F444117

General Info

Members Datasets Scaffolds Average Seq Length
438 280 876 248

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8003856774|8003861911
Length 259
Sequence GVTDEQRQSPAGPIRVGVFGARGRMGAEVCRAVDAADDLELVAAIDEGDGLSGAAEAGAEVVVDFTTPDVVMDNLRWCIDRGISAVVGTTGFTGERLDRVRGWLERSSPGVGVLIAPNFGIGAVLMMQFATKAARYFESVEIIEQHHPRKLDAPSGTATHTARLIAQARAAAGMGPAPDATKEEVPGARGADIDGVRVHAVRSAGMVAHQEVLFGTTGETLTIRQDSYDRVSFMPGVLLGVRSVRQRPGLTIGLDALLD

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
184 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
243 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
244 2643221679 Angustibacter sp. Root456 Isolate Unclassified
245 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
246 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
247 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
248 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
249 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
250 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
251 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
252 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
253 2857727296 Kocuria sp. R-72562 Isolate Unclassified
254 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
255 2858868258 Micromonospora sp. MH33 Isolate Unclassified
256 2858882152 Micromonospora noduli MED15 Isolate Nodule
257 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
258 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
259 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
260 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
261 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
262 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
263 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
264 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
265 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
266 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
267 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
268 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
269 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
270 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
271 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
272 2902582711 Micromonospora sp. AP08 Isolate Unclassified
273 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
274 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
275 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
276 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
277 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
278 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
279 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
280 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.18
Metatranscriptomes 0.91
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 1.14
Rhizoplane 7.08
Rhizosphere 78.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10008440 3300002459 Bacteria 2109
2 JGI25406J46586_10022681 3300003203 Bacteria 2496
3 Ga0070658_10003228 3300005327 Bacteria 13462
4 Ga0070658_10039559 3300005327 Bacteria 3804
5 Ga0070658_10044957 3300005327 Bacteria 3570
6 Ga0070658_10228273 3300005327 Bacteria 1576
7 Ga0070676_10073414 3300005328 Bacteria 2058
8 Ga0070683_100002350 3300005329 Bacteria 15013
9 Ga0070683_100005477 3300005329 Bacteria 10604
10 Ga0070683_100012319 3300005329 Bacteria 7428
11 Ga0070683_100066784 3300005329 Bacteria 3350
12 Ga0070670_100014883 3300005331 Bacteria 6673
13 Ga0068869_100020649 3300005334 Bacteria 4519
14 Ga0068869_100033092 3300005334 Bacteria 3648
15 Ga0068869_100520793 3300005334 Bacteria 995
16 Ga0070680_100011688 3300005336 Bacteria 6801
17 Ga0070682_100033325 3300005337 Bacteria 3129
18 Ga0070682_100141250 3300005337 Bacteria 1642
19 Ga0070682_100326815 3300005337 Bacteria 1135
20 Ga0068868_100009059 3300005338 Bacteria 7146
21 Ga0068868_100030121 3300005338 Bacteria 4161
22 Ga0068868_100108927 3300005338 Bacteria 2249
23 Ga0070691_10002067 3300005341 Bacteria 8863
24 Ga0070687_100049837 3300005343 Bacteria 2160
25 Ga0070687_100089205 3300005343 Bacteria 1701
26 Ga0070661_100054600 3300005344 Bacteria 2926
27 Ga0070661_100066952 3300005344 Bacteria 2639
28 Ga0070661_100217426 3300005344 Bacteria 1464
29 Ga0070661_100472618 3300005344 Bacteria 1000
30 Ga0070692_10013155 3300005345 Bacteria 3852
31 Ga0070692_10044581 3300005345 Bacteria 2285
