F443888

General Info

Members Datasets Scaffolds Average Seq Length
437 258 390 341

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0021706|Ga0500583_0021706_730_1890
Length 386
Sequence VFIAIDVSAWELLQAYLEKTFGVPLQVVLRPLCLRKKVIFIHENGFMKKIGFLSFGHWSNHPAYKTRTPGDTLLQSIDLAVAAEEIGLDGAYFRVHHFAAQLASPFPLLSAIGAKTNNIEIGTGVIDMRYENPQYMVEDAGAADLISRGRLQLGISRGSPEQVIDGWRYFGYEPADGETDADMGRRKALEFLDKLKGVGFAEPNPYPMFPNPPGLLRLEPHSEGLRDRIWWGAASNATAVWAAENGMYLQSSTLKYDETGKPFHVQQAEQIRLYKEAWHKAGHQREPRVSVSRSIFALVTDQDKYFFGQEANRTDKIGFIESDKRAIFGRSYAAEPDQLIKELAKDEAIQEADTILLTIPNTLGVDYNVHVLSSILEHVAPGLGWR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
8 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
9 2738541283 Pedobacter sp. OK701 Isolate Unclassified
10 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
11 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
14 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
15 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
16 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
17 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
18 2818991444 Filimonas endophytica 3197 Isolate Unclassified
19 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
20 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
21 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
22 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
23 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
24 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
25 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
26 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
27 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
28 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
29 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
30 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
31 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
32 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
33 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
34 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
35 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
36 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
37 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
38 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
39 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
40 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
41 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
42 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
43 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
44 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
45 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
165 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
166 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
167 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
168 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
235 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
236 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
237 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
240 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
256 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
257 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
258 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.24
Metatranscriptomes 0
Isolates 10.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.95
Nodule 0.69
Rhizoplane 1.14
Rhizosphere 78.03
Stem 0
Stem Tuber 0
Unclassified 14.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3293304 2162886007 Bacteria 2621
2 JGI24740J21852_10003905 3300001979 Bacteria 6470
3 JGI24737J22298_10000621 3300001990 Bacteria 12491
4 JGI24737J22298_10024697 3300001990 Bacteria 1902
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 rootH2_10211829 3300003320 Bacteria 8905
7 rootL2_10003864 3300003322 Bacteria 4697
8 rootL2_10016637 3300003322 Bacteria 12462
9 rootH1_10008393 3300003323 Bacteria 7585
10 JGI25160J50197_1003407 3300003354 Bacteria 7119
11 Ga0055531_10000118 3300003794 Bacteria 88104
12 Ga0065165_1000539 3300005262 Bacteria 57421
13 Ga0065165_1000981 3300005262 Bacteria 35359
14 Ga0065165_1009726 3300005262 Bacteria 4260
15 Ga0065714_10002196 3300005288 Bacteria 65569
16 Ga0065714_10065245 3300005288 Bacteria 11494
17 Ga0065714_10070343 3300005288 Bacteria 3894
18 Ga0065704_10019930 3300005289 Bacteria 1402
19 Ga0065704_10072377 3300005289 Bacteria 8638
