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
33 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
34 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
35 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
36 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
37 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
38 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
39 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
40 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
41 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
42 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
43 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
44 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
45 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
46 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
47 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
48 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
49 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
50 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
51 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
52 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
53 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
54 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
55 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
56 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
57 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
58 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
59 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
60 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
63 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
66 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
72 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
73 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
82 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
83 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
86 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
238 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
244 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
250 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
251 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
254 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.47
Metatranscriptomes 0
Isolates 12.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.72
Nodule 0
Rhizoplane 0.23
Rhizosphere 66.97
Stem 0
Stem Tuber 0
Unclassified 17.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2414843 2162886007 Bacteria 5174
2 JGI24740J21852_10004999 3300001979 Bacteria 5631
3 JGI24739J22299_10002329 3300001989 Bacteria 7316
4 JGI24739J22299_10015718 3300001989 Bacteria 2750
5 JGI24737J22298_10000149 3300001990 Bacteria 21865
6 JGI24737J22298_10006688 3300001990 Unclassified 3924
7 JGI24735J21928_10000014 3300002067 Bacteria 186670
8 JGI25162J39368_1000020 3300002737 Bacteria 254723
9 JGI25162J39368_1001098 3300002737 Bacteria 16423
10 JGI25154J39366_1000002 3300002738 Bacteria 466942
11 JGI25152J39213_1000075 3300002773 Bacteria 66427
12 JGI25150J39212_1000009 3300002774 Bacteria 249509
13 JGI25159J45721_1014634 3300002987 Bacteria 1760
14 JGI25151J46595_10000017 3300003187 Bacteria 249509
15 JGI25165J46597_1002118 3300003214 Bacteria 7197
16 JGI25153J46596_10000023 3300003215 Bacteria 249509
17 JGI25153J46596_10020546 3300003215 Bacteria 2494
18 rootH1_10055446 3300003316 Bacteria 6046
19 rootH2_10019359 3300003320 Bacteria 2757
20 rootH2_10044433 3300003320 Bacteria 12909
21 rootH2_10045710 3300003320 Bacteria 24416
22 rootH2_10048269 3300003320 Bacteria 27648
23 rootH2_10060743 3300003320 Bacteria 4455
24 rootH2_10071308 3300003320 Bacteria 11642
25 rootH2_10104410 3300003320 Bacteria 6107
26 rootH2_10213882 3300003320 Bacteria 3344
27 rootL2_10007607 3300003322 Bacteria 9621
28 rootL2_10012181 3300003322 Bacteria 10323
29 rootL2_10019410 3300003322 Bacteria 10690
30 rootL2_10273537 3300003322 Bacteria 4122
31 rootH1_10006920 3300003323 Bacteria 63684
32 rootH1_10033179 3300003316 Bacteria 2663
33 rootH1_10033179 3300003323 Bacteria 11985
34 rootH1_10114913 3300003323 Bacteria 3423
35 rootH1_10133931 3300003323 Bacteria 3482
36 rootH1_10202348 3300003323 Bacteria 3192
37 rootH1_10244502 3300003323 Bacteria 3567
38 rootH1_10252314 3300003323 Bacteria 1868
39 rootH1_10354879 3300003323 Bacteria 1728
40 JGI25160J50197_1001530 3300003354 Bacteria 11467
41 Ga0055542_1006902 3300003762 Bacteria 2367
42 Ga0055536_1000011 3300003781 Bacteria 275969
43 Ga0055528_1001598 3300003790 Bacteria 13386
44 Ga0055530_10000420 3300003791 Bacteria 37705
45 Ga0055530_10008127 3300003791 Bacteria 4265
46 Ga0055531_10000074 3300003794 Bacteria 109425
47 Ga0065165_1000022 3300005262 Bacteria 253404
48 Ga0065165_1007766 3300005262 Bacteria 5184
49 Ga0065714_10002817 3300005288 Bacteria 18955
50 Ga0065714_10003488 3300005288 Bacteria 6971
51 Ga0065714_10003924 3300005288 Bacteria 8706
52 Ga0065714_10064511 3300005288 Bacteria 45172
53 Ga0065714_10065446 3300005288 Bacteria 10043
54 Ga0065704_10000288 3300005289 Bacteria 77379
55 Ga0065704_10076447 3300005289 Bacteria 5114
56 Ga0065704_10077465 3300005289 Bacteria 4727
57 Ga0065704_10090240 3300005289 Bacteria 2789
58 Ga0070658_10000011 3300005327 Bacteria 294396
59 Ga0070676_10000197 3300005328 Bacteria 25353
60 Ga0068869_100121348 3300005334 Bacteria 1999
61 Ga0070680_100132337 3300005336 Bacteria 2087
62 Ga0068868_100037501 3300005338 Bacteria 3758
63 Ga0070660_100014824 3300005339 Bacteria 5626
64 Ga0070660_100037344 3300005339 Bacteria 3683
65 Ga0070671_100035749 3300005355 Bacteria 4116
66 Ga0070659_100000231 3300005366 Bacteria 43452
67 Ga0070659_100014529 3300005366 Bacteria 5884
68 Ga0070659_100049759 3300005366 Bacteria 3296
69 Ga0070663_100002347 3300005455 Bacteria 10638
70 Ga0070678_100020864 3300005456 Bacteria 4306
71 Ga0070662_100000068 3300005457 Bacteria 56624
72 Ga0070681_10004081 3300005458 Bacteria 13794
73 Ga0068867_100000938 3300005459 Bacteria 19833
74 Ga0070679_100131649 3300005530 Bacteria 2482