32 Ga0070668_100004987 3300005347 Bacteria 9831
33 Ga0070668_100617220 3300005347 Bacteria 950
34 Ga0070669_100311906 3300005353 Bacteria 1268
35 Ga0070675_100000665 3300005354 Bacteria 23782
36 Ga0070675_100052149 3300005354 Bacteria 3362
37 Ga0070671_100016491 3300005355 Bacteria 5971
38 Ga0070688_100374371 3300005365 Bacteria 1048
39 Ga0070659_100047825 3300005366 Bacteria 3358
40 Ga0070659_100050793 3300005366 Bacteria 3260
41 Ga0070667_100361235 3300005367 Bacteria 1316
42 Ga0070709_10019233 3300005434 Bacteria 3945
43 Ga0070714_100104307 3300005435 Bacteria 2502
44 Ga0070714_100184938 3300005435 Bacteria 1898
45 Ga0070714_100715488 3300005435 Bacteria 967
46 Ga0070713_100007498 3300005436 Bacteria 7663
47 Ga0070711_100017813 3300005439 Bacteria 4526
48 Ga0070700_100000782 3300005441 Bacteria 15671
49 Ga0070700_100157954 3300005441 Bacteria 1558
50 Ga0070694_100186049 3300005444 Bacteria 1539
51 Ga0070663_100123691 3300005455 Bacteria 1957
52 Ga0070663_100350919 3300005455 Bacteria 1194
53 Ga0070678_100005047 3300005456 Bacteria 7574
54 Ga0070678_100107377 3300005456 Bacteria 2177
55 Ga0070662_100067302 3300005457 Bacteria 2630
56 Ga0070662_100068571 3300005457 Bacteria 2608
57 Ga0070662_100258958 3300005457 Bacteria 1401
58 Ga0070681_10086162 3300005458 Bacteria 3094
59 Ga0070681_10087089 3300005458 Bacteria 3076
60 Ga0068867_100236545 3300005459 Bacteria 1479
61 Ga0070679_100018736 3300005530 Bacteria 6719
62 Ga0070679_100053058 3300005530 Bacteria 4036
63 Ga0070679_100131486 3300005530 Bacteria 2484
64 Ga0070684_100001375 3300005535 Bacteria 17480
65 Ga0070684_100003901 3300005535 Bacteria 11294
66 Ga0070684_100006208 3300005535 Bacteria 9222
67 Ga0070684_100019880 3300005535 Bacteria 5564
68 Ga0068853_100080346 3300005539 Bacteria 2852
69 Ga0070693_100015423 3300005547 Bacteria 3933
70 Ga0070693_100181811 3300005547 Bacteria 1354
71 Ga0070665_100008182 3300005548 Bacteria 10591
72 Ga0070665_100514791 3300005548 Bacteria 1208
73 Ga0070665_100608191 3300005548 Bacteria 1106
74 Ga0068855_100103357 3300005563 Bacteria 3278
75 Ga0070664_100015132 3300005564 Bacteria 6300
76 Ga0070664_100043490 3300005564 Bacteria 3790
77 Ga0070664_100107470 3300005564 Bacteria 2432
78 Ga0068857_100032748 3300005577 Bacteria 4595
79 Ga0068856_100030303 3300005614 Bacteria 5289
80 Ga0068856_100143086 3300005614 Bacteria 2399
81 Ga0068856_100221072 3300005614 Bacteria 1909
82 Ga0070702_100013166 3300005615 Bacteria 4169
83 Ga0068852_100010863 3300005616 Bacteria 6822
84 Ga0068859_100677985 3300005617 Bacteria 1122
85 Ga0068864_100025768 3300005618 Bacteria 4957
86 Ga0068864_100056977 3300005618 Bacteria 3376
87 Ga0068864_100063613 3300005618 Bacteria 3197
88 Ga0068866_10080853 3300005718 Bacteria 1744
89 Ga0068861_100519126 3300005719 Bacteria 1080
90 Ga0068851_10004136 3300005834 Bacteria 6531
91 Ga0068870_10001235 3300005840 Bacteria 10256
92 Ga0068870_10087248 3300005840 Bacteria 1737
93 Ga0068863_100007651 3300005841 Bacteria 10565
94 Ga0068863_100364626 3300005841 Bacteria 1409
95 Ga0068858_100848703 3300005842 Bacteria 892
96 Ga0068860_100180650 3300005843 Bacteria 2039
97 Ga0068862_100022557 3300005844 Bacteria 5267
98 Ga0081455_10276263 3300005937 Bacteria 1216
99 Ga0081540_1010183 3300005983 Bacteria 6390
100 Ga0081540_1034562 3300005983 Bacteria 2723
101 Ga0081539_10000357 3300005985 Bacteria 100714
102 Ga0081539_10001023 3300005985 Bacteria 51478
103 Ga0081539_10025791 3300005985 Bacteria 3770
104 Ga0081539_10037429 3300005985 Bacteria 2891
105 Ga0070717_10187078 3300006028 Bacteria 1808
106 Ga0075363_100243733 3300006048 Bacteria 1034
107 Ga0070715_10088312 3300006163 Bacteria 1421
108 Ga0097621_100009844 3300006237 Bacteria 6960
109 Ga0068871_100027924 3300006358 Bacteria 4419
110 Ga0075428_100000251 3300006844 Bacteria 52691
111 Ga0075428_100001544 3300006844 Bacteria 24649
112 Ga0075428_100070497 3300006844 Bacteria 3821
113 Ga0075430_100000091 3300006846 Bacteria 52409
114 Ga0075430_100017452 3300006846 Bacteria 6114
115 Ga0075430_100116972 3300006846 Bacteria 2222
116 Ga0075431_100000579 3300006847 Bacteria 30982
117 Ga0075431_100008409 3300006847 Bacteria 10332
118 Ga0075431_100083203 3300006847 Bacteria 3304
119 Ga0075431_100124726 3300006847 Bacteria 2657
120 Ga0075433_10011044 3300006852 Bacteria 7264
121 Ga0075434_100018053 3300006871 Bacteria 6807
122 Ga0075429_100017972 3300006880 Bacteria 6114
123 Ga0068865_100051643 3300006881 Bacteria 2847
