F444090

General Info

Members Datasets Scaffolds Average Seq Length
438 242 876 129

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_437198_c1|nmdc:mga05p37_437198_c1_532_978
Length 148
Sequence LAAYRLVASRLLAELGGSIVSLLILVVDDESDVEMLFRQQFRRDLRAGRFTFEFAQSAAAALQCIESAADVSLILILSDINMPGMTGLELLPKAKAVRPDVPVIMITAYGDAETKHKALEGGAEALFTKPIDFGMLRSEIDTRVAKAA

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
84 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
85 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
86 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
229 2516143018 Ensifer sp. BR816 Isolate Nodule
230 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
231 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
232 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
233 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
234 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
235 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
236 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
237 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
238 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
239 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
240 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
241 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
242 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 0.23
Isolates 3.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 3.65
Rhizoplane 12.1
Rhizosphere 82.19
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_437198_c1 3300050507 Bacteria 1518
2 Ga0065165_1102513 3300005262 Bacteria 714
3 Ga0065707_10036731 3300005295 Bacteria 1165
4 Ga0065707_10123973 3300005295 Bacteria 2054
5 Ga0070683_101105958 3300005329 Bacteria 761
6 Ga0070690_101510206 3300005330 Bacteria 543
7 Ga0070682_100425163 3300005337 Bacteria 1011
8 Ga0070682_101164568 3300005337 Bacteria 649
9 Ga0068868_100226751 3300005338 Bacteria 1566
10 Ga0070661_100303790 3300005344 Bacteria 1243
11 Ga0070668_101111473 3300005347 Bacteria 714
12 Ga0070675_101386255 3300005354 Bacteria 648
13 Ga0070673_100139165 3300005364 Bacteria 2046
14 Ga0070709_10426124 3300005434 Bacteria 995
15 Ga0070714_100065983 3300005435 Bacteria 3119
16 Ga0070713_100229587 3300005436 Bacteria 1687
17 Ga0070713_100624654 3300005436 Bacteria 1025
18 Ga0070708_100446731 3300005445 Bacteria 1220
19 Ga0070663_100035689 3300005455 Bacteria 3451
20 Ga0070662_100261014 3300005457 Bacteria 1395
21 Ga0070681_10008846 3300005458 Bacteria 9892
22 Ga0068867_100383810 3300005459 Bacteria 1181
23 Ga0070706_100472433 3300005467 Bacteria 1167
24 Ga0070707_100341128 3300005468 Bacteria 1455
25 Ga0070698_100256855 3300005471 Bacteria 1680
26 Ga0070698_100913009 3300005471 Bacteria 824
27 Ga0070679_100005046 3300005530 Bacteria 12185
28 Ga0070684_100425249 3300005535 Bacteria 1226
29 Ga0070684_101065706 3300005535 Bacteria 759
30 Ga0070697_100312742 3300005536 Bacteria 1352
31 Ga0070697_100511449 3300005536 Bacteria 1051
32 Ga0070697_100902414 3300005536 Bacteria 784
33 Ga0068853_100069401 3300005539 Bacteria 3066
34 Ga0068853_101527361 3300005539 Bacteria 647
35 Ga0070672_101459173 3300005543 Bacteria 613
36 Ga0070686_100953809 3300005544 Bacteria 701
37 Ga0070686_101283090 3300005544 Bacteria 611
38 Ga0070665_100013434 3300005548 Bacteria 8238
39 Ga0070664_100055102 3300005564 Bacteria 3374
40 Ga0068854_101362949 3300005578 Bacteria 640
41 Ga0068856_100485383 3300005614 Bacteria 1257
42 Ga0068856_102398430 3300005614 Bacteria 535
43 Ga0068852_100722595 3300005616 Bacteria 1007
44 Ga0068852_100941625 3300005616 Bacteria 882
45 Ga0068859_101105063 3300005617 Bacteria 872
46 Ga0068864_100556844 3300005618 Bacteria 1109
47 Ga0068861_100320863 3300005719 Bacteria 1349
48 Ga0068851_10153094 3300005834 Bacteria 1262
49 Ga0068851_10549495 3300005834 Bacteria 698
50 Ga0068870_10673363 3300005840 Bacteria 711
51 Ga0068863_101054193 3300005841 Bacteria 817
52 Ga0081455_10007941 3300005937 Bacteria 11102
53 Ga0081455_10008660 3300005937 Bacteria 10542
54 Ga0081455_10022133 3300005937 Bacteria 5948
55 Ga0081455_10051509 3300005937 Bacteria 3531
56 Ga0081455_10109486 3300005937 Bacteria 2198
57 Ga0070717_10345142 3300006028 Bacteria 1330