75 Ga0070684_100081986 3300005535 Bacteria 2855
76 Ga0068853_100057883 3300005539 Bacteria 3346
77 Ga0070665_100000003 3300005548 Bacteria 811857
78 Ga0068855_100000240 3300005563 Bacteria 69408
79 Ga0068855_100000652 3300005563 Bacteria 42351
80 Ga0068856_100000110 3300005614 Bacteria 81321
81 Ga0068856_100003903 3300005614 Bacteria 14952
82 Ga0068856_100043043 3300005614 Bacteria 4443
83 Ga0068856_100168083 3300005614 Bacteria 2204
84 Ga0068852_100000852 3300005616 Bacteria 20278
85 Ga0068852_100164552 3300005616 Unclassified 2074
86 Ga0075366_10000185 3300006195 Bacteria 27369
87 Ga0075366_10001811 3300006195 Bacteria 10801
88 Ga0068871_100000229 3300006358 Bacteria 39643
89 Ga0068865_100000505 3300006881 Bacteria 21848
90 Ga0105240_10000068 3300009093 Bacteria 207756
91 Ga0105240_10007722 3300009093 Bacteria 15561
92 Ga0105240_10040923 3300009093 Bacteria 5921
93 Ga0105240_10061171 3300009093 Bacteria 4693
94 Ga0105240_10146426 3300009093 Unclassified 2818
95 Ga0105240_10188458 3300009093 Bacteria 2427
96 Ga0105243_10000006 3300009148 Bacteria 465541
97 Ga0105241_10001074 3300009174 Bacteria 20835
98 Ga0105241_10009529 3300009174 Bacteria 7135
99 Ga0105241_10047194 3300009174 Bacteria 3274
100 Ga0105237_10000274 3300009545 Bacteria 72354
101 Ga0105237_10000356 3300009545 Bacteria 64629
102 Ga0105237_10001345 3300009545 Bacteria 32570
103 Ga0105237_10008288 3300009545 Bacteria 11285
104 Ga0105237_10008869 3300009545 Bacteria 10839
105 Ga0105237_10030637 3300009545 Bacteria 5463
106 Ga0105238_10015655 3300009551 Bacteria 7677
107 Ga0105238_10106294 3300009551 Bacteria 2788
108 Ga0105238_10171279 3300009551 Bacteria 2147
109 Ga0105239_10000002 3300010375 Bacteria 610298
110 Ga0105239_10000010 3300010375 Bacteria 341545
111 Ga0105239_10000081 3300010375 Bacteria 133686
112 Ga0105239_10002065 3300010375 Bacteria 26034
113 Ga0105239_10025167 3300010375 Bacteria 6555
114 Ga0105239_10082193 3300010375 Bacteria 3547
115 Ga0105239_10143419 3300010375 Bacteria 2662
116 Ga0105239_10186918 3300010375 Bacteria 2319
117 Ga0105246_10010200 3300011119 Bacteria 5802
118 Ga0157373_10000041 3300013100 Bacteria 113871
119 Ga0157373_10000362 3300013100 Bacteria 36427
120 Ga0157373_10003598 3300013100 Bacteria 11702
121 Ga0157373_10005177 3300013100 Bacteria 9798
122 Ga0157371_10000009 3300013102 Bacteria 392895
123 Ga0157371_10000382 3300013102 Bacteria 55677
124 Ga0157371_10001338 3300013102 Bacteria 25928
125 Ga0157371_10002029 3300013102 Bacteria 19994
126 Ga0157371_10005230 3300013102 Bacteria 11028
127 Ga0157371_10006025 3300013102 Bacteria 10094
128 Ga0157371_10008757 3300013102 Bacteria 8027
129 Ga0157371_10079561 3300013102 Bacteria 2322
130 Ga0157370_10000545 3300013104 Bacteria 46921
131 Ga0157370_10004402 3300013104 Bacteria 16159
132 Ga0157370_10008331 3300013104 Bacteria 11182
133 Ga0157370_10017168 3300013104 Bacteria 7306
134 Ga0157370_10036830 3300013104 Bacteria 4745
135 Ga0157370_10041836 3300013104 Bacteria 4418
136 Ga0157370_10139336 3300013104 Bacteria 2260
137 Ga0157370_10157477 3300013104 Bacteria 2113
138 Ga0157370_10168741 3300013104 Bacteria 2035
139 Ga0157369_10000006 3300013105 Bacteria 412230
140 Ga0157369_10008581 3300013105 Bacteria 11719
141 Ga0157369_10050158 3300013105 Unclassified 4522
142 Ga0157369_10126924 3300013105 Bacteria 2704
143 Ga0157369_10282211 3300013105 Bacteria 1729
144 Ga0157374_10000206 3300013296 Bacteria 54254
145 Ga0157374_10022762 3300013296 Bacteria 5595
146 Ga0157378_10007182 3300013297 Bacteria 9727
147 Ga0157378_10049524 3300013297 Bacteria 3738
148 Ga0163162_10000066 3300013306 Bacteria 100009
149 Ga0163162_10000178 3300013306 Bacteria 58523
150 Ga0163162_10013403 3300013306 Bacteria 8004
151 Ga0157372_10000001 3300013307 Bacteria 791349
152 Ga0157372_10000372 3300013307 Bacteria 49527
153 Ga0157372_10001129 3300013307 Bacteria 28993
154 Ga0157372_10001733 3300013307 Bacteria 23656
155 Ga0157372_10019706 3300013307 Bacteria 7271
156 Ga0157372_10085478 3300013307 Bacteria 3578
157 Ga0157375_10041000 3300013308 Bacteria 4468
158 Ga0157375_10056103 3300013308 Bacteria 3887
159 Ga0157375_10193692 3300013308 Bacteria 2188
160 Ga0182008_10000001 3300014497 Bacteria 540790
161 Ga0182008_10001546 3300014497 Bacteria 15298
162 Ga0182008_10004035 3300014497 Bacteria 8665
163 Ga0182008_10009761 3300014497 Bacteria 5165
164 Ga0157376_10007372 3300014969 Bacteria 7845
165 Ga0182006_1000308 3300015261 Bacteria 42741
166 Ga0182006_1000696 3300015261 Bacteria 23277
167 Ga0182006_1004407 3300015261 Bacteria 6956
168 Ga0182006_1011102 3300015261 Bacteria 3978
169 Ga0182006_1018772 3300015261 Bacteria 2918
170 Ga0182007_10000001 3300015262 Bacteria 1127301
171 Ga0182005_1000281 3300015265 Bacteria 32073
172 Ga0183373_1006 3300015682 Bacteria 328276
173 Ga0163161_10000405 3300017792 Bacteria 36132
174 Ga0163161_10000717 3300017792 Bacteria 26160
175 Ga0163161_10000934 3300017792 Bacteria 22533
176 Ga0163161_10003366 3300017792 Bacteria 11214
177 Ga0163161_10057325 3300017792 Bacteria 2830
178 Ga0163161_10079614 3300017792 Bacteria 2410
179 Ga0213875_10016433 3300021388 Bacteria 3588
180 Ga0209436_100254 3300025208 Bacteria 24604
181 Ga0207427_100163 3300025231 Bacteria 74501
182 Ga0209437_100085 3300025233 Bacteria 254790
183 Ga0209437_100101 3300025233 Bacteria 226668
184 Ga0209258_100161 3300025242 Bacteria 151992
185 Ga0207425_1000007 3300025245 Bacteria 777411
186 Ga0209646_1000005 3300025246 Bacteria 717627
187 Ga0209026_1000154 3300025250 Bacteria 108964
188 Ga0209026_1001403 3300025250 Bacteria 10725
189 Ga0209026_1002257 3300025250 Bacteria 7395
190 Ga0209026_1004243 3300025250 Bacteria 4348
191 Ga0209148_1000639 3300025254 Bacteria 30516
192 Ga0209129_1000006 3300025258 Bacteria 777761
193 Ga0209129_1011186 3300025258 Bacteria 2165
194 Ga0209233_1000124 3300025261 Bacteria 226743
195 Ga0209233_1001261 3300025261 Bacteria 10166
196 Ga0209233_1019795 3300025261 Bacteria 1780
197 Ga0209455_1002868 3300025272 Bacteria 6382
198 Ga0209673_1000049 3300025273 Bacteria 286207
199 Ga0209130_1001612 3300025284 Bacteria 14003