124 Ga0075436_100007591 3300006914 Bacteria 7409
125 Ga0075436_100627123 3300006914 Bacteria 793
126 Ga0097620_100677995 3300006931 Bacteria 1122
127 Ga0075435_100009345 3300007076 Bacteria 7092
128 Ga0105251_10036276 3300009011 Bacteria 2427
129 Ga0111539_10023245 3300009094 Bacteria 7615
130 Ga0105245_10015351 3300009098 Bacteria 6676
131 Ga0105247_10040870 3300009101 Bacteria 2836
132 Ga0105247_10080904 3300009101 Bacteria 2047
133 Ga0114129_10000024 3300009147 Bacteria 116794
134 Ga0114129_10242134 3300009147 Bacteria 2424
135 Ga0105243_10236924 3300009148 Bacteria 1622
136 Ga0105241_10003250 3300009174 Bacteria 12088
137 Ga0105248_10395212 3300009177 Bacteria 1557
138 Ga0105237_10098434 3300009545 Bacteria 2916
139 Ga0105238_10022498 3300009551 Bacteria 6425
140 Ga0105238_10421961 3300009551 Bacteria 1329
141 Ga0105238_10890458 3300009551 Bacteria 908
142 Ga0105249_10242413 3300009553 Bacteria 1783
143 Ga0105239_10003785 3300010375 Bacteria 18414
144 Ga0105246_10003879 3300011119 Bacteria 9062
145 Ga0105246_10076247 3300011119 Bacteria 2375
146 Ga0157373_10410558 3300013100 Bacteria 971
147 Ga0157369_10189820 3300013105 Bacteria 2159
148 Ga0157369_10414203 3300013105 Bacteria 1397
149 Ga0157374_10040863 3300013296 Bacteria 4272
150 Ga0163162_10060297 3300013306 Bacteria 3829
151 Ga0157372_10018608 3300013307 Bacteria 7473
152 Ga0157372_10056712 3300013307 Bacteria 4377
153 Ga0157375_10049679 3300013308 Bacteria 4111
154 Ga0157375_10266701 3300013308 Bacteria 1874
155 Ga0157375_10658852 3300013308 Bacteria 1203
156 Ga0163163_10086433 3300014325 Bacteria 3145
157 Ga0163163_10088322 3300014325 Bacteria 3111
158 Ga0163163_10177670 3300014325 Bacteria 2176
159 Ga0163163_10435044 3300014325 Bacteria 1371
160 Ga0163163_10442242 3300014325 Bacteria 1360
161 Ga0157380_10852592 3300014326 Bacteria 933
162 Ga0157377_10009880 3300014745 Bacteria 4703
163 Ga0157376_10173982 3300014969 Bacteria 1963
164 Ga0197907_10635468 3300020069 Bacteria 1159
165 Ga0206356_10682490 3300020070 Bacteria 1879
166 Ga0206353_10097147 3300020082 Bacteria 1130
167 Ga0206353_10507185 3300020082 Bacteria 1795
168 Ga0207713_1022457 3300025735 Bacteria 2995
169 Ga0207692_10416691 3300025898 Bacteria 840
170 Ga0207688_10002582 3300025901 Bacteria 9793
171 Ga0207688_10019671 3300025901 Bacteria 3681
172 Ga0207688_10086877 3300025901 Bacteria 1792
173 Ga0207647_10028802 3300025904 Bacteria 3603
174 Ga0207685_10131116 3300025905 Bacteria 1113
175 Ga0207699_10025974 3300025906 Bacteria 3223
176 Ga0207645_10081747 3300025907 Bacteria 2071
177 Ga0207643_10004654 3300025908 Bacteria 7365
178 Ga0207705_10012616 3300025909 Bacteria 6101
179 Ga0207705_10035503 3300025909 Bacteria 3567
180 Ga0207705_10097295 3300025909 Bacteria 2161
181 Ga0207707_10025956 3300025912 Bacteria 5122
182 Ga0207663_10015307 3300025916 Bacteria 4229
183 Ga0207660_10005867 3300025917 Bacteria 7974
184 Ga0207662_10047833 3300025918 Bacteria 2533
185 Ga0207662_10056295 3300025918 Bacteria 2348
186 Ga0207657_10095708 3300025919 Bacteria 2470
187 Ga0207649_10002820 3300025920 Bacteria 9576
188 Ga0207649_10039598 3300025920 Bacteria 2859
189 Ga0207652_10057235 3300025921 Bacteria 3357
190 Ga0207681_10208746 3300025923 Bacteria 1504
191 Ga0207694_10210486 3300025924 Bacteria 1584
192 Ga0207694_10758844 3300025924 Bacteria 819
193 Ga0207650_10052889 3300025925 Bacteria 3009
194 Ga0207659_10002598 3300025926 Bacteria 10757
195 Ga0207659_10020725 3300025926 Bacteria 4351
196 Ga0207700_10084856 3300025928 Bacteria 2484
197 Ga0207664_10057935 3300025929 Bacteria 3081
198 Ga0207664_10077578 3300025929 Bacteria 2692
199 Ga0207664_10458771 3300025929 Bacteria 1138
200 Ga0207644_10013440 3300025931 Bacteria 5457
201 Ga0207690_10045375 3300025932 Bacteria 2903
202 Ga0207690_10199213 3300025932 Bacteria 1520
203 Ga0207690_10204338 3300025932 Bacteria 1502
204 Ga0207706_10068863 3300025933 Bacteria 3113
205 Ga0207706_10323886 3300025933 Bacteria 1341
206 Ga0207706_10344868 3300025933 Bacteria 1295
207 Ga0207709_10199172 3300025935 Bacteria 1429
208 Ga0207709_10215326 3300025935 Bacteria 1381
209 Ga0207704_10034885 3300025938 Bacteria 2876
210 Ga0207665_10314090 3300025939 Bacteria 1174
211 Ga0207691_10052580 3300025940 Bacteria 3720
212 Ga0207691_10434133 3300025940 Bacteria 1118
213 Ga0207711_10621188 3300025941 Bacteria 1008
214 Ga0207689_10018440 3300025942 Bacteria 5890
215 Ga0207689_10044305 3300025942 Bacteria 3678