58 Ga0070717_12111514 3300006028 Bacteria 507
59 Ga0075365_10072373 3300006038 Bacteria 2322
60 Ga0070715_10212428 3300006163 Bacteria 990
61 Ga0070715_10271148 3300006163 Bacteria 896
62 Ga0070716_100152107 3300006173 Bacteria 1490
63 Ga0070716_100240275 3300006173 Bacteria 1228
64 Ga0070716_100316917 3300006173 Bacteria 1091
65 Ga0070712_100655631 3300006175 Bacteria 892
66 Ga0070712_101073534 3300006175 Unclassified 698
67 Ga0070712_101487096 3300006175 Bacteria 592
68 Ga0075427_10001611 3300006194 Bacteria 2921
69 Ga0075427_10011207 3300006194 Bacteria 1350
70 Ga0075427_10014246 3300006194 Bacteria 1219
71 Ga0097621_100032051 3300006237 Bacteria 4176
72 Ga0097621_100082009 3300006237 Bacteria 2685
73 Ga0068871_100623162 3300006358 Bacteria 983
74 Ga0075428_100007899 3300006844 Bacteria 11795
75 Ga0075428_100375934 3300006844 Bacteria 1523
76 Ga0075430_100001022 3300006846 Bacteria 22142
77 Ga0075431_100020083 3300006847 Bacteria 6822
78 Ga0075431_100035664 3300006847 Bacteria 5121
79 Ga0075433_10003427 3300006852 Bacteria 12228
80 Ga0075433_10060979 3300006852 Bacteria 3304
81 Ga0075433_10256926 3300006852 Bacteria 1549
82 Ga0075434_100001215 3300006871 Bacteria 21397
83 Ga0075434_100044793 3300006871 Bacteria 4388
84 Ga0075434_101764941 3300006871 Bacteria 626
85 Ga0075429_100000941 3300006880 Bacteria 23046
86 Ga0075429_100052284 3300006880 Bacteria 3554
87 Ga0075429_100562136 3300006880 Bacteria 1000
88 Ga0097620_101105315 3300006931 Bacteria 872
89 Ga0075435_100048376 3300007076 Bacteria 3416
90 Ga0075435_100519890 3300007076 Bacteria 1030
91 Ga0075435_100709148 3300007076 Bacteria 875
92 Ga0075435_101094723 3300007076 Bacteria 696
93 Ga0075435_101225951 3300007076 Unclassified 656
94 Ga0099794_10024720 3300007265 Bacteria 2760
95 Ga0099794_10034263 3300007265 Bacteria 2391
96 Ga0099794_10282609 3300007265 Bacteria 858
97 Ga0099795_10031703 3300007788 Bacteria 1822
98 Ga0099795_10055497 3300007788 Bacteria 1455
99 Ga0099795_10068352 3300007788 Bacteria 1335
100 Ga0099795_10102420 3300007788 Bacteria 1125
101 Ga0099795_10134940 3300007788 Bacteria 999
102 Ga0111539_10001115 3300009094 Bacteria 35484
103 Ga0111539_10028039 3300009094 Bacteria 6875
104 Ga0111539_10225586 3300009094 Bacteria 2182
105 Ga0111539_10256107 3300009094 Bacteria 2038
106 Ga0111539_10446342 3300009094 Bacteria 1506
107 Ga0105245_10003945 3300009098 Bacteria 13199
108 Ga0105245_10308731 3300009098 Bacteria 1555
109 Ga0105247_10045597 3300009101 Bacteria 2690
110 Ga0105247_10110293 3300009101 Bacteria 1770
111 Ga0114129_10005318 3300009147 Bacteria 18171
112 Ga0114129_10033922 3300009147 Bacteria 7209
113 Ga0114129_10044447 3300009147 Bacteria 6249
114 Ga0114129_10111644 3300009147 Bacteria 3772
115 Ga0114129_10369155 3300009147 Bacteria 1897
116 Ga0114129_10951903 3300009147 Bacteria 1085
117 Ga0114129_11007153 3300009147 Bacteria 1049
118 Ga0114129_11067810 3300009147 Bacteria 1013
119 Ga0105243_10302206 3300009148 Bacteria 1451
120 Ga0105243_10571166 3300009148 Bacteria 1084
121 Ga0105241_10110017 3300009174 Bacteria 2204
122 Ga0105241_11337413 3300009174 Bacteria 684
123 Ga0105242_10083701 3300009176 Bacteria 2672
124 Ga0105242_10165275 3300009176 Bacteria 1941
125 Ga0105248_10107099 3300009177 Bacteria 3152
126 Ga0105248_10419140 3300009177 Bacteria 1508
127 Ga0105237_10350646 3300009545 Bacteria 1480
128 Ga0105238_10130557 3300009551 Bacteria 2490
129 Ga0105238_10184795 3300009551 Bacteria 2061
130 Ga0105238_10282885 3300009551 Bacteria 1640
131 Ga0099796_10021439 3300010159 Bacteria 1990
132 Ga0099796_10038225 3300010159 Bacteria 1609
133 Ga0099796_10041628 3300010159 Bacteria 1556
134 Ga0099796_10061937 3300010159 Bacteria 1329
135 Ga0099796_10065161 3300010159 Bacteria 1302
136 Ga0099796_10112473 3300010159 Bacteria 1038
137 Ga0105239_10023212 3300010375 Bacteria 6836
138 Ga0105239_10048988 3300010375 Bacteria 4632
139 Ga0105239_13625396 3300010375 Bacteria 502
140 Ga0105246_10010382 3300011119 Bacteria 5761
141 Ga0171463_1002 3300013249 Bacteria 1274851
142 Ga0157374_10001949 3300013296 Bacteria 17306
143 Ga0157374_10078721 3300013296 Bacteria 3123
144 Ga0157378_11167095 3300013297 Bacteria 809
145 Ga0163162_10020406 3300013306 Bacteria 6511
146 Ga0157375_10001986 3300013308 Bacteria 17663