20 Ga0065704_10095470 3300005289 Bacteria 2476
21 Ga0065715_10116301 3300005293 Bacteria 2386
22 Ga0070658_10000079 3300005327 Bacteria 90829
23 Ga0070658_10107539 3300005327 Bacteria 2308
24 Ga0070658_10147873 3300005327 Bacteria 1966
25 Ga0070676_10043402 3300005328 Bacteria 2613
26 Ga0070670_100108906 3300005331 Bacteria 2387
27 Ga0068869_100198786 3300005334 Bacteria 1579
28 Ga0070666_10000174 3300005335 Bacteria 43931
29 Ga0070666_10023560 3300005335 Bacteria 4008
30 Ga0070680_100045376 3300005336 Bacteria 3573
31 Ga0068868_100111706 3300005338 Bacteria 2221
32 Ga0070660_100008004 3300005339 Bacteria 7384
33 Ga0070668_100012037 3300005347 Bacteria 6443
34 Ga0070669_100006817 3300005353 Bacteria 8219
35 Ga0070671_100062258 3300005355 Bacteria 3107
36 Ga0070674_100054653 3300005356 Bacteria 2762
37 Ga0070673_100082641 3300005364 Bacteria 2607
38 Ga0070673_100247279 3300005364 Bacteria 1553
39 Ga0070659_100000542 3300005366 Bacteria 27536
40 Ga0070659_100001687 3300005366 Bacteria 15889
41 Ga0070667_100009950 3300005367 Bacteria 7883
42 Ga0070667_100203447 3300005367 Bacteria 1757
43 Ga0070663_100003820 3300005455 Bacteria 8770
44 Ga0070662_100008365 3300005457 Bacteria 6744
45 Ga0070662_100015420 3300005457 Bacteria 5118
46 Ga0068867_100008348 3300005459 Bacteria 7308
47 Ga0068867_100249266 3300005459 Bacteria 1443
48 Ga0068867_100311875 3300005459 Bacteria 1300
49 Ga0070679_100037920 3300005530 Bacteria 4789
50 Ga0068853_100031449 3300005539 Bacteria 4489
51 Ga0068853_100063510 3300005539 Bacteria 3199
52 Ga0068853_100229628 3300005539 Bacteria 1697
53 Ga0070672_100037154 3300005543 Bacteria 3714
54 Ga0070665_100000267 3300005548 Bacteria 85526
55 Ga0070665_100017745 3300005548 Bacteria 7147
56 Ga0068855_100063226 3300005563 Bacteria 4319
57 Ga0068856_100000275 3300005614 Bacteria 55981
58 Ga0068852_100015049 3300005616 Bacteria 5982
59 Ga0068859_100001134 3300005617 Bacteria 27162
60 Ga0068859_100038772 3300005617 Bacteria 4779
61 Ga0068859_100059625 3300005617 Bacteria 3845
62 Ga0068859_100250858 3300005617 Bacteria 1860
63 Ga0068864_100396413 3300005618 Bacteria 1311
64 Ga0068870_10022388 3300005840 Bacteria 3105
65 Ga0068863_100025030 3300005841 Bacteria 5692
66 Ga0068858_100006604 3300005842 Bacteria 11285
67 Ga0068860_100000103 3300005843 Bacteria 139076
68 Ga0068860_100031077 3300005843 Bacteria 5135
69 Ga0068860_100036006 3300005843 Bacteria 4744
70 Ga0068860_100040281 3300005843 Bacteria 4466
71 Ga0068860_100358331 3300005843 Bacteria 1437
72 Ga0075366_10234367 3300006195 Bacteria 1119
73 Ga0097621_100053849 3300006237 Bacteria 3280
74 Ga0097621_100143860 3300006237 Bacteria 2039
75 Ga0068871_100221179 3300006358 Bacteria 1641
76 Ga0068865_100270723 3300006881 Bacteria 1348
77 Ga0097620_100001134 3300006931 Bacteria 27162
78 Ga0097620_100038772 3300006931 Bacteria 4779
79 Ga0097620_100059627 3300006931 Bacteria 3845
80 Ga0097620_100250840 3300006931 Bacteria 1860
81 Ga0079104_1000005 3300006946 Bacteria 407099
82 Ga0099826_10038177 3300006948 Bacteria 3376
83 Ga0105244_10000004 3300009036 Bacteria 492478
84 Ga0105240_10000143 3300009093 Bacteria 146858
85 Ga0105240_10000188 3300009093 Bacteria 126031
86 Ga0105240_10020933 3300009093 Bacteria 8709
87 Ga0105240_10243702 3300009093 Bacteria 2082
88 Ga0105240_10620088 3300009093 Bacteria 1189
89 Ga0105240_10694871 3300009093 Bacteria 1111
90 Ga0105245_10041124 3300009098 Bacteria 4120
91 Ga0105245_10304940 3300009098 Unclassified 1564
92 Ga0105243_10000006 3300009148 Bacteria 465541
93 Ga0105241_10002072 3300009174 Bacteria 15154
94 Ga0105241_10008414 3300009174 Bacteria 7589
95 Ga0105241_10023201 3300009174 Bacteria 4599
96 Ga0105242_10018941 3300009176 Bacteria 5391
97 Ga0105237_10008058 3300009545 Bacteria 11457
98 Ga0105237_10010612 3300009545 Bacteria 9784
99 Ga0105237_10015364 3300009545 Bacteria 7971
100 Ga0105237_10024768 3300009545 Bacteria 6139
101 Ga0105249_10007645 3300009553 Bacteria 9421
102 Ga0105249_10281381 3300009553 Bacteria 1661
103 Ga0105239_10000042 3300010375 Bacteria 199662
104 Ga0105239_10000106 3300010375 Bacteria 117256
105 Ga0105239_10004126 3300010375 Bacteria 17446
106 Ga0105239_10009283 3300010375 Bacteria 11120
107 Ga0105239_10023713 3300010375 Bacteria 6756
108 Ga0105239_10045702 3300010375 Bacteria 4799
109 Ga0105239_10242251 3300010375 Bacteria 2024
110 Ga0105239_10280168 3300010375 Bacteria 1877
111 Ga0105246_10006728 3300011119 Bacteria 7029