216 Ga0207661_10010881 3300025944 Bacteria 6566
217 Ga0207661_10011863 3300025944 Bacteria 6330
218 Ga0207661_10011978 3300025944 Bacteria 6299
219 Ga0207661_10024699 3300025944 Bacteria 4557
220 Ga0207661_10036295 3300025944 Bacteria 3846
221 Ga0207661_10085715 3300025944 Bacteria 2612
222 Ga0207661_10238950 3300025944 Bacteria 1611
223 Ga0207679_10009167 3300025945 Bacteria 6328
224 Ga0207679_10019701 3300025945 Bacteria 4539
225 Ga0207679_10035398 3300025945 Bacteria 3532
226 Ga0207679_10082795 3300025945 Bacteria 2458
227 Ga0207667_10255170 3300025949 Bacteria 1794
228 Ga0207651_10121114 3300025960 Bacteria 1984
229 Ga0207712_10535626 3300025961 Bacteria 1005
230 Ga0207668_10021550 3300025972 Bacteria 4110
231 Ga0207668_10241329 3300025972 Bacteria 1462
232 Ga0207668_10350257 3300025972 Bacteria 1235
233 Ga0207640_10010435 3300025981 Bacteria 5233
234 Ga0207658_10275064 3300025986 Bacteria 1441
235 Ga0207677_10006333 3300026023 Bacteria 6486
236 Ga0207677_10170535 3300026023 Bacteria 1701
237 Ga0207639_10171581 3300026041 Bacteria 1837
238 Ga0207678_10084466 3300026067 Bacteria 2715
239 Ga0207678_10089626 3300026067 Bacteria 2629
240 Ga0207708_10001652 3300026075 Bacteria 16583
241 Ga0207702_10005262 3300026078 Bacteria 11359
242 Ga0207702_10073625 3300026078 Bacteria 2946
243 Ga0207641_10051487 3300026088 Bacteria 3487
244 Ga0207676_10009604 3300026095 Bacteria 6886
245 Ga0207676_10032536 3300026095 Bacteria 3931
246 Ga0207674_10009443 3300026116 Bacteria 11145
247 Ga0207674_10018005 3300026116 Bacteria 7694
248 Ga0207674_10021220 3300026116 Bacteria 7001
249 Ga0207674_10603596 3300026116 Bacteria 1060
250 Ga0207683_10002552 3300026121 Bacteria 15887
251 Ga0207683_10095366 3300026121 Bacteria 2652
252 Ga0207698_10105972 3300026142 Bacteria 2343
253 Ga0207698_10600455 3300026142 Bacteria 1085
254 Ga0207428_10015126 3300027907 Bacteria 6680
255 Ga0268266_10126331 3300028379 Bacteria 2283
256 Ga0268266_10335420 3300028379 Bacteria 1418
257 Ga0268265_10051125 3300028380 Bacteria 3118
258 Ga0268265_10171052 3300028380 Bacteria 1857
259 Ga0268264_10462346 3300028381 Bacteria 1231
260 Ga0307515_10000241 3300028794 Bacteria 135591
261 Ga0307515_10076381 3300028794 Bacteria 4445
262 Ga0307515_10114581 3300028794 Bacteria 3114
263 Ga0307512_10011394 3300030522 Bacteria 8428
264 Ga0307513_10058564 3300031456 Bacteria 4093
265 Ga0307408_100097599 3300031548 Bacteria 2232
266 Ga0307408_100282960 3300031548 Bacteria 1382
267 Ga0307508_10000432 3300031616 Bacteria 49944
268 Ga0307508_10081609 3300031616 Bacteria 2815
269 Ga0307516_10006922 3300031730 Bacteria 13167
270 Ga0307516_10027174 3300031730 Bacteria 5804
271 Ga0307413_10153296 3300031824 Bacteria 1609
272 Ga0307410_10302797 3300031852 Bacteria 1262
273 Ga0326468_10000585 3300031889 Bacteria 3775
274 Ga0307406_10016410 3300031901 Bacteria 4302
275 Ga0307406_10025303 3300031901 Bacteria 3553
276 Ga0307406_10097553 3300031901 Bacteria 1994
277 Ga0307407_10094409 3300031903 Bacteria 1841
278 Ga0307407_10258808 3300031903 Bacteria 1196
279 Ga0307412_10054676 3300031911 Bacteria 2651
280 Ga0307409_100005473 3300031995 Bacteria 7318
281 Ga0307409_100614431 3300031995 Bacteria 1076
282 Ga0307416_100004436 3300032002 Bacteria 8458
283 Ga0307416_100734281 3300032002 Bacteria 1079
284 Ga0307416_100991527 3300032002 Bacteria 943
285 Ga0307411_10067791 3300032005 Bacteria 2403
286 Ga0307415_100014792 3300032126 Bacteria 4601
287 Ga0307415_100016289 3300032126 Bacteria 4428
288 Ga0307415_100112752 3300032126 Bacteria 2021
289 Ga0307415_100430296 3300032126 Bacteria 1135
290 Ga0373938_0062481 3300034957 Bacteria 874
291 Ga0373940_0010309 3300035088 Bacteria 2193
292 Ga0373951_0000072 3300035091 Bacteria 40164
293 Ga0373955_0091408 3300035172 Bacteria 1735
294 Ga0373942_0000768 3300035207 Bacteria 8831
295 Ga0373931_0223241 3300035691 Bacteria 1135
296 Ga0373935_0015203 3300035692 Bacteria 4650
297 Ga0373927_0001754 3300035695 Bacteria 16186
298 Ga0373925_0002236 3300037068 Bacteria 15702
299 Ga0395900_0098808 3300037418 Bacteria 2999
300 Ga0395898_0070752 3300037466 Bacteria 3372
301 Ga0395905_0173332 3300037471 Bacteria 2026
302 Ga0436364_0624094 3300037853 Bacteria 124588
303 Ga0439466_0042363 3300041411 Bacteria 1516
304 Ga0451853_3098818 3300041512 Bacteria 3398
305 Ga0451853_3404556 3300041512 Bacteria 1094
306 Ga0439448_0008170 3300042005 Bacteria 3057
307 Ga0439448_0036400 3300042005 Bacteria 1579