147 Ga0157375_10370183 3300013308 Bacteria 1599
148 Ga0163163_10018168 3300014325 Bacteria 6576
149 Ga0157380_10488607 3300014326 Bacteria 1193
150 Ga0157377_10221074 3300014745 Bacteria 1212
151 Ga0157377_10908234 3300014745 Bacteria 659
152 Ga0157379_10063638 3300014968 Bacteria 3297
153 Ga0157379_10246389 3300014968 Bacteria 1621
154 Ga0157376_10022477 3300014969 Bacteria 4918
155 Ga0163161_10560651 3300017792 Bacteria 937
156 Ga0214544_1000279 3300021320 Bacteria 85706
157 Ga0214542_1000014 3300021321 Bacteria 233825
158 Ga0214543_1000056 3300021327 Bacteria 134292
159 Ga0224572_1007958 3300024225 Bacteria 1953
160 Ga0228598_1000728 3300024227 Bacteria 7050
161 Ga0228598_1034582 3300024227 Bacteria 996
162 Ga0207426_1000949 3300025302 Bacteria 28635
163 Ga0207697_10050058 3300025315 Bacteria 1725
164 Ga0207656_10702266 3300025321 Bacteria 518
165 Ga0207642_10174283 3300025899 Bacteria 1166
166 Ga0207642_10985535 3300025899 Bacteria 542
167 Ga0207685_10225916 3300025905 Bacteria 893
168 Ga0207699_10047135 3300025906 Bacteria 2525
169 Ga0207699_10373799 3300025906 Bacteria 1010
170 Ga0207643_10584186 3300025908 Bacteria 718
171 Ga0207684_11153519 3300025910 Bacteria 643
172 Ga0207707_10001413 3300025912 Bacteria 22240
173 Ga0207693_10043304 3300025915 Bacteria 3542
174 Ga0207693_11227563 3300025915 Bacteria 564
175 Ga0207649_10150261 3300025920 Bacteria 1603
176 Ga0207646_10127797 3300025922 Bacteria 2286
177 Ga0207694_10071350 3300025924 Bacteria 2714
178 Ga0207694_10164504 3300025924 Bacteria 1793
179 Ga0207687_10178225 3300025927 Bacteria 1644
180 Ga0207687_10348473 3300025927 Bacteria 1206
181 Ga0207700_10204501 3300025928 Bacteria 1666
182 Ga0207700_11872748 3300025928 Bacteria 526
183 Ga0207664_10071181 3300025929 Bacteria 2801
184 Ga0207706_10251127 3300025933 Bacteria 1545
185 Ga0207686_10380764 3300025934 Bacteria 1070
186 Ga0207686_10606060 3300025934 Bacteria 862
187 Ga0207709_10080295 3300025935 Bacteria 2100
188 Ga0207704_10045261 3300025938 Bacteria 2614
189 Ga0207665_10259902 3300025939 Bacteria 1286
190 Ga0207691_10417600 3300025940 Bacteria 1143
191 Ga0207711_10022578 3300025941 Bacteria 5264
192 Ga0207689_10275369 3300025942 Bacteria 1393
193 Ga0207661_10699410 3300025944 Bacteria 932
194 Ga0207679_10060451 3300025945 Bacteria 2815
195 Ga0207651_10303153 3300025960 Bacteria 1329
196 Ga0207712_10640611 3300025961 Bacteria 923
197 Ga0207668_10042262 3300025972 Bacteria 3086
198 Ga0207677_10184741 3300026023 Bacteria 1643
199 Ga0207703_10568388 3300026035 Bacteria 1070
200 Ga0207639_10364678 3300026041 Bacteria 1294
201 Ga0207639_10725541 3300026041 Bacteria 923
202 Ga0207678_10138388 3300026067 Bacteria 2077
203 Ga0207702_12241634 3300026078 Bacteria 535
204 Ga0207702_12520594 3300026078 Unclassified 501
205 Ga0207648_10080482 3300026089 Bacteria 2842
206 Ga0207676_10107891 3300026095 Bacteria 2323
207 Ga0207675_100287214 3300026118 Bacteria 1599
208 Ga0207683_11606408 3300026121 Bacteria 599
209 Ga0207698_10102365 3300026142 Bacteria 2377
210 Ga0207698_10670307 3300026142 Bacteria 1029
211 Ga0209179_1039198 3300027512 Bacteria 993
212 Ga0209588_1004866 3300027671 Bacteria 3819
213 Ga0209588_1025212 3300027671 Bacteria 1880
214 Ga0209588_1141974 3300027671 Bacteria 763
215 Ga0209588_1185475 3300027671 Bacteria 652
216 Ga0207428_10017066 3300027907 Bacteria 6237
217 Ga0207428_10128407 3300027907 Bacteria 1941
218 Ga0207428_10304293 3300027907 Bacteria 1179
219 Ga0207428_10321807 3300027907 Bacteria 1142
220 Ga0268266_10004651 3300028379 Bacteria 13082
221 Ga0265760_10007989 3300031090 Bacteria 3023
222 Ga0307408_100554735 3300031548 Bacteria 1014
223 Ga0307411_10376805 3300032005 Bacteria 1166
224 Ga0373934_0075087 3300035086 Bacteria 1355
225 Ga0373949_0254442 3300035090 Bacteria 544
226 Ga0373936_0195319 3300035113 Bacteria 892
227 Ga0373939_0089751 3300035114 Bacteria 1037
228 Ga0373939_0509529 3300035114 Unclassified 515
229 Ga0373954_0191600 3300035118 Bacteria 1004
230 Ga0373954_0288659 3300035118 Bacteria 809
231 Ga0373956_0345303 3300035119 Bacteria 709
232 Ga0373960_0233972 3300035121 Bacteria 662
233 Ga0373946_0290955 3300035171 Bacteria 806
234 Ga0373946_0309305 3300035171 Bacteria 783
235 Ga0373946_0684469 3300035171 Unclassified 535