112 Ga0105246_10011212 3300011119 Bacteria 5557
113 Ga0105246_10035502 3300011119 Bacteria 3333
114 Ga0157373_10000420 3300013100 Bacteria 33988
115 Ga0157373_10007305 3300013100 Bacteria 8225
116 Ga0157373_10012311 3300013100 Bacteria 6290
117 Ga0157373_10026204 3300013100 Unclassified 4213
118 Ga0157373_10042647 3300013100 Bacteria 3242
119 Ga0157373_10044363 3300013100 Bacteria 3174
120 Ga0157371_10000009 3300013102 Bacteria 392895
121 Ga0157371_10000529 3300013102 Bacteria 45499
122 Ga0157371_10002456 3300013102 Bacteria 17666
123 Ga0157371_10003544 3300013102 Bacteria 14078
124 Ga0157371_10007232 3300013102 Bacteria 9017
125 Ga0157371_10007733 3300013102 Bacteria 8644
126 Ga0157371_10019129 3300013102 Bacteria 5056
127 Ga0157371_10026977 3300013102 Bacteria 4169
128 Ga0157370_10002699 3300013104 Bacteria 21270
129 Ga0157370_10005462 3300013104 Bacteria 14254
130 Ga0157370_10005489 3300013104 Bacteria 14219
131 Ga0157370_10007758 3300013104 Bacteria 11631
132 Ga0157370_10215217 3300013104 Bacteria 1780
133 Ga0157369_10002206 3300013105 Bacteria 23455
134 Ga0157369_10064549 3300013105 Bacteria 3943
135 Ga0157369_10130657 3300013105 Bacteria 2661
136 Ga0157374_10000758 3300013296 Bacteria 28222
137 Ga0157374_10000809 3300013296 Bacteria 27407
138 Ga0157374_10095879 3300013296 Bacteria 2837
139 Ga0157374_10099866 3300013296 Bacteria 2781
140 Ga0157378_10003533 3300013297 Bacteria 13853
141 Ga0157378_10105148 3300013297 Bacteria 2581
142 Ga0157378_10294313 3300013297 Bacteria 1569
143 Ga0163162_10000074 3300013306 Bacteria 91138
144 Ga0163162_10004928 3300013306 Bacteria 12869
145 Ga0163162_10012229 3300013306 Bacteria 8376
146 Ga0157372_10000016 3300013307 Bacteria 220177
147 Ga0157372_10000771 3300013307 Bacteria 34676
148 Ga0157372_10000878 3300013307 Bacteria 32670
149 Ga0157372_10015709 3300013307 Bacteria 8119
150 Ga0157372_10047954 3300013307 Bacteria 4747
151 Ga0157372_10094254 3300013307 Bacteria 3409
152 Ga0157372_10244303 3300013307 Bacteria 2083
153 Ga0157372_10320608 3300013307 Bacteria 1804
154 Ga0157372_10408894 3300013307 Bacteria 1581
155 Ga0157372_10560427 3300013307 Bacteria 1332
156 Ga0182008_10002302 3300014497 Bacteria 12036
157 Ga0157376_10018302 3300014969 Bacteria 5367
158 Ga0182006_1002740 3300015261 Bacteria 9440
159 Ga0182007_10000059 3300015262 Bacteria 88462
160 Ga0163161_10000026 3300017792 Bacteria 199745
161 Ga0163161_10000341 3300017792 Bacteria 39792
162 Ga0163161_10005185 3300017792 Bacteria 9062
163 Ga0163161_10101916 3300017792 Bacteria 2137
164 Ga0209026_1000559 3300025250 Bacteria 25465
165 Ga0209676_1000396 3300025292 Bacteria 79502
166 Ga0209050_1001087 3300025298 Bacteria 33136
167 Ga0207426_1000019 3300025302 Bacteria 558579
168 Ga0207426_1000209 3300025302 Bacteria 139524
169 Ga0207426_1007048 3300025302 Bacteria 4763
170 Ga0209257_1000007 3300025304 Bacteria 1564415
171 Ga0207656_10032655 3300025321 Bacteria 2163
172 Ga0207655_1000008 3300025728 Bacteria 734289
173 Ga0207642_10058418 3300025899 Bacteria 1779
174 Ga0207688_10021206 3300025901 Bacteria 3549
175 Ga0207680_10001491 3300025903 Bacteria 11058
176 Ga0207680_10285184 3300025903 Bacteria 1148
177 Ga0207647_10000473 3300025904 Bacteria 32482
178 Ga0207647_10000641 3300025904 Bacteria 27308
179 Ga0207647_10019409 3300025904 Bacteria 4573
180 Ga0207647_10023755 3300025904 Bacteria 4051
181 Ga0207645_10000685 3300025907 Bacteria 28100
182 Ga0207645_10071104 3300025907 Bacteria 2226
183 Ga0207705_10000112 3300025909 Bacteria 90821
184 Ga0207654_10006008 3300025911 Bacteria 6105
185 Ga0207695_10000016 3300025913 Bacteria 771991
186 Ga0207695_10000284 3300025913 Bacteria 126041
187 Ga0207671_10000967 3300025914 Bacteria 35600
188 Ga0207671_10001786 3300025914 Bacteria 24101
189 Ga0207671_10009391 3300025914 Bacteria 8177
190 Ga0207671_10012352 3300025914 Bacteria 6871
191 Ga0207660_10377419 3300025917 Bacteria 1139
192 Ga0207657_10015475 3300025919 Bacteria 7389
193 Ga0207657_10021682 3300025919 Bacteria 6038
194 Ga0207652_10002572 3300025921 Bacteria 15232
195 Ga0207652_10006324 3300025921 Bacteria 9566
196 Ga0207652_10216052 3300025921 Bacteria 1727
197 Ga0207650_10146678 3300025925 Bacteria 1859
198 Ga0207690_10000668 3300025932 Bacteria 21960
199 Ga0207690_10018404 3300025932 Bacteria 4284
200 Ga0207706_10000380 3300025933 Bacteria 48389
201 Ga0207706_10001186 3300025933 Bacteria 26325
202 Ga0207709_10000007 3300025935 Bacteria 752025