308 Ga0450902_021453 3300042137 Bacteria 1068
309 Ga0439459_0049260 3300042438 Bacteria 920
310 Ga0466963_0025982 3300044694 Bacteria 3741
311 Ga0451576_0329999 3300045051 Bacteria 1597
312 Ga0466967_0042012 3300045976 Bacteria 3947
313 Ga0466967_0071052 3300045976 Bacteria 3116
314 Ga0495590_0158962 3300046457 Bacteria 821
315 Ga0495629_0112154 3300046459 Bacteria 1901
316 Ga0495629_0184518 3300046459 Bacteria 1445
317 Ga0495594_0072418 3300046499 Bacteria 1917
318 Ga0496100_0075099 3300048903 Bacteria 2266
319 Ga0496102_0071709 3300048905 Bacteria 3181
320 Ga0496102_0191461 3300048905 Bacteria 1927
321 Ga0496103_0253744 3300048906 Bacteria 1132
322 Ga0496104_0022785 3300048907 Bacteria 5753
323 Ga0496104_0181455 3300048907 Bacteria 2015
324 Ga0496104_0302306 3300048907 Bacteria 1512
325 Ga0496105_0032103 3300048908 Bacteria 4307
326 Ga0496106_0002401 3300048909 Bacteria 13955
327 Ga0496107_0177247 3300048910 Bacteria 1583
328 Ga0496108_0000028 3300048911 Bacteria 168580
329 Ga0496108_0021944 3300048911 Bacteria 5247
330 Ga0496109_0022236 3300048912 Bacteria 5615
331 Ga0496109_0059153 3300048912 Bacteria 3501
332 Ga0496109_0087972 3300048912 Bacteria 2870
333 Ga0496109_0289967 3300048912 Bacteria 1543
334 Ga0496110_0025275 3300048913 Bacteria 5073
335 Ga0496110_0028669 3300048913 Bacteria 4784
336 Ga0496110_0036865 3300048913 Bacteria 4248
337 Ga0496110_0119151 3300048913 Bacteria 2377
338 Ga0496111_0019500 3300048914 Bacteria 4712
339 Ga0496111_0053049 3300048914 Bacteria 2929
340 Ga0496111_0088209 3300048914 Bacteria 2271
341 Ga0496111_0091718 3300048914 Bacteria 2226
342 Ga0496112_0004351 3300048915 Bacteria 11977
343 Ga0496112_0090532 3300048915 Bacteria 3028
344 Ga0496112_0112150 3300048915 Bacteria 2696
345 Ga0496112_0116838 3300048915 Bacteria 2638
346 Ga0496113_0148103 3300048916 Bacteria 1851
347 Ga0496113_0282041 3300048916 Bacteria 1328
348 Ga0496114_0573874 3300048917 Bacteria 996
349 Ga0496119_0077453 3300048922 Bacteria 1926
350 Ga0496119_0148239 3300048922 Bacteria 1260
351 Ga0496122_0001065 3300048925 Bacteria 47730
352 Ga0496122_0002068 3300048925 Bacteria 29759
353 Ga0496123_0001305 3300048926 Bacteria 35428
354 Ga0496124_0001856 3300048927 Bacteria 29184
355 Ga0496125_0000172 3300048928 Bacteria 144915
356 Ga0496125_0001719 3300048928 Bacteria 30449
357 Ga0501034_0037152 3300049571 Bacteria 4932
358 Ga0501038_0103487 3300049574 Bacteria 2368
359 Ga0501040_0212629 3300049576 Bacteria 1375
360 Ga0501046_0207934 3300049580 Bacteria 1454
361 Ga0501047_0042014 3300049581 Bacteria 4418
362 Ga0501047_0484137 3300049581 Bacteria 1065
363 Ga0501067_0001116 3300049583 Bacteria 14530
364 Ga0501068_0065181 3300049584 Bacteria 2217
365 Ga0501069_0025980 3300049585 Bacteria 3205
366 Ga0501070_0006412 3300049586 Bacteria 10013
367 Ga0501070_0014740 3300049586 Bacteria 6578
368 Ga0501072_0036676 3300049588 Bacteria 3844
369 Ga0501073_0005484 3300049589 Bacteria 9506
370 Ga0501074_0005285 3300049590 Bacteria 9297
371 Ga0501074_0021357 3300049590 Bacteria 4701
372 Ga0501077_0010216 3300049593 Bacteria 5845
373 Ga0501079_0070899 3300049741 Bacteria 2691
374 Ga0501079_0528942 3300049741 Bacteria 927
375 Ga0501080_0070761 3300049742 Bacteria 3244
376 Ga0501044_0518157 3300049823 Bacteria 1092
377 nmdc:mga03n38_123483_c1 3300050490 Bacteria 1275
378 nmdc:mga05p37_189_c1 3300050507 Bacteria 61137
379 nmdc:mga09592_2_c1 3300050508 Bacteria 168133
380 nmdc:mga0qj67_10_c2 3300050509 Bacteria 57980
381 nmdc:mga0qj67_44276_c1 3300050509 Bacteria 3507
382 nmdc:mga0qj67_58605_c1 3300050509 Bacteria 3053
383 nmdc:mga06r32_113946_c1 3300050510 Bacteria 2662
384 nmdc:mga06r32_11892_c1 3300050510 Bacteria 7840
385 nmdc:mga06r32_39_c1 3300050510 Bacteria 54656
386 nmdc:mga0n895_222808_c1 3300050512 Bacteria 1915
387 nmdc:mga0n895_749773_c1 3300050512 Bacteria 969
388 nmdc:mga0rr50_9857_c1 3300050513 Bacteria 6036
389 nmdc:mga08x19_536391_c1 3300050514 Bacteria 827
390 nmdc:mga08x19_87201_c1 3300050514 Bacteria 2056
391 nmdc:mga0a205_135546_c1 3300050515 Bacteria 2363
392 Ga0500644_0001372 3300053088 Bacteria 6487
393 Ga0500594_0021900 3300053118 Bacteria 1607
394 Ga0500594_0100316 3300053118 Bacteria 890
395 Ga0500568_0002215 3300053139 Bacteria 11675
396 Ga0500616_0000612 3300053153 Bacteria 43296
397 Ga0500630_041901 3300053159 Bacteria 2234
398 Ga0501084_0099895 3300054114 Bacteria 2436
399 Ga0501082_0031460 3300060353 Bacteria 4576