236 Ga0373955_0021844 3300035172 Bacteria 3238
237 Ga0316574_0664408 3300035398 Bacteria 641
238 Ga0373931_0004766 3300035691 Bacteria 6220
239 Ga0373931_0184406 3300035691 Bacteria 1238
240 Ga0373931_0611330 3300035691 Bacteria 713
241 Ga0373935_0836629 3300035692 Bacteria 680
242 Ga0373927_0018585 3300035695 Bacteria 4565
243 Ga0373927_0106772 3300035695 Bacteria 1823
244 Ga0373927_0232127 3300035695 Bacteria 1212
245 Ga0373927_0296566 3300035695 Bacteria 1064
246 Ga0373927_0556363 3300035695 Unclassified 758
247 Ga0373933_0188104 3300035724 Bacteria 1318
248 Ga0373933_0496522 3300035724 Bacteria 799
249 Ga0373947_0289750 3300035725 Bacteria 1090
250 Ga0373947_0435775 3300035725 Bacteria 887
251 Ga0373947_0728944 3300035725 Bacteria 676
252 Ga0373947_1199803 3300035725 Bacteria 517
253 Ga0373937_0062799 3300036401 Bacteria 3415
254 Ga0373937_0257077 3300036401 Bacteria 1647
255 Ga0373937_1489864 3300036401 Bacteria 624
256 Ga0373925_1121349 3300037068 Bacteria 647
257 Ga0373925_1128462 3300037068 Bacteria 645
258 Ga0373925_1210343 3300037068 Bacteria 621
259 Ga0436365_1421435 3300039437 Bacteria 814
260 Ga0436363_0398031 3300039450 Bacteria 815
261 Ga0436363_1649080 3300039450 Bacteria 651
262 Ga0439453_0022806 3300041408 Bacteria 1138
263 Ga0451789_0378184 3300041443 Bacteria 853
264 Ga0439441_094998 3300042001 Bacteria 663
265 Ga0439440_0223936 3300042993 Bacteria 565
266 Ga0495592_0041281 3300046454 Bacteria 3457
267 Ga0495592_0853223 3300046454 Bacteria 538
268 Ga0495603_0133339 3300046455 Bacteria 1446
269 Ga0495603_0404078 3300046455 Bacteria 783
270 Ga0495629_0116441 3300046459 Unclassified 1862
271 Ga0495629_0419527 3300046459 Bacteria 908
272 Ga0495638_0132400 3300046460 Bacteria 1463
273 Ga0495651_0139912 3300046462 Bacteria 1756
274 Ga0495653_0439509 3300046463 Bacteria 822
275 Ga0495580_0835876 3300046472 Bacteria 595
276 Ga0495580_1093427 3300046472 Bacteria 505
277 Ga0495664_0155399 3300046477 Bacteria 1388
278 Ga0495664_0376648 3300046477 Bacteria 853
279 Ga0495585_0449661 3300046492 Bacteria 616
280 Ga0495608_0081031 3300046511 Bacteria 2109
281 Ga0495628_0057819 3300046516 Bacteria 3050
282 Ga0495631_0343491 3300046518 Bacteria 635
283 Ga0495642_0463750 3300046528 Bacteria 560
284 Ga0495652_0129035 3300046529 Bacteria 2004
285 Ga0495665_0137499 3300046531 Bacteria 1278
286 Ga0495640_0559913 3300046533 Bacteria 693
287 Ga0495586_0195554 3300046535 Bacteria 1146
288 Ga0495587_0041251 3300046536 Bacteria 2754
289 Ga0495598_0168461 3300046537 Bacteria 775
290 Ga0495645_0726450 3300046543 Bacteria 601
291 Ga0495667_0375118 3300046559 Bacteria 897
292 Ga0495656_0584018 3300046615 Bacteria 597
293 Ga0495634_0122729 3300046642 Bacteria 1663
294 Ga0495657_0215690 3300046675 Bacteria 1165
295 Ga0495599_0040505 3300046678 Bacteria 2925
296 Ga0495623_0014838 3300046679 Bacteria 5038
297 Ga0495647_0394805 3300046681 Bacteria 635
298 Ga0495658_0362912 3300046683 Unclassified 921
299 Ga0495669_0527618 3300046684 Bacteria 574
300 Ga0495613_0323215 3300046689 Unclassified 1064
301 Ga0495613_0503938 3300046689 Bacteria 815
302 Ga0495624_0867822 3300046690 Bacteria 532
303 Ga0495589_0441204 3300046794 Bacteria 596
304 Ga0495600_0132873 3300046809 Bacteria 1617
305 Ga0495581_0527277 3300047315 Bacteria 686
306 Ga0495581_0762366 3300047315 Bacteria 556
307 Ga0495604_0039513 3300047317 Bacteria 3708
308 Ga0495674_0580504 3300047319 Bacteria 890
309 Ga0495680_0336013 3300047322 Bacteria 1054
310 Ga0495680_0633819 3300047322 Bacteria 712
311 Ga0495675_0099779 3300047444 Bacteria 1818
312 Ga0495684_0598693 3300047471 Bacteria 744
313 Ga0495602_0105617 3300048088 Bacteria 2301
314 Ga0495602_0401399 3300048088 Bacteria 977
315 Ga0495614_0128422 3300048089 Bacteria 1121
316 Ga0496100_0095224 3300048903 Bacteria 2040
317 Ga0496100_0105906 3300048903 Bacteria 1946
318 Ga0496100_0499332 3300048903 Bacteria 937
319 Ga0496101_0017427 3300048904 Bacteria 4872
320 Ga0496101_0022831 3300048904 Bacteria 4313
321 Ga0496101_0403158 3300048904 Bacteria 1077
322 Ga0496102_0021319 3300048905 Bacteria 5730
323 Ga0496103_0110237 3300048906 Bacteria 1748
324 Ga0496103_0820867 3300048906 Bacteria 586
325 Ga0496104_0008265 3300048907 Bacteria 9241
326 Ga0496104_0017461 3300048907 Bacteria 6534