200 Ga0209676_1000001 3300025292 Bacteria 1852142
201 Ga0209025_1000025 3300025294 Bacteria 524454
202 Ga0209564_1006608 3300025295 Bacteria 6210
203 Ga0209564_1011679 3300025295 Bacteria 3908
204 Ga0209758_1000016 3300025297 Bacteria 778557
205 Ga0209758_1013121 3300025297 Bacteria 4553
206 Ga0209758_1021999 3300025297 Bacteria 2945
207 Ga0209050_1000016 3300025298 Bacteria 729149
208 Ga0209050_1000129 3300025298 Bacteria 186356
209 Ga0209050_1001591 3300025298 Bacteria 23468
210 Ga0207426_1000243 3300025302 Bacteria 122575
211 Ga0207426_1000461 3300025302 Bacteria 63611
212 Ga0207426_1000895 3300025302 Bacteria 30164
213 Ga0209257_1000004 3300025304 Bacteria 1678347
214 Ga0207642_10058898 3300025899 Bacteria 1774
215 Ga0207647_10000356 3300025904 Bacteria 37148
216 Ga0207647_10001659 3300025904 Bacteria 17144
217 Ga0207647_10087614 3300025904 Bacteria 1859
218 Ga0207645_10001018 3300025907 Bacteria 23159
219 Ga0207705_10000015 3300025909 Bacteria 382901
220 Ga0207654_10004098 3300025911 Bacteria 7340
221 Ga0207654_10007874 3300025911 Bacteria 5371
222 Ga0207707_10018108 3300025912 Bacteria 6138
223 Ga0207695_10000131 3300025913 Bacteria 223762
224 Ga0207695_10002296 3300025913 Bacteria 28532
225 Ga0207695_10004588 3300025913 Bacteria 18767
226 Ga0207695_10226306 3300025913 Bacteria 1776
227 Ga0207671_10000993 3300025914 Bacteria 34894
228 Ga0207671_10002287 3300025914 Bacteria 20732
229 Ga0207671_10006260 3300025914 Bacteria 10658
230 Ga0207671_10008102 3300025914 Bacteria 8971
231 Ga0207671_10009052 3300025914 Bacteria 8371
232 Ga0207657_10022604 3300025919 Bacteria 5879
233 Ga0207657_10169012 3300025919 Unclassified 1772
234 Ga0207652_10109304 3300025921 Bacteria 2451
235 Ga0207694_10076706 3300025924 Bacteria 2618
236 Ga0207644_10122929 3300025931 Bacteria 1978
237 Ga0207690_10001548 3300025932 Bacteria 14396
238 Ga0207690_10025939 3300025932 Bacteria 3687
239 Ga0207690_10033556 3300025932 Bacteria 3301
240 Ga0207706_10000126 3300025933 Bacteria 82630
241 Ga0207709_10000007 3300025935 Bacteria 752025
242 Ga0207704_10000209 3300025938 Bacteria 29657
243 Ga0207689_10136141 3300025942 Bacteria 2023
244 Ga0207667_10000037 3300025949 Bacteria 297252
245 Ga0207667_10001001 3300025949 Bacteria 36044
246 Ga0207667_10121029 3300025949 Bacteria 2697
247 Ga0207667_10200354 3300025949 Bacteria 2048
248 Ga0207639_10060942 3300026041 Unclassified 2912
249 Ga0207678_10031635 3300026067 Bacteria 4614
250 Ga0207702_10000151 3300026078 Bacteria 81314
251 Ga0207702_10008159 3300026078 Bacteria 8853
252 Ga0207648_10000155 3300026089 Bacteria 69524
253 Ga0207683_10031962 3300026121 Bacteria 4570
254 Ga0207698_10006555 3300026142 Bacteria 7274
255 Ga0207698_10126036 3300026142 Bacteria 2178
256 Ga0268266_10000052 3300028379 Bacteria 296230
257 Ga0307517_10002873 3300028786 Bacteria 27309
258 Ga0307515_10000432 3300028794 Bacteria 100348
259 Ga0307515_10001738 3300028794 Bacteria 48492
260 Ga0307515_10058547 3300028794 Bacteria 5547
261 Ga0307515_10113213 3300028794 Bacteria 3148
262 Ga0307513_10230078 3300031456 Bacteria 1667
263 Ga0307408_100001198 3300031548 Bacteria 19585
264 Ga0307408_100001304 3300031548 Bacteria 18669
265 Ga0307408_100001781 3300031548 Bacteria 15723
266 Ga0316576_10028689 3300031727 Bacteria 3926
267 Ga0316578_10110378 3300031728 Unclassified 1652
268 Ga0307405_10000010 3300031731 Bacteria 250978
269 Ga0307405_10094863 3300031731 Unclassified 1985
270 Ga0316577_10045387 3300031733 Bacteria 2456
271 Ga0307413_10000122 3300031824 Bacteria 20290
272 Ga0307407_10000009 3300031903 Bacteria 188746
273 Ga0307412_10000033 3300031911 Bacteria 206649
274 Ga0307412_10006678 3300031911 Bacteria 6539
275 Ga0307416_100000019 3300032002 Bacteria 199706
276 Ga0307414_10001227 3300032004 Bacteria 13215
277 Ga0307414_10021806 3300032004 Bacteria 4029
278 Ga0307414_10036394 3300032004 Bacteria 3286
279 Ga0307414_10063188 3300032004 Bacteria 2631
280 Ga0307414_10109928 3300032004 Bacteria 2095
281 Ga0307411_10000011 3300032005 Bacteria 204666
282 Ga0316583_10031693 3300032133 Bacteria 1881
283 Ga0307507_10002988 3300033179 Bacteria 33879
284 Ga0307510_10005315 3300033180 Bacteria 15324
285 Ga0307510_10006242 3300033180 Bacteria 14219
286 Ga0373941_0025534 3300035115 Bacteria 1707
287 Ga0316584_0013762 3300036712 Bacteria 5735
288 Ga0316584_0052704 3300036712 Bacteria 3043
289 Ga0395899_0000001 3300037312 Bacteria 1750322
290 Ga0395899_0000402 3300037312 Bacteria 50694
291 Ga0395899_0000608 3300037312 Bacteria 37382
292 Ga0395900_0000330 3300037418 Bacteria 69819
293 Ga0395900_0002451 3300037418 Bacteria 20441
294 Ga0395900_0009856 3300037418 Bacteria 9787
295 Ga0395898_0012298 3300037466 Bacteria 8851
296 Ga0395905_0000301 3300037471 Bacteria 72121
297 Ga0395905_0000516 3300037471 Bacteria 52868
298 Ga0436364_0793703 3300037853 Bacteria 9409
299 Ga0395901_0004292 3300038443 Bacteria 14381
300 Ga0395901_0098046 3300038443 Bacteria 3073
301 Ga0400483_038296 3300039062 Bacteria 2042
302 Ga0436361_0249079 3300039447 Bacteria 5755
303 Ga0451833_1017079 3300041491 Bacteria 2112
304 Ga0439431_0002777 3300041997 Bacteria 3854
305 Ga0451577_0069415 3300042876 Unclassified 3142
306 Ga0466969_0025140 3300044656 Bacteria 3064
307 Ga0453683_0011799 3300044673 Bacteria 5753
308 Ga0466966_0002565 3300044684 Bacteria 11899
309 Ga0453684_0004110 3300044712 Bacteria 31557
310 Ga0466959_0016770 3300045049 Bacteria 5360
311 Ga0451576_0012610 3300045051 Bacteria 9490
312 Ga0451576_0017811 3300045051 Bacteria 7803
313 Ga0451576_0092444 3300045051 Bacteria 3147
314 Ga0451576_0170080 3300045051 Unclassified 2274
315 Ga0495627_015700 3300046453 Bacteria 2608
316 Ga0495638_0000013 3300046460 Bacteria 430133
317 Ga0495638_0089173 3300046460 Bacteria 1861
318 Ga0495650_0000003 3300046471 Bacteria 900730
319 Ga0495585_0000085 3300046492 Bacteria 97836
320 Ga0495585_0000156 3300046492 Bacteria 72941
321 Ga0495583_0011701 3300046506 Bacteria 5024
322 Ga0495606_0000145 3300046507 Bacteria 122857
323 Ga0495610_0000028 3300046512 Bacteria 272572
324 Ga0495610_0001185 3300046512 Bacteria 23579