400 8003861911 8003856774 Bacteria 7675274
401 2552109304 2551306166 Bacteria 9731570
402 2644446490 2643221679 Bacteria 3839507
403 2744957209 2744054611 Bacteria 5611514
404 2772644744 2772190715 Bacteria 6959372
405 2812365528 2811994880 Bacteria 4147780
406 2831937960 2831935698 Bacteria 5963223
407 2848551873 2848551377 Bacteria 3720646
408 2855674290 2855670206 Bacteria 7120389
409 2855682174 2855676851 Bacteria 7063653
410 2857292413 2857288857 Bacteria 7189066
411 2857728889 2857727296 Bacteria 2745552
412 2858853080 2858848962 Bacteria 6963058
413 2858875820 2858868258 Bacteria 7683772
414 2858884167 2858882152 Bacteria 7230291
415 2858889679 2858888857 Bacteria 7060307
416 2858896599 2858895516 Bacteria 7378898
417 2858903855 2858902515 Bacteria 7086037
418 2866552562 2866552031 Bacteria 5824618
419 2867304785 2867302475 Bacteria 7087181
420 2867315575 2867312974 Bacteria 7058875
421 2867324461 2867319477 Bacteria 7069771
422 2867507799 2867507094 Bacteria 6506033
423 2868091137 2868088558 Bacteria 7609351
424 2869051758 2869048445 Bacteria 6875584
425 2869068223 2869061728 Bacteria 7112407
426 2869075106 2869068681 Bacteria 7205615
427 2880492961 2880489317 Bacteria 7096270
428 2880499342 2880495981 Bacteria 7340502
429 2884995056 2884994152 Bacteria 4492978
430 2902587931 2902582711 Bacteria 6187705
431 2929221318 2929219909 Bacteria 6984360
432 2929227942 2929226422 Bacteria 7248583
433 3001891833 3001889506 Bacteria 2975194
434 3003003158 3002998708 Bacteria 11715108
435 8003878106 8003870546 Bacteria 7396674
436 8054710419 8054704163 Bacteria 7247792
437 8054731990 8054727385 Bacteria 7558670
438 8054739084 8054734606 Bacteria 6947278
439 JGI24751J29686_10008440
440 JGI25406J46586_10022681
441 Ga0070658_10003228
442 Ga0070658_10039559
443 Ga0070658_10044957
444 Ga0070658_10228273
445 Ga0070676_10073414
446 Ga0070683_100002350
447 Ga0070683_100005477
448 Ga0070683_100012319
449 Ga0070683_100066784
450 Ga0070670_100014883
451 Ga0068869_100020649
452 Ga0068869_100033092
453 Ga0068869_100520793
454 Ga0070680_100011688
455 Ga0070682_100033325
456 Ga0070682_100141250
457 Ga0070682_100326815
458 Ga0068868_100009059
459 Ga0068868_100030121
460 Ga0068868_100108927
461 Ga0070691_10002067
462 Ga0070687_100049837
463 Ga0070687_100089205
464 Ga0070661_100054600
465 Ga0070661_100066952
466 Ga0070661_100217426
467 Ga0070661_100472618
468 Ga0070692_10013155
469 Ga0070692_10044581
470 Ga0070668_100004987
471 Ga0070668_100617220
472 Ga0070669_100311906
473 Ga0070675_100000665
474 Ga0070675_100052149
475 Ga0070671_100016491
476 Ga0070688_100374371
477 Ga0070659_100047825
478 Ga0070659_100050793
479 Ga0070667_100361235
480 Ga0070709_10019233
481 Ga0070714_100104307
482 Ga0070714_100184938
483 Ga0070714_100715488
484 Ga0070713_100007498
485 Ga0070711_100017813
486 Ga0070700_100000782
487 Ga0070700_100157954
488 Ga0070694_100186049
489 Ga0070663_100123691
490 Ga0070663_100350919
491 Ga0070678_100005047
492 Ga0070678_100107377
493 Ga0070662_100067302
494 Ga0070662_100068571
495 Ga0070662_100258958
496 Ga0070681_10086162
497 Ga0070681_10087089
498 Ga0068867_100236545
499 Ga0070679_100018736
500 Ga0070679_100053058
501 Ga0070679_100131486
502 Ga0070684_100001375
503 Ga0070684_100003901
504 Ga0070684_100006208
505 Ga0070684_100019880
506 Ga0068853_100080346
507 Ga0070693_100015423
508 Ga0070693_100181811
509 Ga0070665_100008182
510 Ga0070665_100514791
511 Ga0070665_100608191
512 Ga0068855_100103357
513 Ga0070664_100015132
514 Ga0070664_100043490
515 Ga0070664_100107470
516 Ga0068857_100032748
517 Ga0068856_100030303
518 Ga0068856_100143086
519 Ga0068856_100221072
520 Ga0070702_100013166
521 Ga0068852_100010863
522 Ga0068859_100677985
523 Ga0068864_100025768
524 Ga0068864_100056977
525 Ga0068864_100063613
526 Ga0068866_10080853
527 Ga0068861_100519126
528 Ga0068851_10004136
529 Ga0068870_10001235
530 Ga0068870_10087248
531 Ga0068863_100007651
532 Ga0068863_100364626
533 Ga0068858_100848703
534 Ga0068860_100180650
535 Ga0068862_100022557
536 Ga0081455_10276263
537 Ga0081540_1010183
538 Ga0081540_1034562
539 Ga0081539_10000357
540 Ga0081539_10001023
541 Ga0081539_10025791
542 Ga0081539_10037429
543 Ga0070717_10187078
544 Ga0075363_100243733
545 Ga0070715_10088312
546 Ga0097621_100009844
547 Ga0068871_100027924
548 Ga0075428_100000251
549 Ga0075428_100001544
550 Ga0075428_100070497
551 Ga0075430_100000091
552 Ga0075430_100017452
553 Ga0075430_100116972