203 Ga0207704_10210580 3300025938 Bacteria 1430
204 Ga0207704_10233617 3300025938 Bacteria 1369
205 Ga0207691_10029493 3300025940 Bacteria 5132
206 Ga0207689_10001528 3300025942 Bacteria 22005
207 Ga0207689_10037062 3300025942 Bacteria 4047
208 Ga0207667_10001065 3300025949 Bacteria 34755
209 Ga0207667_10007843 3300025949 Bacteria 12750
210 Ga0207667_10084388 3300025949 Bacteria 3288
211 Ga0207667_10111230 3300025949 Bacteria 2825
212 Ga0207667_10450735 3300025949 Bacteria 1307
213 Ga0207651_10264433 3300025960 Bacteria 1414
214 Ga0207658_10016984 3300025986 Bacteria 5009
215 Ga0207658_10119885 3300025986 Bacteria 2095
216 Ga0207677_10017050 3300026023 Bacteria 4319
217 Ga0207677_10055752 3300026023 Bacteria 2704
218 Ga0207703_10005772 3300026035 Bacteria 9921
219 Ga0207639_10015679 3300026041 Bacteria 5347
220 Ga0207639_10116364 3300026041 Bacteria 2188
221 Ga0207639_10159066 3300026041 Bacteria 1901
222 Ga0207639_10244663 3300026041 Bacteria 1561
223 Ga0207639_10373371 3300026041 Bacteria 1279
224 Ga0207678_10004400 3300026067 Bacteria 12668
225 Ga0207702_10008555 3300026078 Bacteria 8625
226 Ga0207641_10001176 3300026088 Bacteria 26293
227 Ga0207648_10001944 3300026089 Bacteria 22600
228 Ga0207648_10008386 3300026089 Bacteria 10015
229 Ga0207676_10004759 3300026095 Bacteria 9627
230 Ga0207676_10261484 3300026095 Bacteria 1563
231 Ga0207676_10322340 3300026095 Bacteria 1419
232 Ga0207674_10029340 3300026116 Bacteria 5791
233 Ga0207675_100064132 3300026118 Bacteria 3433
234 Ga0207675_100085507 3300026118 Bacteria 2960
235 Ga0207683_10005647 3300026121 Bacteria 10725
236 Ga0207698_10006065 3300026142 Bacteria 7517
237 Ga0207698_10008804 3300026142 Bacteria 6400
238 Ga0209281_1000216 3300027111 Bacteria 125724
239 Ga0268266_10000018 3300028379 Bacteria 569141
240 Ga0268266_10047917 3300028379 Bacteria 3662
241 Ga0268265_10314818 3300028380 Bacteria 1415
242 Ga0268264_10000013 3300028381 Bacteria 513859
243 Ga0268264_10016796 3300028381 Bacteria 5990
244 Ga0268264_10029803 3300028381 Bacteria 4472
245 Ga0268264_10091047 3300028381 Bacteria 2630
246 Ga0307515_10000280 3300028794 Bacteria 125330
247 Ga0307515_10001742 3300028794 Bacteria 48455
248 Ga0307515_10009106 3300028794 Bacteria 19259
249 Ga0307515_10014354 3300028794 Bacteria 14700
250 Ga0316177_1078782 3300030731 Bacteria 11673
251 Ga0316176_1219093 3300030732 Bacteria 40700
252 Ga0316183_1074350 3300030742 Bacteria 48608
253 Ga0316181_1088231 3300030744 Bacteria 10299
254 Ga0316182_1411663 3300030745 Bacteria 1276
255 Ga0307513_10022679 3300031456 Bacteria 7367
256 Ga0307513_10191379 3300031456 Bacteria 1897
257 Ga0307513_10216702 3300031456 Bacteria 1740
258 Ga0307513_10319203 3300031456 Bacteria 1312
259 Ga0307509_10106342 3300031507 Bacteria 2825
260 Ga0307509_10190468 3300031507 Bacteria 1903
261 Ga0307408_100005672 3300031548 Bacteria 8317
262 Ga0307408_100007304 3300031548 Bacteria 7309
263 Ga0307405_10000006 3300031731 Bacteria 361477
264 Ga0307410_10002011 3300031852 Bacteria 9588
265 Ga0307406_10000114 3300031901 Bacteria 46700
266 Ga0307407_10000005 3300031903 Bacteria 233125
267 Ga0307412_10280191 3300031911 Bacteria 1309
268 Ga0307416_100000001 3300032002 Bacteria 515017
269 Ga0307416_100005670 3300032002 Bacteria 7714
270 Ga0307414_10000002 3300032004 Bacteria 623006
271 Ga0307414_10006592 3300032004 Bacteria 6482
272 Ga0307414_10061111 3300032004 Bacteria 2667
273 Ga0307411_10000001 3300032005 Bacteria 931810
274 Ga0307510_10000230 3300033180 Bacteria 50153
275 Ga0307510_10089067 3300033180 Bacteria 2941
276 Ga0307510_10272206 3300033180 Bacteria 1169
277 Ga0395899_0000339 3300037312 Bacteria 58722
278 Ga0395899_0001258 3300037312 Bacteria 22040
279 Ga0395900_0000140 3300037418 Bacteria 121917
280 Ga0395900_0000231 3300037418 Bacteria 87314
281 Ga0395900_0010483 3300037418 Bacteria 9480
282 Ga0395900_0016691 3300037418 Bacteria 7490
283 Ga0395898_0084142 3300037466 Bacteria 3066
284 Ga0395898_0215103 3300037466 Bacteria 1833
285 Ga0395898_0522332 3300037466 Bacteria 1128
286 Ga0395905_0000261 3300037471 Bacteria 78643
287 Ga0395905_0000579 3300037471 Bacteria 49357
288 Ga0395901_0000236 3300038443 Bacteria 69250
289 Ga0395901_0015933 3300038443 Bacteria 7658
290 Ga0395901_0110565 3300038443 Bacteria 2885
291 Ga0395901_0404933 3300038443 Bacteria 1401
292 Ga0436361_1163642 3300039447 Bacteria 16297
293 Ga0439447_001865 3300041407 Bacteria 7712
294 Ga0451791_0509542 3300041451 Bacteria 1614