325 Ga0495610_0005649 3300046512 Bacteria 8819
326 Ga0495644_0004566 3300046523 Bacteria 5443
327 Ga0495648_0017169 3300046524 Bacteria 5185
328 Ga0495652_0037951 3300046529 Bacteria 4177
329 Ga0495609_0005836 3300046538 Bacteria 6387
330 Ga0495609_0063209 3300046538 Bacteria 1634
331 Ga0495633_0000014 3300046558 Bacteria 261742
332 Ga0495633_0007172 3300046558 Bacteria 6462
333 Ga0495633_0049197 3300046558 Bacteria 1990
334 Ga0495668_0000012 3300046616 Bacteria 458817
335 Ga0495625_0000005 3300046660 Bacteria 596135
336 Ga0495625_0007620 3300046660 Bacteria 9396
337 Ga0495625_0016997 3300046660 Bacteria 5704
338 Ga0495625_0028943 3300046660 Bacteria 4147
339 Ga0495625_0048787 3300046660 Bacteria 3046
340 Ga0495661_0001748 3300046665 Bacteria 17477
341 Ga0495661_0037258 3300046665 Bacteria 3037
342 Ga0495661_0038265 3300046665 Bacteria 2990
343 Ga0495658_0012902 3300046683 Bacteria 4245
344 Ga0495649_0000003 3300046694 Bacteria 880817
345 Ga0495683_0036314 3300047323 Bacteria 2502
346 Ga0495687_000672 3300047443 Bacteria 38920
347 Ga0495687_000762 3300047443 Bacteria 34827
348 Ga0495677_0048818 3300047445 Bacteria 1555
349 Ga0495673_0029169 3300047469 Bacteria 2607
350 Ga0495686_0001125 3300047472 Bacteria 31631
351 Ga0495686_0006898 3300047472 Bacteria 8599
352 Ga0495686_0070186 3300047472 Bacteria 2159
353 Ga0496117_0001976 3300048920 Bacteria 27259
354 Ga0496118_0077655 3300048921 Bacteria 2354
355 Ga0496121_0000008 3300048924 Bacteria 843593
356 Ga0496122_0001345 3300048925 Bacteria 40096
357 Ga0496122_0058418 3300048925 Bacteria 2855
358 Ga0496123_0023603 3300048926 Bacteria 4703
359 Ga0496125_0049699 3300048928 Bacteria 3481
360 Ga0501034_0089820 3300049571 Bacteria 3070
361 Ga0501241_000611 3300049758 Bacteria 7659
362 Ga0501241_000913 3300049758 Bacteria 6265
363 Ga0501241_004306 3300049758 Bacteria 2672
364 Ga0501266_000006 3300049763 Bacteria 312183
365 Ga0501044_0109269 3300049823 Bacteria 2775
366 nmdc:mga0k408_16_c2 3300050493 Bacteria 101089
367 nmdc:mga0k408_23871_c1 3300050493 Bacteria 3454
368 nmdc:mga0k408_295_c2 3300050493 Bacteria 15899
369 Ga0500644_0000434 3300053088 Bacteria 19414
370 Ga0500651_0001275 3300053093 Bacteria 12577
371 Ga0500569_001723 3300053109 Bacteria 4182
372 Ga0500608_000451 3300053122 Bacteria 15387
373 Ga0500618_000526 3300053125 Bacteria 24101
374 Ga0500658_0000007 3300053134 Bacteria 284115
375 Ga0500658_0005105 3300053134 Bacteria 4887
376 Ga0500616_0000013 3300053153 Bacteria 674172
377 Ga0500616_0085884 3300053153 Unclassified 1571
378 Ga0500622_0000405 3300053156 Bacteria 41077
379 Ga0500622_0000679 3300053156 Bacteria 30085
380 Ga0500622_0030142 3300053156 Bacteria 2850
381 Ga0500624_000290 3300053157 Bacteria 17334
382 Ga0500633_0015192 3300053160 Bacteria 2203
383 Ga0500634_0026100 3300053161 Bacteria 3182
384 Ga0500634_0064898 3300053161 Bacteria 1928
385 Ga0500636_0041561 3300053177 Bacteria 2719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2887375801 2887380420 367
2 3300033179 Ga0307507_10002988 Ga0307507_1000298820 393
3 3300050493 nmdc:mga0k408_23871_c1 nmdc:mga0k408_23871_c1_40_1245 393
4 3300036712 Ga0316584_0013762 Ga0316584_0013762_1360_2697 418
5 3300046665 Ga0495661_0037258 Ga0495661_0037258_1678_2961 419
6 3300025250 Ga0209026_1002257 Ga0209026_10022573 421
7 3300045051 Ga0451576_0092444 Ga0451576_0092444_1008_2276 421
8 3300031727 Ga0316576_10028689 Ga0316576_100286895 422
9 3300036712 Ga0316584_0052704 Ga0316584_0052704_1050_2387 422
10 3300037853 Ga0436364_0793703 Ga0436364_0793703_627_1976 424
11 3300031728 Ga0316578_10110378 Ga0316578_101103782 425
12 3300009148 Ga0105243_10000006 Ga0105243_1000000690 426
13 3300031456 Ga0307513_10230078 Ga0307513_102300781 426
14 3300005289 Ga0065704_10090240 Ga0065704_100902402 427
15 3300009093 Ga0105240_10000068 Ga0105240_1000006820 427
16 3300009174 Ga0105241_10009529 Ga0105241_100095294 427
17 3300009545 Ga0105237_10000274 Ga0105237_1000027420 427
18 3300009551 Ga0105238_10171279 Ga0105238_101712792 427
19 3300010375 Ga0105239_10002065 Ga0105239_1000206518 427
20 3300013104 Ga0157370_10017168 Ga0157370_100171687 427
21 3300015261 Ga0182006_1004407 Ga0182006_10044073 427
22 3300017792 Ga0163161_10003366 Ga0163161_100033666 427
23 3300025298 Ga0209050_1001591 Ga0209050_100159115 427
24 3300025911 Ga0207654_10007874 Ga0207654_100078746 427
25 3300025913 Ga0207695_10000131 Ga0207695_1000013120 427
26 3300025914 Ga0207671_10000993 Ga0207671_1000099320 427
27 3300025935 Ga0207709_10000007 Ga0207709_10000007330 427
28 3300032004 Ga0307414_10063188 Ga0307414_100631882 427
29 3300048920 Ga0496117_0001976 Ga0496117_0001976_4109_5512 427
30 3300048921 Ga0496118_0077655 Ga0496118_0077655_754_2157 427
31 3300048925 Ga0496122_0001345 Ga0496122_0001345_37101_38402 427
32 3300048925 Ga0496122_0058418 Ga0496122_0058418_1363_2766 427
33 3300048926 Ga0496123_0023603 Ga0496123_0023603_2502_3803 427
34 3300048928 Ga0496125_0049699 Ga0496125_0049699_650_1951 427
35 3300053109 Ga0500569_001723 Ga0500569_001723_2492_3841 427
36 3300053134 Ga0500658_0005105 Ga0500658_0005105_622_1971 427
37 3300053153 Ga0500616_0085884 Ga0500616_0085884_33_1382 427
38 iso_pu_bacteria 2738541283 2738754835 429
39 3300021388 Ga0213875_10016433 Ga0213875_100164332 430
40 iso_pu_bacteria 2738541284 2738761248 431
41 3300045051 Ga0451576_0012610 Ga0451576_0012610_4380_5717 432
42 3300013308 Ga0157375_10056103 Ga0157375_100561033 434
43 3300014497 Ga0182008_10009761 Ga0182008_100097612 434
44 3300032133 Ga0316583_10031693 Ga0316583_100316932 434
45 3300013102 Ga0157371_10002029 Ga0157371_100020297 435
46 3300013104 Ga0157370_10008331 Ga0157370_100083316 435
47 3300013104 Ga0157370_10041836 Ga0157370_100418364 435
48 3300014497 Ga0182008_10000001 Ga0182008_10000001245 435
49 3300025899 Ga0207642_10058898 Ga0207642_100588981 435
50 3300025904 Ga0207647_10087614 Ga0207647_100876142 435
51 3300025942 Ga0207689_10136141 Ga0207689_101361412 435
52 3300026041 Ga0207639_10060942 Ga0207639_100609421 435
53 3300026121 Ga0207683_10031962 Ga0207683_100319625 435
54 3300026142 Ga0207698_10006555 Ga0207698_100065557 435