554 Ga0075431_100000579
555 Ga0075431_100008409
556 Ga0075431_100083203
557 Ga0075431_100124726
558 Ga0075433_10011044
559 Ga0075434_100018053
560 Ga0075429_100017972
561 Ga0068865_100051643
562 Ga0075436_100007591
563 Ga0075436_100627123
564 Ga0097620_100677995
565 Ga0075435_100009345
566 Ga0105251_10036276
567 Ga0111539_10023245
568 Ga0105245_10015351
569 Ga0105247_10040870
570 Ga0105247_10080904
571 Ga0114129_10000024
572 Ga0114129_10242134
573 Ga0105243_10236924
574 Ga0105241_10003250
575 Ga0105248_10395212
576 Ga0105237_10098434
577 Ga0105238_10022498
578 Ga0105238_10421961
579 Ga0105238_10890458
580 Ga0105249_10242413
581 Ga0105239_10003785
582 Ga0105246_10003879
583 Ga0105246_10076247
584 Ga0157373_10410558
585 Ga0157369_10189820
586 Ga0157369_10414203
587 Ga0157374_10040863
588 Ga0163162_10060297
589 Ga0157372_10018608
590 Ga0157372_10056712
591 Ga0157375_10049679
592 Ga0157375_10266701
593 Ga0157375_10658852
594 Ga0163163_10086433
595 Ga0163163_10088322
596 Ga0163163_10177670
597 Ga0163163_10435044
598 Ga0163163_10442242
599 Ga0157380_10852592
600 Ga0157377_10009880
601 Ga0157376_10173982
602 Ga0197907_10635468
603 Ga0206356_10682490
604 Ga0206353_10097147
605 Ga0206353_10507185
606 Ga0207713_1022457
607 Ga0207692_10416691
608 Ga0207688_10002582
609 Ga0207688_10019671
610 Ga0207688_10086877
611 Ga0207647_10028802
612 Ga0207685_10131116
613 Ga0207699_10025974
614 Ga0207645_10081747
615 Ga0207643_10004654
616 Ga0207705_10012616
617 Ga0207705_10035503
618 Ga0207705_10097295
619 Ga0207707_10025956
620 Ga0207663_10015307
621 Ga0207660_10005867
622 Ga0207662_10047833
623 Ga0207662_10056295
624 Ga0207657_10095708
625 Ga0207649_10002820
626 Ga0207649_10039598
627 Ga0207652_10057235
628 Ga0207681_10208746
629 Ga0207694_10210486
630 Ga0207694_10758844
631 Ga0207650_10052889
632 Ga0207659_10002598
633 Ga0207659_10020725
634 Ga0207700_10084856
635 Ga0207664_10057935
636 Ga0207664_10077578
637 Ga0207664_10458771
638 Ga0207644_10013440
639 Ga0207690_10045375
640 Ga0207690_10199213
641 Ga0207690_10204338
642 Ga0207706_10068863
643 Ga0207706_10323886
644 Ga0207706_10344868
645 Ga0207709_10199172
646 Ga0207709_10215326
647 Ga0207704_10034885
648 Ga0207665_10314090
649 Ga0207691_10052580
650 Ga0207691_10434133
651 Ga0207711_10621188
652 Ga0207689_10018440
653 Ga0207689_10044305
654 Ga0207661_10010881
655 Ga0207661_10011863
656 Ga0207661_10011978
657 Ga0207661_10024699
658 Ga0207661_10036295
659 Ga0207661_10085715
660 Ga0207661_10238950
661 Ga0207679_10009167
662 Ga0207679_10019701
663 Ga0207679_10035398
664 Ga0207679_10082795
665 Ga0207667_10255170
666 Ga0207651_10121114
667 Ga0207712_10535626
668 Ga0207668_10021550
669 Ga0207668_10241329
670 Ga0207668_10350257
671 Ga0207640_10010435
672 Ga0207658_10275064
673 Ga0207677_10006333
674 Ga0207677_10170535
675 Ga0207639_10171581
676 Ga0207678_10084466
677 Ga0207678_10089626
678 Ga0207708_10001652
679 Ga0207702_10005262
680 Ga0207702_10073625
681 Ga0207641_10051487
682 Ga0207676_10009604
683 Ga0207676_10032536
684 Ga0207674_10009443
685 Ga0207674_10018005
686 Ga0207674_10021220
687 Ga0207674_10603596
688 Ga0207683_10002552
689 Ga0207683_10095366
690 Ga0207698_10105972
691 Ga0207698_10600455
692 Ga0207428_10015126
693 Ga0268266_10126331
694 Ga0268266_10335420
695 Ga0268265_10051125
696 Ga0268265_10171052
697 Ga0268264_10462346
698 Ga0307515_10000241
699 Ga0307515_10076381
700 Ga0307515_10114581
701 Ga0307512_10011394
702 Ga0307513_10058564
703 Ga0307408_100097599
704 Ga0307408_100282960
705 Ga0307508_10000432
706 Ga0307508_10081609
707 Ga0307516_10006922
708 Ga0307516_10027174
709 Ga0307413_10153296
710 Ga0307410_10302797
711 Ga0326468_10000585
712 Ga0307406_10016410
713 Ga0307406_10025303
714 Ga0307406_10097553
715 Ga0307407_10094409
716 Ga0307407_10258808
717 Ga0307412_10054676
718 Ga0307409_100005473
719 Ga0307409_100614431
720 Ga0307416_100004436
721 Ga0307416_100734281
722 Ga0307416_100991527
723 Ga0307411_10067791
724 Ga0307415_100014792
725 Ga0307415_100016289
726 Ga0307415_100112752
727 Ga0307415_100430296
728 Ga0373938_0062481
729 Ga0373940_0010309
730 Ga0373951_0000072
731 Ga0373955_0091408
732 Ga0373942_0000768
733 Ga0373931_0223241
734 Ga0373935_0015203
735 Ga0373927_0001754
736 Ga0373925_0002236
737 Ga0395900_0098808
738 Ga0395898_0070752
739 Ga0395905_0173332
740 Ga0436364_0624094
741 Ga0439466_0042363
742 Ga0451853_3098818
743 Ga0451853_3404556
744 Ga0439448_0008170
745 Ga0439448_0036400