295 Ga0466972_0000010 3300044658 Bacteria 256339
296 Ga0466972_0000031 3300044658 Bacteria 159625
297 Ga0466972_0051643 3300044658 Bacteria 1983
298 Ga0466961_0220350 3300044693 Bacteria 1169
299 Ga0466968_0017136 3300044735 Bacteria 2892
300 Ga0466970_0019353 3300044765 Bacteria 3528
301 Ga0466957_0012643 3300044842 Bacteria 4889
302 Ga0466959_0006440 3300045049 Bacteria 8128
303 Ga0466959_0066687 3300045049 Bacteria 2611
304 Ga0466958_0032476 3300045836 Bacteria 3106
305 Ga0495650_0000132 3300046471 Bacteria 174226
306 Ga0495585_0000786 3300046492 Bacteria 28002
307 Ga0495606_0004976 3300046507 Bacteria 12959
308 Ga0495606_0061011 3300046507 Bacteria 2413
309 Ga0495610_0000539 3300046512 Bacteria 38045
310 Ga0495616_0001663 3300046513 Bacteria 15207
311 Ga0495648_0016642 3300046524 Bacteria 5292
312 Ga0495648_0048276 3300046524 Bacteria 2622
313 Ga0495609_0019056 3300046538 Bacteria 3176
314 Ga0495622_0022161 3300046557 Bacteria 2960
315 Ga0495633_0000156 3300046558 Bacteria 89387
316 Ga0495633_0019737 3300046558 Bacteria 3403
317 Ga0495668_0000643 3300046616 Bacteria 42003
318 Ga0495668_0002482 3300046616 Bacteria 15145
319 Ga0495625_0000036 3300046660 Bacteria 221680
320 Ga0495625_0000222 3300046660 Bacteria 89536
321 Ga0495625_0004120 3300046660 Bacteria 13873
322 Ga0495625_0083591 3300046660 Bacteria 2219
323 Ga0495661_0053609 3300046665 Bacteria 2424
324 Ga0495649_0000017 3300046694 Bacteria 221685
325 Ga0495649_0051111 3300046694 Bacteria 2242
326 Ga0495600_0137422 3300046809 Bacteria 1587
327 Ga0495674_0007847 3300047319 Bacteria 10194
328 Ga0495687_000119 3300047443 Bacteria 121587
329 Ga0495687_000541 3300047443 Bacteria 45129
330 Ga0495614_0035840 3300048089 Bacteria 2131
331 Ga0496110_0029052 3300048913 Bacteria 4754
332 Ga0496112_0464023 3300048915 Bacteria 1204
333 Ga0496115_0034010 3300048918 Bacteria 4028
334 Ga0496116_0000032 3300048919 Bacteria 419997
335 Ga0496116_0005747 3300048919 Bacteria 11408
336 Ga0496117_0000897 3300048920 Bacteria 45839
337 Ga0496117_0098258 3300048920 Bacteria 1862
338 Ga0496118_0025760 3300048921 Bacteria 5032
339 Ga0496121_0000028 3300048924 Bacteria 439193
340 Ga0496121_0021305 3300048924 Bacteria 6357
341 Ga0496122_0009309 3300048925 Bacteria 10384
342 Ga0496122_0020451 3300048925 Bacteria 5980
343 Ga0496123_0021240 3300048926 Bacteria 5051
344 Ga0496123_0056643 3300048926 Bacteria 2559
345 Ga0496124_0050674 3300048927 Bacteria 3536
346 Ga0496124_0076568 3300048927 Bacteria 2761
347 Ga0496125_0000111 3300048928 Bacteria 191489
348 Ga0496125_0130065 3300048928 Bacteria 1774
349 Ga0496126_0020260 3300048929 Bacteria 6527
350 Ga0496126_0035848 3300048929 Bacteria 4644
351 Ga0495678_020157 3300049459 Bacteria 2959
352 Ga0501032_0101228 3300049569 Bacteria 1909
353 Ga0501034_0048843 3300049571 Bacteria 4270
354 Ga0501034_0061606 3300049571 Bacteria 3767
355 Ga0501034_0087863 3300049571 Bacteria 3107
356 Ga0501034_0417927 3300049571 Bacteria 1262
357 Ga0501037_0012109 3300049573 Bacteria 6351
358 Ga0501037_0151385 3300049573 Bacteria 1658
359 Ga0501046_0255537 3300049580 Bacteria 1289
360 Ga0501047_0073020 3300049581 Bacteria 3303
361 Ga0501067_0055732 3300049583 Bacteria 2190
362 Ga0501072_0297878 3300049588 Bacteria 1282
363 Ga0501073_0017725 3300049589 Bacteria 5155
364 Ga0501217_000730 3300049661 Bacteria 5678
365 Ga0501222_002857 3300049662 Bacteria 2383
366 Ga0501238_000054 3300049671 Bacteria 18754
367 Ga0501238_011126 3300049671 Bacteria 1207
368 Ga0501242_004059 3300049674 Bacteria 1612
369 Ga0501257_012641 3300049686 Bacteria 1932
370 Ga0501266_000016 3300049763 Bacteria 164181
371 Ga0501280_000049 3300049776 Bacteria 34870
372 Ga0501035_0450702 3300049822 Bacteria 1064
373 Ga0501044_0114543 3300049823 Bacteria 2702
374 Ga0501044_0176722 3300049823 Bacteria 2104
375 nmdc:mga0k408_496_c1 3300050493 Bacteria 14108
376 Ga0500578_0048552 3300053086 Bacteria 2723
377 Ga0500583_0021706 3300053092 Bacteria 2675
378 Ga0500641_0000013 3300053096 Bacteria 156919
379 Ga0500562_000011 3300053108 Bacteria 179510
380 Ga0500562_006465 3300053108 Bacteria 2953
381 Ga0500614_005510 3300053123 Bacteria 2656
382 Ga0500658_0000019 3300053134 Bacteria 141013
383 Ga0500616_0000004 3300053153 Bacteria 1002714
384 Ga0500616_0035577 3300053153 Bacteria 2708
385 Ga0500616_0138005 3300053153 Bacteria 1143
386 Ga0500622_0000927 3300053156 Bacteria 24923
387 Ga0500622_0000930 3300053156 Bacteria 24898