327 Ga0496104_0062956 3300048907 Bacteria 3518
328 Ga0496104_0127777 3300048907 Bacteria 2440
329 Ga0496104_1392157 3300048907 Bacteria 604
330 Ga0496105_0006540 3300048908 Bacteria 8966
331 Ga0496105_0019981 3300048908 Bacteria 5406
332 Ga0496105_0279623 3300048908 Bacteria 1346
333 Ga0496105_0610706 3300048908 Bacteria 845
334 Ga0496106_0054581 3300048909 Bacteria 3019
335 Ga0496106_0133688 3300048909 Bacteria 1947
336 Ga0496107_0022727 3300048910 Bacteria 4433
337 Ga0496107_0379530 3300048910 Bacteria 1051
338 Ga0496107_0724989 3300048910 Bacteria 730
339 Ga0496108_0002119 3300048911 Bacteria 15901
340 Ga0496108_0228349 3300048911 Bacteria 1618
341 Ga0496108_0324130 3300048911 Bacteria 1343
342 Ga0496108_0759451 3300048911 Bacteria 838
343 Ga0496109_0010038 3300048912 Bacteria 8082
344 Ga0496109_0186320 3300048912 Bacteria 1950
345 Ga0496109_0455174 3300048912 Bacteria 1209
346 Ga0496110_0144596 3300048913 Bacteria 2150
347 Ga0496110_0390342 3300048913 Bacteria 1269
348 Ga0496110_1019734 3300048913 Bacteria 735
349 Ga0496110_1134180 3300048913 Bacteria 690
350 Ga0496111_0041853 3300048914 Bacteria 3289
351 Ga0496111_0058787 3300048914 Bacteria 2784
352 Ga0496111_0702325 3300048914 Bacteria 736
353 Ga0496112_0012715 3300048915 Bacteria 7740
354 Ga0496112_0206639 3300048915 Bacteria 1921
355 Ga0496112_0245112 3300048915 Bacteria 1744
356 Ga0496112_0318722 3300048915 Bacteria 1499
357 Ga0496112_1111750 3300048915 Unclassified 708
358 Ga0496113_0002503 3300048916 Bacteria 10701
359 Ga0496113_0044741 3300048916 Bacteria 3281
360 Ga0496113_0164843 3300048916 Unclassified 1753
361 Ga0496114_0009294 3300048917 Bacteria 7801
362 Ga0496114_0043927 3300048917 Bacteria 3706
363 Ga0496114_0272942 3300048917 Bacteria 1490
364 Ga0496115_0004986 3300048918 Bacteria 9639
365 Ga0496115_0011773 3300048918 Bacteria 6569
366 Ga0496115_0031594 3300048918 Bacteria 4172
367 Ga0496115_0711014 3300048918 Bacteria 789
368 Ga0501079_1115324 3300049741 Bacteria 622
369 nmdc:mga05p37_281_c1 3300050507 Bacteria 50198
370 nmdc:mga05p37_321112_c1 3300050507 Bacteria 1833
371 nmdc:mga05p37_46610_c1 3300050507 Bacteria 5330
372 nmdc:mga05p37_645227_c1 3300050507 Bacteria 1187
373 nmdc:mga05p37_6614_c1 3300050507 Bacteria 13664
374 nmdc:mga05p37_69352_c1 3300050507 Bacteria 4337
375 nmdc:mga05p37_779299_c1 3300050507 Bacteria 1050
376 nmdc:mga05p37_9020_c1 3300050507 Bacteria 11796
377 nmdc:mga09592_103311_c1 3300050508 Bacteria 2442
378 nmdc:mga09592_15262_c1 3300050508 Bacteria 6276
379 nmdc:mga09592_41304_c1 3300050508 Bacteria 3878
380 nmdc:mga09592_418496_c1 3300050508 Bacteria 1158
381 nmdc:mga09592_609_c1 3300050508 Bacteria 27250
382 nmdc:mga0qj67_191103_c1 3300050509 Bacteria 1664
383 nmdc:mga0qj67_2675_c1 3300050509 Bacteria 12761
384 nmdc:mga0qj67_44927_c1 3300050509 Bacteria 3484
385 nmdc:mga0qj67_67185_c1 3300050509 Bacteria 2856
386 nmdc:mga0qj67_8021_c1 3300050509 Bacteria 7812
387 nmdc:mga06r32_14560_c1 3300050510 Bacteria 7140
388 nmdc:mga06r32_2024_c1 3300050510 Bacteria 18126
389 nmdc:mga08y16_103202_c1 3300050511 Bacteria 2969
390 nmdc:mga08y16_188204_c1 3300050511 Bacteria 2142
391 nmdc:mga08y16_411710_c1 3300050511 Bacteria 1383
392 nmdc:mga08y16_6620_c1 3300050511 Bacteria 12149
393 nmdc:mga08y16_800148_c1 3300050511 Bacteria 936
394 nmdc:mga08y16_912_c1 3300050511 Bacteria 28635
395 nmdc:mga0n895_1149070_c1 3300050512 Bacteria 752
396 nmdc:mga0n895_1643829_c1 3300050512 Unclassified 606
397 nmdc:mga0n895_221238_c1 3300050512 Bacteria 1922
398 nmdc:mga0n895_31903_c1 3300050512 Bacteria 5051
399 nmdc:mga0n895_4052_c1 3300050512 Bacteria 11922
400 nmdc:mga0n895_56743_c1 3300050512 Bacteria 3859
401 nmdc:mga0n895_730223_c1 3300050512 Bacteria 985
402 nmdc:mga0n895_80280_c1 3300050512 Bacteria 3250
403 nmdc:mga0rr50_135232_c1 3300050513 Bacteria 1978
404 nmdc:mga0rr50_247202_c1 3300050513 Bacteria 1480
405 nmdc:mga0rr50_433478_c1 3300050513 Bacteria 1113
406 nmdc:mga0rr50_590338_c1 3300050513 Bacteria 947
407 nmdc:mga0rr50_7138_c1 3300050513 Bacteria 6862
408 nmdc:mga0rr50_810717_c1 3300050513 Bacteria 799
409 nmdc:mga0a205_41624_c1 3300050515 Bacteria 4425
410 nmdc:mga0a205_51392_c1 3300050515 Bacteria 3979
411 nmdc:mga0a205_571_c1 3300050515 Bacteria 29236