746 Ga0450902_021453
747 Ga0439459_0049260
748 Ga0466963_0025982
749 Ga0451576_0329999
750 Ga0466967_0042012
751 Ga0466967_0071052
752 Ga0495590_0158962
753 Ga0495629_0112154
754 Ga0495629_0184518
755 Ga0495594_0072418
756 Ga0496100_0075099
757 Ga0496102_0071709
758 Ga0496102_0191461
759 Ga0496103_0253744
760 Ga0496104_0022785
761 Ga0496104_0181455
762 Ga0496104_0302306
763 Ga0496105_0032103
764 Ga0496106_0002401
765 Ga0496107_0177247
766 Ga0496108_0000028
767 Ga0496108_0021944
768 Ga0496109_0022236
769 Ga0496109_0059153
770 Ga0496109_0087972
771 Ga0496109_0289967
772 Ga0496110_0025275
773 Ga0496110_0028669
774 Ga0496110_0036865
775 Ga0496110_0119151
776 Ga0496111_0019500
777 Ga0496111_0053049
778 Ga0496111_0088209
779 Ga0496111_0091718
780 Ga0496112_0004351
781 Ga0496112_0090532
782 Ga0496112_0112150
783 Ga0496112_0116838
784 Ga0496113_0148103
785 Ga0496113_0282041
786 Ga0496114_0573874
787 Ga0496119_0077453
788 Ga0496119_0148239
789 Ga0496122_0001065
790 Ga0496122_0002068
791 Ga0496123_0001305
792 Ga0496124_0001856
793 Ga0496125_0000172
794 Ga0496125_0001719
795 Ga0501034_0037152
796 Ga0501038_0103487
797 Ga0501040_0212629
798 Ga0501046_0207934
799 Ga0501047_0042014
800 Ga0501047_0484137
801 Ga0501067_0001116
802 Ga0501068_0065181
803 Ga0501069_0025980
804 Ga0501070_0006412
805 Ga0501070_0014740
806 Ga0501072_0036676
807 Ga0501073_0005484
808 Ga0501074_0005285
809 Ga0501074_0021357
810 Ga0501077_0010216
811 Ga0501079_0070899
812 Ga0501079_0528942
813 Ga0501080_0070761
814 Ga0501044_0518157
815 nmdc:mga03n38_123483_c1
816 nmdc:mga05p37_189_c1
817 nmdc:mga09592_2_c1
818 nmdc:mga0qj67_10_c2
819 nmdc:mga0qj67_44276_c1
820 nmdc:mga0qj67_58605_c1
821 nmdc:mga06r32_113946_c1
822 nmdc:mga06r32_11892_c1
823 nmdc:mga06r32_39_c1
824 nmdc:mga0n895_222808_c1
825 nmdc:mga0n895_749773_c1
826 nmdc:mga0rr50_9857_c1
827 nmdc:mga08x19_536391_c1
828 nmdc:mga08x19_87201_c1
829 nmdc:mga0a205_135546_c1
830 Ga0500644_0001372
831 Ga0500594_0021900
832 Ga0500594_0100316
833 Ga0500568_0002215
834 Ga0500616_0000612
835 Ga0500630_041901
836 Ga0501084_0099895
837 Ga0501082_0031460
838 8003861911
839 2552109304
840 2644446490
841 2744957209
842 2772644744
843 2812365528
844 2831937960
845 2848551873
846 2855674290
847 2855682174
848 2857292413
849 2857728889
850 2858853080
851 2858875820
852 2858884167
853 2858889679
854 2858896599
855 2858903855
856 2866552562
857 2867304785
858 2867315575
859 2867324461
860 2867507799
861 2868091137
862 2869051758
863 2869068223
864 2869075106
865 2880492961
866 2880499342
867 2884995056
868 2902587931
869 2929221318
870 2929227942
871 3001891833
872 3003003158
873 8003878106
874 8054710419
875 8054731990
876 8054739084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

14

119

0.93

PF05173

DapB_C

Dihydrodipicolinate reductase, C-terminus

122

258

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yl5-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a) 0.9806 9 255
5tek-assembly1.cif.gz_A apo structure of 4-hydroxy-tetrahydrodipicolinate reductase from mycobacterium tuberculosis 0.9794 8 255
1yl5-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a) 0.9689 9 255
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.9677 10 252
5tek-assembly1.cif.gz_A apo structure of 4-hydroxy-tetrahydrodipicolinate reductase from mycobacterium tuberculosis 0.964 8 255
ID Description Score Start End Superfamily
af_P9WP23_2_88_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9951 11 96 3.40.50.720
af_P9WP23_2_120_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9945 11 128 3.50.50.60
1yl7C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.99 11 255 3.40.50.720
1c3vA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.984 115 222 3.30.360.10
af_P9WP23_2_120_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.978 11 128 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6I3D5I3-F1-model_v4 deleted 1.001 9 86
AF-A0A7V9BXP0-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9946 8 110 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A4Q4CKF8-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9941 11 87 GO:0008839
GO:0009089
AF-A0A1X4I634-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9907 8 101 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A255EIP9-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) 0.9851 11 254 GO:0005829
GO:0008839
GO:0009089
GO:0016726
GO:0019877
GO:0050661
GO:0051287

Map