388 Ga0500636_0127501 3300053177 Bacteria 1421
389 Ga0501084_0050445 3300054114 Bacteria 3483
390 Ga0501082_0027813 3300060353 Bacteria 4870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10320608 Ga0157372_103206082 314
2 3300031548 Ga0307408_100005672 Ga0307408_1000056724 327
3 iso_pu_bacteria 2519899754 2520879069 336
4 iso_pu_bacteria 2599185184 2599478126 336
5 iso_pu_bacteria 2643221667 2644372634 336
6 iso_pu_bacteria 2643221716 2644640172 336
7 iso_pu_bacteria 2721755487 2722726877 336
8 iso_pu_bacteria 2738541279 2738732207 336
9 iso_pu_bacteria 2738541283 2738759272 336
10 iso_pu_bacteria 2738541285 2738764772 336
11 iso_pu_bacteria 2738543007 2739213787 336
12 iso_pu_bacteria 2739367663 2739647686 336
13 iso_pu_bacteria 2739367857 2740001446 336
14 iso_pu_bacteria 2739367858 2740006262 336
15 iso_pu_bacteria 2775506987 2776614034 336
16 iso_pu_bacteria 2816332280 2817416047 336
17 iso_pu_bacteria 2818991442 2819572291 336
18 iso_pu_bacteria 2818991444 2819588173 336
19 iso_pu_bacteria 2818991460 2819681863 336
20 iso_pu_bacteria 2821136567 2821141549 336
21 iso_pu_bacteria 2842722452 2842724165 336
22 iso_pu_bacteria 2842903701 2842903828 336
23 iso_pu_bacteria 2842909656 2842913696 336
24 iso_pu_bacteria 2857613821 2857616857 336
25 iso_pu_bacteria 2857618242 2857618398 336
26 iso_pu_bacteria 2881359912 2881362964 336
27 iso_pu_bacteria 2884791551 2884792780 336
28 iso_pu_bacteria 2896317667 2896319860 336
29 iso_pu_bacteria 2903895155 2903897192 336
30 iso_pu_bacteria 2904467357 2904470037 336
31 iso_pu_bacteria 2904555929 2904560527 336
32 iso_pu_bacteria 2904780799 2904782101 336
33 iso_pu_bacteria 2919177583 2919179504 336
34 iso_pu_bacteria 2919186247 2919191175 336
35 iso_pu_bacteria 2919437846 2919441845 336
36 iso_pu_bacteria 2928078545 2928080082 336
37 iso_pu_bacteria 2928147474 2928149749 336
38 iso_pu_bacteria 2929150217 2929153931 336
39 iso_pu_bacteria 2929239360 2929245184 336
40 iso_pu_bacteria 2932082852 2932083572 336
41 iso_pu_bacteria 2939664404 2939669454 336
42 iso_pu_bacteria 2946019816 2946020001 336
43 iso_pu_bacteria 2958458903 2958461528 336
44 iso_pu_bacteria 2977232053 2977236476 336
45 iso_pu_bacteria 8055419101 8055421777 336
46 iso_pu_bacteria 8055588893 8055590629 336
47 iso_pu_bacteria 8055592153 8055593780 336
48 iso_pu_bacteria 8056440228 8056441493 336
49 iso_pu_bacteria 2522125168 2522552989 337
50 3300005843 Ga0068860_100031077 Ga0068860_1000310772 338
51 3300005288 Ga0065714_10065245 Ga0065714_100652453 339
52 3300005327 Ga0070658_10000079 Ga0070658_1000007997 339
53 3300013297 Ga0157378_10003533 Ga0157378_1000353315 339
54 3300025909 Ga0207705_10000112 Ga0207705_1000011297 339
55 2162886007 SwRhRL2b_contig_3293304 SwRhRL2b_0707.00004670 340
56 3300001979 JGI24740J21852_10003905 JGI24740J21852_100039053 340
57 3300001990 JGI24737J22298_10000621 JGI24737J22298_1000062112 340
58 3300001990 JGI24737J22298_10024697 JGI24737J22298_100246972 340
59 3300002067 JGI24735J21928_10000002 JGI24735J21928_1000000278 340
60 3300003320 rootH2_10211829 rootH2_102118297 340
61 3300003322 rootL2_10003864 rootL2_100038645 340
62 3300003322 rootL2_10016637 rootL2_1001663711 340
63 3300003323 rootH1_10008393 rootH1_100083936 340
64 3300003354 JGI25160J50197_1003407 JGI25160J50197_10034072 340
65 3300003794 Ga0055531_10000118 Ga0055531_1000011871 340
66 3300005262 Ga0065165_1000539 Ga0065165_100053911 340
67 3300005262 Ga0065165_1000981 Ga0065165_100098123 340
68 3300005262 Ga0065165_1009726 Ga0065165_10097264 340
69 3300005288 Ga0065714_10002196 Ga0065714_1000219642 340
70 3300005288 Ga0065714_10070343 Ga0065714_100703434 340
71 3300005289 Ga0065704_10019930 Ga0065704_100199302 340
72 3300005289 Ga0065704_10072377 Ga0065704_100723777 340
73 3300005289 Ga0065704_10095470 Ga0065704_100954703 340
74 3300005293 Ga0065715_10116301 Ga0065715_101163011 340
75 3300005327 Ga0070658_10107539 Ga0070658_101075392 340
76 3300005327 Ga0070658_10147873 Ga0070658_101478732 340
77 3300005328 Ga0070676_10043402 Ga0070676_100434022 340
78 3300005331 Ga0070670_100108906 Ga0070670_1001089062 340
79 3300005334 Ga0068869_100198786 Ga0068869_1001987861 340
80 3300005335 Ga0070666_10000174 Ga0070666_1000017416 340
81 3300005335 Ga0070666_10023560 Ga0070666_100235604 340
82 3300005336 Ga0070680_100045376 Ga0070680_1000453761 340
83 3300005338 Ga0068868_100111706 Ga0068868_1001117062 340
84 3300005339 Ga0070660_100008004 Ga0070660_1000080044 340