55 3300049758 Ga0501241_004306 Ga0501241_004306_1315_2622 435
56 3300005455 Ga0070663_100002347 Ga0070663_1000023474 436
57 3300013102 Ga0157371_10006025 Ga0157371_100060255 436
58 3300013104 Ga0157370_10168741 Ga0157370_101687412 436
59 3300013105 Ga0157369_10008581 Ga0157369_100085814 436
60 3300013307 Ga0157372_10000001 Ga0157372_10000001597 436
61 3300026067 Ga0207678_10031635 Ga0207678_100316355 436
62 3300037312 Ga0395899_0000402 Ga0395899_0000402_28714_30078 436
63 3300044656 Ga0466969_0025140 Ga0466969_0025140_545_1909 436
64 3300044684 Ga0466966_0002565 Ga0466966_0002565_6317_7681 436
65 3300045049 Ga0466959_0016770 Ga0466959_0016770_2491_3855 436
66 3300045051 Ga0451576_0170080 Ga0451576_0170080_226_1566 436
67 3300046460 Ga0495638_0000013 Ga0495638_0000013_203042_204406 436
68 3300003320 rootH2_10044433 rootH2_100444336 437
69 3300003323 rootH1_10033179 rootH1_100331799 437
70 3300041997 Ga0439431_0002777 Ga0439431_0002777_1476_2837 437
71 3300048924 Ga0496121_0000008 Ga0496121_0000008_797487_798824 437
72 3300025250 Ga0209026_1004243 Ga0209026_10042432 438
73 3300049571 Ga0501034_0089820 Ga0501034_0089820_1077_2438 438
74 iso_pu_bacteria 2821136567 2821142001 438
75 iso_pu_bacteria 2904467357 2904469585 438
76 3300013307 Ga0157372_10001129 Ga0157372_1000112926 439
77 3300049758 Ga0501241_000913 Ga0501241_000913_2330_3709 439
78 3300002987 JGI25159J45721_1014634 JGI25159J45721_10146342 440
79 3300025208 Ga0209436_100254 Ga0209436_10025413 440
80 3300025284 Ga0209130_1001612 Ga0209130_100161212 440
81 3300025302 Ga0207426_1000243 Ga0207426_100024325 440
82 3300041491 Ga0451833_1017079 Ga0451833_1017079_158_1501 440
83 3300046660 Ga0495625_0048787 Ga0495625_0048787_800_2179 440
84 iso_pu_bacteria 2929239360 2929245700 440
85 3300002737 JGI25162J39368_1001098 JGI25162J39368_100109815 441
86 3300003214 JGI25165J46597_1002118 JGI25165J46597_10021186 441
87 3300003320 rootH2_10048269 rootH2_1004826917 441
88 3300003323 rootH1_10202348 rootH1_102023481 441
89 3300017792 Ga0163161_10079614 Ga0163161_100796141 441
90 3300025231 Ga0207427_100163 Ga0207427_10016315 441
91 3300025233 Ga0209437_100101 Ga0209437_100101211 441
92 3300025261 Ga0209233_1000124 Ga0209233_100012427 441
93 3300042876 Ga0451577_0069415 Ga0451577_0069415_667_1995 441
94 3300044712 Ga0453684_0004110 Ga0453684_0004110_16321_17649 441
95 3300046665 Ga0495661_0001748 Ga0495661_0001748_15475_16848 441
96 3300005262 Ga0065165_1007766 Ga0065165_10077663 442
97 3300005366 Ga0070659_100014529 Ga0070659_1000145292 442
98 3300013104 Ga0157370_10036830 Ga0157370_100368302 442
99 3300025261 Ga0209233_1001261 Ga0209233_10012614 442
100 3300025904 Ga0207647_10000356 Ga0207647_1000035616 442
101 3300025932 Ga0207690_10025939 Ga0207690_100259392 442
102 3300047472 Ga0495686_0006898 Ga0495686_0006898_2626_4005 442
103 3300003320 rootH2_10071308 rootH2_1007130810 443
104 3300003323 rootH1_10006920 rootH1_100069208 443
105 3300005530 Ga0070679_100131649 Ga0070679_1001316493 443
106 3300013104 Ga0157370_10139336 Ga0157370_101393362 443
107 3300013297 Ga0157378_10007182 Ga0157378_100071826 443
108 3300013308 Ga0157375_10041000 Ga0157375_100410003 443
109 3300025921 Ga0207652_10109304 Ga0207652_101093041 443
110 iso_pu_bacteria 2890737413 2890740712 443
111 3300001989 JGI24739J22299_10002329 JGI24739J22299_100023295 444
112 3300003320 rootH2_10213882 rootH2_102138822 444
113 3300003354 JGI25160J50197_1001530 JGI25160J50197_10015307 444
114 3300003790 Ga0055528_1001598 Ga0055528_10015986 444
115 3300003791 Ga0055530_10000420 Ga0055530_100004207 444
116 3300005262 Ga0065165_1000022 Ga0065165_100002222 444
117 3300025273 Ga0209673_1000049 Ga0209673_1000049187 444
118 3300025295 Ga0209564_1006608 Ga0209564_10066082 444
119 3300025295 Ga0209564_1011679 Ga0209564_10116792 444
120 3300025297 Ga0209758_1013121 Ga0209758_10131213 444
121 3300025297 Ga0209758_1021999 Ga0209758_10219992 444
122 3300025298 Ga0209050_1000129 Ga0209050_1000129103 444
123 3300025302 Ga0207426_1000895 Ga0207426_10008953 444
124 3300053088 Ga0500644_0000434 Ga0500644_0000434_4108_5457 444
125 3300053156 Ga0500622_0000679 Ga0500622_0000679_16029_17408 444
126 3300053160 Ga0500633_0015192 Ga0500633_0015192_740_2089 444
127 3300053161 Ga0500634_0026100 Ga0500634_0026100_1361_2710 444
128 3300053177 Ga0500636_0041561 Ga0500636_0041561_1002_2351 444
129 iso_pu_bacteria 2818991460 2819677581 444
130 iso_pu_bacteria 2896109856 2896115516 444
131 iso_pu_bacteria 2898713307 2898713415 444
132 iso_pu_bacteria 2929921140 2929927899 444
133 iso_pu_bacteria 2977232053 2977232646 444
134 iso_pu_bacteria 8003151029 8003152680 444
135 3300005288 Ga0065714_10003488 Ga0065714_100034886 445
136 3300005614 Ga0068856_100043043 Ga0068856_1000430433 445
137 3300025949 Ga0207667_10200354 Ga0207667_102003542 445
138 3300028794 Ga0307515_10058547 Ga0307515_100585475 445
139 3300003322 rootL2_10019410 rootL2_1001941011 446
140 3300003323 rootH1_10252314 rootH1_102523142 446
141 3300015265 Ga0182005_1000281 Ga0182005_100028124 446
142 iso_pu_bacteria 2818991442 2819571741 446
143 iso_pu_bacteria 2857618242 2857620657 446
144 iso_pu_bacteria 2884791551 2884797500 446
145 3300003320 rootH2_10019359 rootH2_100193594 447
146 3300003322 rootL2_10007607 rootL2_100076071 447
147 3300005289 Ga0065704_10076447 Ga0065704_100764472 447
148 3300005336 Ga0070680_100132337 Ga0070680_1001323371 447
149 3300005458 Ga0070681_10004081 Ga0070681_100040817 447
150 3300005535 Ga0070684_100081986 Ga0070684_1000819862 447
151 3300005563 Ga0068855_100000652 Ga0068855_10000065217 447
152 3300013100 Ga0157373_10000362 Ga0157373_1000036226 447
153 3300013307 Ga0157372_10001733 Ga0157372_1000173325 447
154 3300014497 Ga0182008_10004035 Ga0182008_100040357 447
155 3300025912 Ga0207707_10018108 Ga0207707_100181086 447
156 3300025949 Ga0207667_10001001 Ga0207667_1000100132 447
157 3300039062 Ga0400483_038296 Ga0400483_038296_340_1686 447
158 3300044673 Ga0453683_0011799 Ga0453683_0011799_426_1769 447
159 3300045051 Ga0451576_0017811 Ga0451576_0017811_257_1600 447
160 3300053153 Ga0500616_0000013 Ga0500616_0000013_514713_516080 447