412 nmdc:mga0a205_77645_c1 3300050515 Bacteria 3208
413 nmdc:mga0a205_865328_c1 3300050515 Bacteria 751
414 Ga0495601_0122833 3300053077 Bacteria 1687
415 Ga0495601_0250522 3300053077 Bacteria 1156
416 Ga0495601_0857296 3300053077 Bacteria 575
417 Ga0495612_0328274 3300053078 Bacteria 689
418 Ga0495595_0038998 3300053084 Bacteria 2166
419 Ga0495595_0105248 3300053084 Bacteria 1364
420 Ga0495619_0028979 3300053085 Bacteria 3574
421 Ga0495619_0328180 3300053085 Bacteria 1059
422 Ga0500569_007493 3300053109 Bacteria 2453
423 Ga0500627_0060927 3300053158 Bacteria 1660
424 2513999137 2513237159 Bacteria 6810126
425 2516208465 2516143018 Bacteria 6951533
426 2585397042 2582581866 Bacteria 6859583
427 2842501409 2842495871 Bacteria 6820686
428 2842524881 2842521101 Bacteria 6569494
429 2913296872 2913295892 Bacteria 6333755
430 2920764932 2920760137 Bacteria 7427611
431 2937073199 2937071275 Bacteria 6984483
432 2937127211 2937126314 Bacteria 6771275
433 2960687698 2960687367 Bacteria 6535474
434 2961172161 2961170736 Bacteria 7072258
435 2964706949 2964705432 Bacteria 7114648
436 2970504759 2970503327 Bacteria 7099517
437 2977572084 2977565890 Bacteria 6901543
438 2979809396 2979808191 Bacteria 7179355
439 nmdc:mga05p37_437198_c1
440 Ga0065165_1102513
441 Ga0065707_10036731
442 Ga0065707_10123973
443 Ga0070683_101105958
444 Ga0070690_101510206
445 Ga0070682_100425163
446 Ga0070682_101164568
447 Ga0068868_100226751
448 Ga0070661_100303790
449 Ga0070668_101111473
450 Ga0070675_101386255
451 Ga0070673_100139165
452 Ga0070709_10426124
453 Ga0070714_100065983
454 Ga0070713_100229587
455 Ga0070713_100624654
456 Ga0070708_100446731
457 Ga0070663_100035689
458 Ga0070662_100261014
459 Ga0070681_10008846
460 Ga0068867_100383810
461 Ga0070706_100472433
462 Ga0070707_100341128
463 Ga0070698_100256855
464 Ga0070698_100913009
465 Ga0070679_100005046
466 Ga0070684_100425249
467 Ga0070684_101065706
468 Ga0070697_100312742
469 Ga0070697_100511449
470 Ga0070697_100902414
471 Ga0068853_100069401
472 Ga0068853_101527361
473 Ga0070672_101459173
474 Ga0070686_100953809
475 Ga0070686_101283090
476 Ga0070665_100013434
477 Ga0070664_100055102
478 Ga0068854_101362949
479 Ga0068856_100485383
480 Ga0068856_102398430
481 Ga0068852_100722595
482 Ga0068852_100941625
483 Ga0068859_101105063
484 Ga0068864_100556844
485 Ga0068861_100320863
486 Ga0068851_10153094
487 Ga0068851_10549495
488 Ga0068870_10673363
489 Ga0068863_101054193
490 Ga0081455_10007941
491 Ga0081455_10008660
492 Ga0081455_10022133
493 Ga0081455_10051509
494 Ga0081455_10109486
495 Ga0070717_10345142
496 Ga0070717_12111514
497 Ga0075365_10072373
498 Ga0070715_10212428
499 Ga0070715_10271148
500 Ga0070716_100152107
501 Ga0070716_100240275
502 Ga0070716_100316917
503 Ga0070712_100655631
504 Ga0070712_101073534
505 Ga0070712_101487096
506 Ga0075427_10001611
507 Ga0075427_10011207
508 Ga0075427_10014246
509 Ga0097621_100032051
510 Ga0097621_100082009
511 Ga0068871_100623162
512 Ga0075428_100007899
513 Ga0075428_100375934
514 Ga0075430_100001022
515 Ga0075431_100020083
516 Ga0075431_100035664
517 Ga0075433_10003427
518 Ga0075433_10060979
519 Ga0075433_10256926
520 Ga0075434_100001215
521 Ga0075434_100044793
522 Ga0075434_101764941
523 Ga0075429_100000941
524 Ga0075429_100052284
525 Ga0075429_100562136
526 Ga0097620_101105315
527 Ga0075435_100048376
528 Ga0075435_100519890
529 Ga0075435_100709148
530 Ga0075435_101094723
531 Ga0075435_101225951
532 Ga0099794_10024720
533 Ga0099794_10034263
534 Ga0099794_10282609
535 Ga0099795_10031703
536 Ga0099795_10055497
537 Ga0099795_10068352
538 Ga0099795_10102420
539 Ga0099795_10134940
540 Ga0111539_10001115
541 Ga0111539_10028039
542 Ga0111539_10225586
543 Ga0111539_10256107
544 Ga0111539_10446342
545 Ga0105245_10003945
546 Ga0105245_10308731
547 Ga0105247_10045597
548 Ga0105247_10110293
549 Ga0114129_10005318
550 Ga0114129_10033922
551 Ga0114129_10044447
552 Ga0114129_10111644
553 Ga0114129_10369155
554 Ga0114129_10951903
555 Ga0114129_11007153
556 Ga0114129_11067810
557 Ga0105243_10302206
558 Ga0105243_10571166
559 Ga0105241_10110017
560 Ga0105241_11337413
561 Ga0105242_10083701
562 Ga0105242_10165275
563 Ga0105248_10107099
564 Ga0105248_10419140
565 Ga0105237_10350646
566 Ga0105238_10130557
567 Ga0105238_10184795