85 3300005347 Ga0070668_100012037 Ga0070668_1000120373 340
86 3300005353 Ga0070669_100006817 Ga0070669_1000068173 340
87 3300005355 Ga0070671_100062258 Ga0070671_1000622582 340
88 3300005356 Ga0070674_100054653 Ga0070674_1000546534 340
89 3300005364 Ga0070673_100082641 Ga0070673_1000826411 340
90 3300005364 Ga0070673_100247279 Ga0070673_1002472792 340
91 3300005366 Ga0070659_100000542 Ga0070659_10000054210 340
92 3300005366 Ga0070659_100001687 Ga0070659_1000016872 340
93 3300005367 Ga0070667_100009950 Ga0070667_1000099507 340
94 3300005367 Ga0070667_100203447 Ga0070667_1002034472 340
95 3300005455 Ga0070663_100003820 Ga0070663_1000038203 340
96 3300005457 Ga0070662_100008365 Ga0070662_1000083654 340
97 3300005457 Ga0070662_100015420 Ga0070662_1000154203 340
98 3300005459 Ga0068867_100008348 Ga0068867_1000083484 340
99 3300005459 Ga0068867_100249266 Ga0068867_1002492661 340
100 3300005459 Ga0068867_100311875 Ga0068867_1003118751 340
101 3300005530 Ga0070679_100037920 Ga0070679_1000379202 340
102 3300005539 Ga0068853_100031449 Ga0068853_1000314493 340
103 3300005539 Ga0068853_100063510 Ga0068853_1000635104 340
104 3300005539 Ga0068853_100229628 Ga0068853_1002296282 340
105 3300005543 Ga0070672_100037154 Ga0070672_1000371544 340
106 3300005548 Ga0070665_100000267 Ga0070665_10000026732 340
107 3300005548 Ga0070665_100017745 Ga0070665_1000177452 340
108 3300005563 Ga0068855_100063226 Ga0068855_1000632261 340
109 3300005614 Ga0068856_100000275 Ga0068856_10000027557 340
110 3300005616 Ga0068852_100015049 Ga0068852_1000150496 340
111 3300005617 Ga0068859_100001134 Ga0068859_10000113412 340
112 3300005617 Ga0068859_100038772 Ga0068859_1000387723 340
113 3300005617 Ga0068859_100059625 Ga0068859_1000596252 340
114 3300005617 Ga0068859_100250858 Ga0068859_1002508582 340
115 3300005618 Ga0068864_100396413 Ga0068864_1003964131 340
116 3300005840 Ga0068870_10022388 Ga0068870_100223881 340
117 3300005841 Ga0068863_100025030 Ga0068863_1000250302 340
118 3300005842 Ga0068858_100006604 Ga0068858_1000066045 340
119 3300005843 Ga0068860_100000103 Ga0068860_10000010380 340
120 3300005843 Ga0068860_100036006 Ga0068860_1000360065 340
121 3300005843 Ga0068860_100040281 Ga0068860_1000402812 340
122 3300005843 Ga0068860_100358331 Ga0068860_1003583311 340
123 3300006195 Ga0075366_10234367 Ga0075366_102343671 340
124 3300006237 Ga0097621_100053849 Ga0097621_1000538491 340
125 3300006237 Ga0097621_100143860 Ga0097621_1001438602 340
126 3300006358 Ga0068871_100221179 Ga0068871_1002211792 340
127 3300006881 Ga0068865_100270723 Ga0068865_1002707231 340
128 3300006931 Ga0097620_100001134 Ga0097620_10000113417 340
129 3300006931 Ga0097620_100038772 Ga0097620_1000387724 340
130 3300006931 Ga0097620_100059627 Ga0097620_1000596272 340
131 3300006931 Ga0097620_100250840 Ga0097620_1002508402 340
132 3300006946 Ga0079104_1000005 Ga0079104_1000005216 340
133 3300006948 Ga0099826_10038177 Ga0099826_100381773 340
134 3300009036 Ga0105244_10000004 Ga0105244_10000004145 340
135 3300009093 Ga0105240_10000143 Ga0105240_1000014324 340
136 3300009093 Ga0105240_10000188 Ga0105240_1000018877 340
137 3300009093 Ga0105240_10020933 Ga0105240_100209334 340
138 3300009093 Ga0105240_10243702 Ga0105240_102437023 340
139 3300009093 Ga0105240_10620088 Ga0105240_106200881 340
140 3300009093 Ga0105240_10694871 Ga0105240_106948711 340
141 3300009098 Ga0105245_10041124 Ga0105245_100411242 340
142 3300009098 Ga0105245_10304940 Ga0105245_103049401 340
143 3300009148 Ga0105243_10000006 Ga0105243_10000006223 340
144 3300009174 Ga0105241_10002072 Ga0105241_100020728 340
145 3300009174 Ga0105241_10008414 Ga0105241_100084141 340
146 3300009174 Ga0105241_10023201 Ga0105241_100232011 340
147 3300009176 Ga0105242_10018941 Ga0105242_100189413 340
148 3300009545 Ga0105237_10008058 Ga0105237_100080589 340
149 3300009545 Ga0105237_10010612 Ga0105237_100106129 340
150 3300009545 Ga0105237_10015364 Ga0105237_100153643 340
151 3300009545 Ga0105237_10024768 Ga0105237_100247682 340
152 3300009553 Ga0105249_10007645 Ga0105249_100076454 340
153 3300009553 Ga0105249_10281381 Ga0105249_102813811 340
154 3300010375 Ga0105239_10000042 Ga0105239_1000004265 340
155 3300010375 Ga0105239_10000106 Ga0105239_1000010687 340
156 3300010375 Ga0105239_10004126 Ga0105239_100041264 340
157 3300010375 Ga0105239_10009283 Ga0105239_100092835 340
158 3300010375 Ga0105239_10023713 Ga0105239_100237132 340