161 3300053156 Ga0500622_0000405 Ga0500622_0000405_27006_28349 447
162 iso_pu_bacteria 2739367656 2739616104 447
163 iso_pu_bacteria 2739367663 2739645131 447
164 iso_pu_bacteria 2852627209 2852631970 447
165 iso_pu_bacteria 2896344016 2896346926 447
166 3300001979 JGI24740J21852_10004999 JGI24740J21852_100049993 448
167 3300002738 JGI25154J39366_1000002 JGI25154J39366_100000296 448
168 3300003215 JGI25153J46596_10020546 JGI25153J46596_100205463 448
169 3300003762 Ga0055542_1006902 Ga0055542_10069022 448
170 3300005614 Ga0068856_100003903 Ga0068856_1000039036 448
171 3300025242 Ga0209258_100161 Ga0209258_10016128 448
172 3300025246 Ga0209646_1000005 Ga0209646_1000005282 448
173 3300025250 Ga0209026_1000154 Ga0209026_100015453 448
174 3300025254 Ga0209148_1000639 Ga0209148_100063929 448
175 3300025258 Ga0209129_1011186 Ga0209129_10111862 448
176 3300025302 Ga0207426_1000461 Ga0207426_100046111 448
177 3300026078 Ga0207702_10008159 Ga0207702_100081595 448
178 3300046453 Ga0495627_015700 Ga0495627_015700_1082_2428 448
179 3300046558 Ga0495633_0007172 Ga0495633_0007172_845_2191 448
180 3300053161 Ga0500634_0064898 Ga0500634_0064898_97_1464 448
181 iso_pu_bacteria 2599185184 2599477682 448
182 iso_pu_bacteria 2739367651 2739588521 448
183 iso_pu_bacteria 2840677318 2840678137 448
184 iso_pu_bacteria 2849281842 2849285193 448
185 iso_pu_bacteria 2883068021 2883070661 448
186 iso_pu_bacteria 2896085136 2896085955 448
187 iso_pu_bacteria 2904445276 2904445810 448
188 iso_pu_bacteria 2919437846 2919441122 448
189 iso_pu_bacteria 2928078545 2928079596 448
190 iso_pu_bacteria 2928147474 2928147922 448
191 iso_pu_bacteria 2929150217 2929152309 448
192 iso_pu_bacteria 2929177148 2929183426 448
193 iso_pu_bacteria 2932082852 2932086772 448
194 iso_pu_bacteria 2945977869 2945979387 448
195 iso_pu_bacteria 2945997725 2946000493 448
196 iso_pu_bacteria 2946013367 2946014743 448
197 3300003322 rootL2_10012181 rootL2_100121817 449
198 3300003322 rootL2_10273537 rootL2_102735374 449
199 3300003794 Ga0055531_10000074 Ga0055531_1000007462 449
200 3300005366 Ga0070659_100000231 Ga0070659_10000023136 449
201 3300005616 Ga0068852_100164552 Ga0068852_1001645522 449
202 3300025304 Ga0209257_1000004 Ga0209257_1000004842 449
203 3300025932 Ga0207690_10001548 Ga0207690_1000154811 449
204 3300026142 Ga0207698_10126036 Ga0207698_101260362 449
205 3300031731 Ga0307405_10094863 Ga0307405_100948632 449
206 3300046665 Ga0495661_0038265 Ga0495661_0038265_1345_2718 449
207 iso_pu_bacteria 8055588893 8055588935 449
208 3300003320 rootH2_10045710 rootH2_1004571010 450
209 3300005614 Ga0068856_100000110 Ga0068856_10000011027 450
210 3300005614 Ga0068856_100168083 Ga0068856_1001680831 450
211 3300009093 Ga0105240_10146426 Ga0105240_101464261 450
212 3300015261 Ga0182006_1000308 Ga0182006_100030826 450
213 3300015261 Ga0182006_1000696 Ga0182006_10006968 450
214 3300025250 Ga0209026_1001403 Ga0209026_10014034 450
215 3300026078 Ga0207702_10000151 Ga0207702_1000015127 450
216 3300028794 Ga0307515_10113213 Ga0307515_101132134 450
217 3300031733 Ga0316577_10045387 Ga0316577_100453871 450
218 3300031824 Ga0307413_10000122 Ga0307413_100001224 450
219 3300032005 Ga0307411_10000011 Ga0307411_1000001191 450
220 3300049758 Ga0501241_000611 Ga0501241_000611_726_2081 450
221 3300049763 Ga0501266_000006 Ga0501266_000006_109988_111343 450
222 3300053134 Ga0500658_0000007 Ga0500658_0000007_187791_189146 450
223 iso_pu_bacteria 2721755487 2722726736 450
224 iso_pu_bacteria 2852623160 2852623648 450
225 iso_pu_bacteria 2884933994 2884937449 450
226 iso_pu_bacteria 2904780799 2904782199 450
227 iso_pu_bacteria 2919177583 2919179602 450
228 3300006195 Ga0075366_10001811 Ga0075366_100018119 451
229 3300009093 Ga0105240_10188458 Ga0105240_101884582 451
230 3300009545 Ga0105237_10001345 Ga0105237_1000134510 451
231 3300009551 Ga0105238_10106294 Ga0105238_101062942 451
232 3300010375 Ga0105239_10000010 Ga0105239_10000010139 451
233 3300025272 Ga0209455_1002868 Ga0209455_10028684 451
234 3300025913 Ga0207695_10226306 Ga0207695_102263062 451
235 3300025914 Ga0207671_10006260 Ga0207671_100062608 451
236 3300025924 Ga0207694_10076706 Ga0207694_100767062 451
237 3300031903 Ga0307407_10000009 Ga0307407_10000009111 451
238 3300032002 Ga0307416_100000019 Ga0307416_10000001984 451
239 3300032004 Ga0307414_10021806 Ga0307414_100218064 451
240 3300032004 Ga0307414_10109928 Ga0307414_101099282 451
241 3300046529 Ga0495652_0037951 Ga0495652_0037951_2781_4157 451
242 3300050493 nmdc:mga0k408_295_c2 nmdc:mga0k408_295_c2_8229_9599 451
243 iso_pu_bacteria 2585427687 2586206566 451
244 iso_pu_bacteria 2738541302 2738853858 451
245 iso_pu_bacteria 2738543023 2739305133 451
246 iso_pu_bacteria 2775506987 2776613408 451
247 iso_pu_bacteria 2818991437 2819549873 451
248 iso_pu_bacteria 2842722452 2842723664 451
249 iso_pu_bacteria 2842909656 2842910170 451
250 iso_pu_bacteria 2857627736 2857629102 451
251 iso_pu_bacteria 2896317667 2896318850 451
252 iso_pu_bacteria 2902048731 2902048825 451
253 iso_pu_bacteria 2919186247 2919187063 451
254 iso_pu_bacteria 2939664404 2939665668 451
255 iso_pu_bacteria 2954016120 2954017402 451
256 3300001989 JGI24739J22299_10015718 JGI24739J22299_100157182 452
257 3300001990 JGI24737J22298_10000149 JGI24737J22298_100001492 452
258 3300001990 JGI24737J22298_10006688 JGI24737J22298_100066885 452
259 3300002067 JGI24735J21928_10000014 JGI24735J21928_1000001437 452
260 3300002737 JGI25162J39368_1000020 JGI25162J39368_1000020150 452
261 3300002773 JGI25152J39213_1000075 JGI25152J39213_100007535 452
262 3300002774 JGI25150J39212_1000009 JGI25150J39212_1000009104 452
263 3300003187 JGI25151J46595_10000017 JGI25151J46595_10000017104 452
264 3300003215 JGI25153J46596_10000023 JGI25153J46596_10000023135 452
265 3300003316 rootH1_10055446 rootH1_100554463 452
266 3300003320 rootH2_10060743 rootH2_100607434 452
267 3300003320 rootH2_10104410 rootH2_101044104 452
268 3300003323 rootH1_10133931 rootH1_101339312 452
269 3300003323 rootH1_10354879 rootH1_103548792 452
270 3300005327 Ga0070658_10000011 Ga0070658_10000011252 452