568 Ga0105238_10282885
569 Ga0099796_10021439
570 Ga0099796_10038225
571 Ga0099796_10041628
572 Ga0099796_10061937
573 Ga0099796_10065161
574 Ga0099796_10112473
575 Ga0105239_10023212
576 Ga0105239_10048988
577 Ga0105239_13625396
578 Ga0105246_10010382
579 Ga0171463_1002
580 Ga0157374_10001949
581 Ga0157374_10078721
582 Ga0157378_11167095
583 Ga0163162_10020406
584 Ga0157375_10001986
585 Ga0157375_10370183
586 Ga0163163_10018168
587 Ga0157380_10488607
588 Ga0157377_10221074
589 Ga0157377_10908234
590 Ga0157379_10063638
591 Ga0157379_10246389
592 Ga0157376_10022477
593 Ga0163161_10560651
594 Ga0214544_1000279
595 Ga0214542_1000014
596 Ga0214543_1000056
597 Ga0224572_1007958
598 Ga0228598_1000728
599 Ga0228598_1034582
600 Ga0207426_1000949
601 Ga0207697_10050058
602 Ga0207656_10702266
603 Ga0207642_10174283
604 Ga0207642_10985535
605 Ga0207685_10225916
606 Ga0207699_10047135
607 Ga0207699_10373799
608 Ga0207643_10584186
609 Ga0207684_11153519
610 Ga0207707_10001413
611 Ga0207693_10043304
612 Ga0207693_11227563
613 Ga0207649_10150261
614 Ga0207646_10127797
615 Ga0207694_10071350
616 Ga0207694_10164504
617 Ga0207687_10178225
618 Ga0207687_10348473
619 Ga0207700_10204501
620 Ga0207700_11872748
621 Ga0207664_10071181
622 Ga0207706_10251127
623 Ga0207686_10380764
624 Ga0207686_10606060
625 Ga0207709_10080295
626 Ga0207704_10045261
627 Ga0207665_10259902
628 Ga0207691_10417600
629 Ga0207711_10022578
630 Ga0207689_10275369
631 Ga0207661_10699410
632 Ga0207679_10060451
633 Ga0207651_10303153
634 Ga0207712_10640611
635 Ga0207668_10042262
636 Ga0207677_10184741
637 Ga0207703_10568388
638 Ga0207639_10364678
639 Ga0207639_10725541
640 Ga0207678_10138388
641 Ga0207702_12241634
642 Ga0207702_12520594
643 Ga0207648_10080482
644 Ga0207676_10107891
645 Ga0207675_100287214
646 Ga0207683_11606408
647 Ga0207698_10102365
648 Ga0207698_10670307
649 Ga0209179_1039198
650 Ga0209588_1004866
651 Ga0209588_1025212
652 Ga0209588_1141974
653 Ga0209588_1185475
654 Ga0207428_10017066
655 Ga0207428_10128407
656 Ga0207428_10304293
657 Ga0207428_10321807
658 Ga0268266_10004651
659 Ga0265760_10007989
660 Ga0307408_100554735
661 Ga0307411_10376805
662 Ga0373934_0075087
663 Ga0373949_0254442
664 Ga0373936_0195319
665 Ga0373939_0089751
666 Ga0373939_0509529
667 Ga0373954_0191600
668 Ga0373954_0288659
669 Ga0373956_0345303
670 Ga0373960_0233972
671 Ga0373946_0290955
672 Ga0373946_0309305
673 Ga0373946_0684469
674 Ga0373955_0021844
675 Ga0316574_0664408
676 Ga0373931_0004766
677 Ga0373931_0184406
678 Ga0373931_0611330
679 Ga0373935_0836629
680 Ga0373927_0018585
681 Ga0373927_0106772
682 Ga0373927_0232127
683 Ga0373927_0296566
684 Ga0373927_0556363
685 Ga0373933_0188104
686 Ga0373933_0496522
687 Ga0373947_0289750
688 Ga0373947_0435775
689 Ga0373947_0728944
690 Ga0373947_1199803
691 Ga0373937_0062799
692 Ga0373937_0257077
693 Ga0373937_1489864
694 Ga0373925_1121349
695 Ga0373925_1128462
696 Ga0373925_1210343
697 Ga0436365_1421435
698 Ga0436363_0398031
699 Ga0436363_1649080
700 Ga0439453_0022806
701 Ga0451789_0378184
702 Ga0439441_094998
703 Ga0439440_0223936
704 Ga0495592_0041281
705 Ga0495592_0853223
706 Ga0495603_0133339
707 Ga0495603_0404078
708 Ga0495629_0116441
709 Ga0495629_0419527
710 Ga0495638_0132400
711 Ga0495651_0139912
712 Ga0495653_0439509
713 Ga0495580_0835876
714 Ga0495580_1093427
715 Ga0495664_0155399
716 Ga0495664_0376648
717 Ga0495585_0449661
718 Ga0495608_0081031
719 Ga0495628_0057819
720 Ga0495631_0343491
721 Ga0495642_0463750
722 Ga0495652_0129035
723 Ga0495665_0137499
724 Ga0495640_0559913
725 Ga0495586_0195554
726 Ga0495587_0041251
727 Ga0495598_0168461
728 Ga0495645_0726450
729 Ga0495667_0375118
730 Ga0495656_0584018
731 Ga0495634_0122729
732 Ga0495657_0215690
733 Ga0495599_0040505
734 Ga0495623_0014838
735 Ga0495647_0394805
736 Ga0495658_0362912
737 Ga0495669_0527618
738 Ga0495613_0323215
739 Ga0495613_0503938
740 Ga0495624_0867822
741 Ga0495589_0441204
742 Ga0495600_0132873
743 Ga0495581_0527277
744 Ga0495581_0762366
745 Ga0495604_0039513
746 Ga0495674_0580504
747 Ga0495680_0336013
748 Ga0495680_0633819
749 Ga0495675_0099779
750 Ga0495684_0598693
751 Ga0495602_0105617
752 Ga0495602_0401399
753 Ga0495614_0128422
754 Ga0496100_0095224
755 Ga0496100_0105906
756 Ga0496100_0499332
757 Ga0496101_0017427
758 Ga0496101_0022831
759 Ga0496101_0403158
760 Ga0496102_0021319
761 Ga0496103_0110237
762 Ga0496103_0820867
763 Ga0496104_0008265
764 Ga0496104_0017461
765 Ga0496104_0062956
766 Ga0496104_0127777
767 Ga0496104_1392157
768 Ga0496105_0006540
769 Ga0496105_0019981
770 Ga0496105_0279623
771 Ga0496105_0610706
772 Ga0496106_0054581
773 Ga0496106_0133688
774 Ga0496107_0022727
775 Ga0496107_0379530
776 Ga0496107_0724989
777 Ga0496108_0002119
778 Ga0496108_0228349
779 Ga0496108_0324130
780 Ga0496108_0759451
781 Ga0496109_0010038
782 Ga0496109_0186320
783 Ga0496109_0455174
784 Ga0496110_0144596
785 Ga0496110_0390342
786 Ga0496110_1019734
787 Ga0496110_1134180
788 Ga0496111_0041853
789 Ga0496111_0058787
790 Ga0496111_0702325
791 Ga0496112_0012715
792 Ga0496112_0206639
793 Ga0496112_0245112
794 Ga0496112_0318722
795 Ga0496112_1111750
796 Ga0496113_0002503
797 Ga0496113_0044741
798 Ga0496113_0164843
799 Ga0496114_0009294
800 Ga0496114_0043927
801 Ga0496114_0272942
802 Ga0496115_0004986
803 Ga0496115_0011773
804 Ga0496115_0031594
805 Ga0496115_0711014
806 Ga0501079_1115324
807 nmdc:mga05p37_281_c1
808 nmdc:mga05p37_321112_c1
809 nmdc:mga05p37_46610_c1
810 nmdc:mga05p37_645227_c1
811 nmdc:mga05p37_6614_c1
812 nmdc:mga05p37_69352_c1
813 nmdc:mga05p37_779299_c1
814 nmdc:mga05p37_9020_c1
815 nmdc:mga09592_103311_c1
816 nmdc:mga09592_15262_c1
817 nmdc:mga09592_41304_c1
818 nmdc:mga09592_418496_c1
819 nmdc:mga09592_609_c1
820 nmdc:mga0qj67_191103_c1
821 nmdc:mga0qj67_2675_c1
822 nmdc:mga0qj67_44927_c1
823 nmdc:mga0qj67_67185_c1
824 nmdc:mga0qj67_8021_c1
825 nmdc:mga06r32_14560_c1
826 nmdc:mga06r32_2024_c1
827 nmdc:mga08y16_103202_c1
828 nmdc:mga08y16_188204_c1
829 nmdc:mga08y16_411710_c1
830 nmdc:mga08y16_6620_c1
831 nmdc:mga08y16_800148_c1
832 nmdc:mga08y16_912_c1
833 nmdc:mga0n895_1149070_c1
834 nmdc:mga0n895_1643829_c1
835 nmdc:mga0n895_221238_c1
836 nmdc:mga0n895_31903_c1
837 nmdc:mga0n895_4052_c1
838 nmdc:mga0n895_56743_c1
839 nmdc:mga0n895_730223_c1
840 nmdc:mga0n895_80280_c1
841 nmdc:mga0rr50_135232_c1
842 nmdc:mga0rr50_247202_c1
843 nmdc:mga0rr50_433478_c1
844 nmdc:mga0rr50_590338_c1
845 nmdc:mga0rr50_7138_c1
846 nmdc:mga0rr50_810717_c1
847 nmdc:mga0a205_41624_c1
848 nmdc:mga0a205_51392_c1
849 nmdc:mga0a205_571_c1
850 nmdc:mga0a205_77645_c1
851 nmdc:mga0a205_865328_c1
852 Ga0495601_0122833
853 Ga0495601_0250522
854 Ga0495601_0857296
855 Ga0495612_0328274
856 Ga0495595_0038998
857 Ga0495595_0105248
858 Ga0495619_0028979
859 Ga0495619_0328180
860 Ga0500569_007493
861 Ga0500627_0060927
862 2513999137
863 2516208465
864 2585397042
865 2842501409
866 2842524881
867 2913296872
868 2920764932
869 2937073199
870 2937127211
871 2960687698
872 2961172161
873 2964706949
874 2970504759
875 2977572084
876 2979809396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

24

141

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9326 1 127
4kny-assembly1.cif.gz_A crystal structure of the response regulator kdpe complexed to dna in an active-like conformation 0.9276 1 125
4kfc-assembly1.cif.gz_A crystal structure of a hyperactive mutant of response regulator kdpe complexed to its promoter dna 0.9275 1 127
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9244 1 127
4l85-assembly1.cif.gz_A crystal structure of receiver domain of kdpe d52a mutant from e. coli 0.9199 1 125
ID Description Score Start End Superfamily
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9317 1 124 3.40.50.2300
2qzjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9219 2 129 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9165 1 126 3.40.50.2300
2qzjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9146 2 129 3.40.50.2300
1xhfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9134 1 127 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2A4T3L2-F1-model_v4 Response regulator 0.9648 1 129 GO:0000160
AF-A0A2A4T3L2-F1-model_v4 Response regulator 0.9576 1 129 GO:0000160
AF-T0RFB3-F1-model_v4 Response regulator receiver domain protein 0.9485 1 124 GO:0000160
AF-A0A7V3XEZ7-F1-model_v4 Adenylate/guanylate cyclase domain-containing response regulator 0.9436 1 128 GO:0000160
GO:0004016
GO:0009190
AF-A0A7W2GJR4-F1-model_v4 Response regulator 0.9412 1 124 GO:0000160

Map