271 3300005328 Ga0070676_10000197 Ga0070676_1000019719 452
272 3300005334 Ga0068869_100121348 Ga0068869_1001213482 452
273 3300005338 Ga0068868_100037501 Ga0068868_1000375012 452
274 3300005339 Ga0070660_100014824 Ga0070660_1000148245 452
275 3300005339 Ga0070660_100037344 Ga0070660_1000373442 452
276 3300005355 Ga0070671_100035749 Ga0070671_1000357492 452
277 3300005366 Ga0070659_100049759 Ga0070659_1000497593 452
278 3300005456 Ga0070678_100020864 Ga0070678_1000208644 452
279 3300005457 Ga0070662_100000068 Ga0070662_10000006853 452
280 3300005459 Ga0068867_100000938 Ga0068867_10000093817 452
281 3300005539 Ga0068853_100057883 Ga0068853_1000578832 452
282 3300005548 Ga0070665_100000003 Ga0070665_100000003501 452
283 3300005563 Ga0068855_100000240 Ga0068855_10000024058 452
284 3300005616 Ga0068852_100000852 Ga0068852_1000008526 452
285 3300006195 Ga0075366_10000185 Ga0075366_100001859 452
286 3300006358 Ga0068871_100000229 Ga0068871_10000022916 452
287 3300006881 Ga0068865_100000505 Ga0068865_1000005057 452
288 3300009093 Ga0105240_10007722 Ga0105240_100077222 452
289 3300009093 Ga0105240_10040923 Ga0105240_100409233 452
290 3300009093 Ga0105240_10061171 Ga0105240_100611712 452
291 3300009174 Ga0105241_10001074 Ga0105241_100010745 452
292 3300009174 Ga0105241_10047194 Ga0105241_100471943 452
293 3300009545 Ga0105237_10000356 Ga0105237_1000035618 452
294 3300009545 Ga0105237_10008288 Ga0105237_1000828811 452
295 3300009545 Ga0105237_10008869 Ga0105237_100088696 452
296 3300009545 Ga0105237_10030637 Ga0105237_100306375 452
297 3300009551 Ga0105238_10015655 Ga0105238_100156552 452
298 3300010375 Ga0105239_10000002 Ga0105239_10000002572 452
299 3300010375 Ga0105239_10000081 Ga0105239_1000008117 452
300 3300010375 Ga0105239_10025167 Ga0105239_100251671 452
301 3300010375 Ga0105239_10082193 Ga0105239_100821932 452
302 3300010375 Ga0105239_10143419 Ga0105239_101434192 452
303 3300010375 Ga0105239_10186918 Ga0105239_101869181 452
304 3300011119 Ga0105246_10010200 Ga0105246_100102006 452
305 3300013100 Ga0157373_10005177 Ga0157373_100051776 452
306 3300013102 Ga0157371_10000382 Ga0157371_1000038235 452
307 3300013102 Ga0157371_10005230 Ga0157371_1000523011 452
308 3300013102 Ga0157371_10008757 Ga0157371_100087576 452
309 3300013102 Ga0157371_10079561 Ga0157371_100795612 452
310 3300013104 Ga0157370_10004402 Ga0157370_100044024 452
311 3300013105 Ga0157369_10050158 Ga0157369_100501586 452
312 3300013105 Ga0157369_10126924 Ga0157369_101269243 452
313 3300013296 Ga0157374_10000206 Ga0157374_1000020626 452
314 3300013296 Ga0157374_10022762 Ga0157374_100227625 452
315 3300013297 Ga0157378_10049524 Ga0157378_100495244 452
316 3300013306 Ga0163162_10000066 Ga0163162_1000006656 452
317 3300013306 Ga0163162_10000178 Ga0163162_100001786 452
318 3300013306 Ga0163162_10013403 Ga0163162_100134036 452
319 3300013307 Ga0157372_10000372 Ga0157372_1000037225 452
320 3300013307 Ga0157372_10019706 Ga0157372_100197064 452
321 3300013307 Ga0157372_10085478 Ga0157372_100854782 452
322 3300013308 Ga0157375_10193692 Ga0157375_101936922 452
323 3300014497 Ga0182008_10001546 Ga0182008_1000154612 452
324 3300014969 Ga0157376_10007372 Ga0157376_100073723 452
325 3300015682 Ga0183373_1006 Ga0183373_1006275 452
326 3300017792 Ga0163161_10000717 Ga0163161_100007176 452
327 3300025233 Ga0209437_100085 Ga0209437_10008560 452
328 3300025245 Ga0207425_1000007 Ga0207425_1000007452 452
329 3300025258 Ga0209129_1000006 Ga0209129_1000006452 452
330 3300025261 Ga0209233_1019795 Ga0209233_10197952 452
331 3300025294 Ga0209025_1000025 Ga0209025_1000025282 452
332 3300025297 Ga0209758_1000016 Ga0209758_1000016452 452
333 3300025904 Ga0207647_10001659 Ga0207647_100016597 452
334 3300025907 Ga0207645_10001018 Ga0207645_1000101810 452
335 3300025909 Ga0207705_10000015 Ga0207705_10000015248 452
336 3300025911 Ga0207654_10004098 Ga0207654_100040985 452
337 3300025913 Ga0207695_10002296 Ga0207695_1000229611 452
338 3300025913 Ga0207695_10004588 Ga0207695_100045885 452
339 3300025914 Ga0207671_10002287 Ga0207671_1000228718 452
340 3300025914 Ga0207671_10008102 Ga0207671_100081024 452
341 3300025914 Ga0207671_10009052 Ga0207671_100090526 452
342 3300025919 Ga0207657_10022604 Ga0207657_100226043 452
343 3300025919 Ga0207657_10169012 Ga0207657_101690122 452
344 3300025931 Ga0207644_10122929 Ga0207644_101229292 452
345 3300025932 Ga0207690_10033556 Ga0207690_100335563 452
346 3300025933 Ga0207706_10000126 Ga0207706_1000012624 452
347 3300025938 Ga0207704_10000209 Ga0207704_1000020920 452
348 3300025949 Ga0207667_10000037 Ga0207667_1000003776 452
349 3300025949 Ga0207667_10121029 Ga0207667_101210292 452
350 3300026089 Ga0207648_10000155 Ga0207648_100001558 452
351 3300028379 Ga0268266_10000052 Ga0268266_1000005295 452
352 3300028786 Ga0307517_10002873 Ga0307517_1000287310 452
353 3300028794 Ga0307515_10000432 Ga0307515_100004329 452
354 3300028794 Ga0307515_10001738 Ga0307515_1000173812 452
355 3300031548 Ga0307408_100001198 Ga0307408_10000119815 452
356 3300031548 Ga0307408_100001304 Ga0307408_10000130418 452
357 3300031911 Ga0307412_10006678 Ga0307412_100066784 452
358 3300033180 Ga0307510_10005315 Ga0307510_100053154 452
359 3300033180 Ga0307510_10006242 Ga0307510_1000624214 452
360 3300035115 Ga0373941_0025534 Ga0373941_0025534_96_1475 452
361 3300037312 Ga0395899_0000001 Ga0395899_0000001_1718624_1719991 452
362 3300037312 Ga0395899_0000608 Ga0395899_0000608_13403_14782 452
363 3300037418 Ga0395900_0000330 Ga0395900_0000330_45351_46730 452
364 3300037418 Ga0395900_0002451 Ga0395900_0002451_10562_11941 452
365 3300037466 Ga0395898_0012298 Ga0395898_0012298_7343_8722 452
366 3300037471 Ga0395905_0000301 Ga0395905_0000301_54583_55962 452
367 3300038443 Ga0395901_0004292 Ga0395901_0004292_9242_10621 452
368 3300039447 Ga0436361_0249079 Ga0436361_0249079_1599_2978 452
369 3300046460 Ga0495638_0089173 Ga0495638_0089173_36_1415 452
370 3300046471 Ga0495650_0000003 Ga0495650_0000003_144350_145732 452
371 3300046492 Ga0495585_0000085 Ga0495585_0000085_46832_48214 452
372 3300046492 Ga0495585_0000156 Ga0495585_0000156_46782_48161 452
373 3300046506 Ga0495583_0011701 Ga0495583_0011701_704_2086 452
374 3300046507 Ga0495606_0000145 Ga0495606_0000145_92541_93923 452
375 3300046512 Ga0495610_0000028 Ga0495610_0000028_192016_193374 452
376 3300046512 Ga0495610_0001185 Ga0495610_0001185_1254_2636 452
377 3300046523 Ga0495644_0004566 Ga0495644_0004566_3320_4699 452
378 3300046524 Ga0495648_0017169 Ga0495648_0017169_3324_4703 452
379 3300046538 Ga0495609_0005836 Ga0495609_0005836_2101_3480 452
380 3300046538 Ga0495609_0063209 Ga0495609_0063209_207_1589 452
381 3300046558 Ga0495633_0000014 Ga0495633_0000014_234986_236365 452
382 3300046558 Ga0495633_0049197 Ga0495633_0049197_218_1600 452
383 3300046616 Ga0495668_0000012 Ga0495668_0000012_339857_341236 452
384 3300046660 Ga0495625_0000005 Ga0495625_0000005_261371_262753 452
385 3300046660 Ga0495625_0007620 Ga0495625_0007620_49_1428 452
386 3300046660 Ga0495625_0016997 Ga0495625_0016997_3289_4668 452
387 3300046660 Ga0495625_0028943 Ga0495625_0028943_1342_2721 452
388 3300046683 Ga0495658_0012902 Ga0495658_0012902_1380_2759 452
389 3300046694 Ga0495649_0000003 Ga0495649_0000003_261381_262763 452
390 3300047323 Ga0495683_0036314 Ga0495683_0036314_967_2346 452
391 3300047443 Ga0495687_000672 Ga0495687_000672_24622_26004 452
392 3300047443 Ga0495687_000762 Ga0495687_000762_25667_27046 452
393 3300047445 Ga0495677_0048818 Ga0495677_0048818_70_1449 452
394 3300047469 Ga0495673_0029169 Ga0495673_0029169_1128_2510 452
395 3300047472 Ga0495686_0001125 Ga0495686_0001125_15394_16773 452
396 3300047472 Ga0495686_0070186 Ga0495686_0070186_206_1585 452
397 3300049823 Ga0501044_0109269 Ga0501044_0109269_223_1668 452
398 3300050493 nmdc:mga0k408_16_c2 nmdc:mga0k408_16_c2_18431_19810 452
399 3300053122 Ga0500608_000451 Ga0500608_000451_4143_5522 452
400 3300053156 Ga0500622_0030142 Ga0500622_0030142_1193_2575 452
401 3300053157 Ga0500624_000290 Ga0500624_000290_6754_8133 452
402 3300003323 rootH1_10244502 rootH1_102445025 453
403 3300003781 Ga0055536_1000011 Ga0055536_100001184 453
404 3300003791 Ga0055530_10008127 Ga0055530_100081274 453
405 3300013102 Ga0157371_10001338 Ga0157371_100013383 453
406 3300013104 Ga0157370_10157477 Ga0157370_101574772 453
407 3300013105 Ga0157369_10282211 Ga0157369_102822112 453
408 3300017792 Ga0163161_10000405 Ga0163161_1000040519 453
409 3300025292 Ga0209676_1000001 Ga0209676_1000001869 453
410 3300025298 Ga0209050_1000016 Ga0209050_1000016535 453
411 3300003323 rootH1_10114913 rootH1_101149132 454
412 3300005288 Ga0065714_10003924 Ga0065714_100039246 454
413 3300013105 Ga0157369_10000006 Ga0157369_10000006268 454
414 3300015261 Ga0182006_1011102 Ga0182006_10111024 454
415 3300015262 Ga0182007_10000001 Ga0182007_10000001216 454
416 3300017792 Ga0163161_10000934 Ga0163161_1000093413 454
417 3300031548 Ga0307408_100001781 Ga0307408_1000017819 454
418 3300032004 Ga0307414_10036394 Ga0307414_100363943 454
419 3300037418 Ga0395900_0009856 Ga0395900_0009856_7985_9370 454
420 3300037471 Ga0395905_0000516 Ga0395905_0000516_49603_50988 454
421 3300038443 Ga0395901_0098046 Ga0395901_0098046_73_1458 454
422 3300053125 Ga0500618_000526 Ga0500618_000526_8554_9939 454
423 2162886007 SwRhRL2b_contig_2414843 SwRhRL2b_0695.00000680 455
424 3300005288 Ga0065714_10002817 Ga0065714_100028179 455
425 3300005288 Ga0065714_10064511 Ga0065714_1006451115 455
426 3300005288 Ga0065714_10065446 Ga0065714_100654467 455
427 3300005289 Ga0065704_10000288 Ga0065704_1000028810 455
428 3300005289 Ga0065704_10077465 Ga0065704_100774653 455
429 3300013100 Ga0157373_10000041 Ga0157373_1000004182 455
430 3300013100 Ga0157373_10003598 Ga0157373_100035985 455
431 3300013102 Ga0157371_10000009 Ga0157371_1000000990 455
432 3300013104 Ga0157370_10000545 Ga0157370_1000054514 455
433 3300015261 Ga0182006_1018772 Ga0182006_10187722 455
434 3300017792 Ga0163161_10057325 Ga0163161_100573252 455
435 3300031731 Ga0307405_10000010 Ga0307405_10000010123 455
436 3300031911 Ga0307412_10000033 Ga0307412_1000003332 455
437 3300032004 Ga0307414_10001227 Ga0307414_1000122711 455
438 3300046512 Ga0495610_0005649 Ga0495610_0005649_5630_7000 455
439 3300053093 Ga0500651_0001275 Ga0500651_0001275_1974_3341 455

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

62

213

0.98

PF01554

MatE

MatE

280

441

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7php-assembly1.cif.gz_A structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em 0.9495 6 446
6z70-assembly1.cif.gz_A structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.9484 9 449
6fv7-assembly1.cif.gz_A dimer structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.9408 14 449
6fv7-assembly1.cif.gz_B dimer structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.9366 16 449
6z71-assembly1.cif.gz_B structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.9356 9 449
ID Description Score Start End Superfamily
af_A0A1D8PCB5_370_524_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9865 254 407 1.20.1250.20
af_Q54YM8_263_426_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9844 252 408 1.20.1250.20
af_Q54DM2_248_409_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9823 253 407 1.20.1250.20
af_E7FEQ7_267_428_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9818 253 407 1.20.1250.20
af_Q9USK3_331_487_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9816 254 407 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1I1L243-F1-model_v4 Multidrug-efflux transporter 0.9909 2 449 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A4Q3X305-F1-model_v4 Multidrug-efflux transporter 0.9852 7 446 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A2E5WIY4-F1-model_v4 Multidrug-efflux transporter 0.9849 9 446 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A2T2VRD2-F1-model_v4 Multidrug-efflux transporter 0.9844 6 449 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A2G6PXF0-F1-model_v4 Multidrug-efflux transporter 0.9842 9 449 GO:0005886
GO:0006811
GO:0015297
GO:0042910

Feature Viewer

pLDDT pTM Quality
87.41 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map