159 3300010375 Ga0105239_10045702 Ga0105239_100457024 340
160 3300010375 Ga0105239_10242251 Ga0105239_102422512 340
161 3300010375 Ga0105239_10280168 Ga0105239_102801682 340
162 3300011119 Ga0105246_10006728 Ga0105246_100067284 340
163 3300011119 Ga0105246_10011212 Ga0105246_100112123 340
164 3300011119 Ga0105246_10035502 Ga0105246_100355022 340
165 3300013100 Ga0157373_10000420 Ga0157373_1000042031 340
166 3300013100 Ga0157373_10007305 Ga0157373_100073056 340
167 3300013100 Ga0157373_10012311 Ga0157373_100123116 340
168 3300013100 Ga0157373_10026204 Ga0157373_100262042 340
169 3300013100 Ga0157373_10042647 Ga0157373_100426472 340
170 3300013100 Ga0157373_10044363 Ga0157373_100443631 340
171 3300013102 Ga0157371_10000009 Ga0157371_10000009100 340
172 3300013102 Ga0157371_10000529 Ga0157371_1000052933 340
173 3300013102 Ga0157371_10002456 Ga0157371_100024564 340
174 3300013102 Ga0157371_10003544 Ga0157371_100035448 340
175 3300013102 Ga0157371_10007232 Ga0157371_100072325 340
176 3300013102 Ga0157371_10007733 Ga0157371_100077334 340
177 3300013102 Ga0157371_10019129 Ga0157371_100191292 340
178 3300013102 Ga0157371_10026977 Ga0157371_100269773 340
179 3300013104 Ga0157370_10002699 Ga0157370_1000269915 340
180 3300013104 Ga0157370_10005462 Ga0157370_100054623 340
181 3300013104 Ga0157370_10005489 Ga0157370_100054895 340
182 3300013104 Ga0157370_10007758 Ga0157370_100077584 340
183 3300013104 Ga0157370_10215217 Ga0157370_102152171 340
184 3300013105 Ga0157369_10002206 Ga0157369_1000220610 340
185 3300013105 Ga0157369_10064549 Ga0157369_100645494 340
186 3300013105 Ga0157369_10130657 Ga0157369_101306573 340
187 3300013296 Ga0157374_10000758 Ga0157374_1000075832 340
188 3300013296 Ga0157374_10000809 Ga0157374_1000080910 340
189 3300013296 Ga0157374_10095879 Ga0157374_100958792 340
190 3300013296 Ga0157374_10099866 Ga0157374_100998661 340
191 3300013297 Ga0157378_10105148 Ga0157378_101051483 340
192 3300013297 Ga0157378_10294313 Ga0157378_102943131 340
193 3300013306 Ga0163162_10000074 Ga0163162_1000007441 340
194 3300013306 Ga0163162_10004928 Ga0163162_1000492810 340
195 3300013306 Ga0163162_10012229 Ga0163162_100122292 340
196 3300013307 Ga0157372_10000016 Ga0157372_1000001640 340
197 3300013307 Ga0157372_10000771 Ga0157372_1000077132 340
198 3300013307 Ga0157372_10000878 Ga0157372_100008782 340
199 3300013307 Ga0157372_10015709 Ga0157372_100157097 340
200 3300013307 Ga0157372_10047954 Ga0157372_100479543 340
201 3300013307 Ga0157372_10094254 Ga0157372_100942543 340
202 3300013307 Ga0157372_10244303 Ga0157372_102443034 340
203 3300013307 Ga0157372_10408894 Ga0157372_104088942 340
204 3300013307 Ga0157372_10560427 Ga0157372_105604271 340
205 3300014497 Ga0182008_10002302 Ga0182008_100023028 340
206 3300014969 Ga0157376_10018302 Ga0157376_100183023 340
207 3300015261 Ga0182006_1002740 Ga0182006_10027409 340
208 3300015262 Ga0182007_10000059 Ga0182007_1000005970 340
209 3300017792 Ga0163161_10000026 Ga0163161_10000026128 340
210 3300017792 Ga0163161_10000341 Ga0163161_100003414 340
211 3300017792 Ga0163161_10005185 Ga0163161_100051855 340
212 3300017792 Ga0163161_10101916 Ga0163161_101019161 340
213 3300025250 Ga0209026_1000559 Ga0209026_100055916 340
214 3300025292 Ga0209676_1000396 Ga0209676_100039647 340
215 3300025298 Ga0209050_1001087 Ga0209050_100108717 340
216 3300025302 Ga0207426_1000019 Ga0207426_1000019296 340
217 3300025302 Ga0207426_1000209 Ga0207426_10002092 340
218 3300025302 Ga0207426_1007048 Ga0207426_10070484 340
219 3300025304 Ga0209257_1000007 Ga0209257_1000007119 340
220 3300025321 Ga0207656_10032655 Ga0207656_100326552 340
221 3300025728 Ga0207655_1000008 Ga0207655_1000008443 340
222 3300025899 Ga0207642_10058418 Ga0207642_100584181 340
223 3300025901 Ga0207688_10021206 Ga0207688_100212063 340
224 3300025903 Ga0207680_10001491 Ga0207680_100014919 340
225 3300025903 Ga0207680_10285184 Ga0207680_102851841 340
226 3300025904 Ga0207647_10000473 Ga0207647_100004733 340
227 3300025904 Ga0207647_10000641 Ga0207647_100006411 340
228 3300025904 Ga0207647_10019409 Ga0207647_100194093 340
229 3300025904 Ga0207647_10023755 Ga0207647_100237552 340
230 3300025907 Ga0207645_10000685 Ga0207645_1000068511 340
231 3300025907 Ga0207645_10071104 Ga0207645_100711041 340
232 3300025911 Ga0207654_10006008 Ga0207654_100060082 340
233 3300025913 Ga0207695_10000016 Ga0207695_10000016497 340
234 3300025913 Ga0207695_10000284 Ga0207695_1000028454 340
235 3300025914 Ga0207671_10000967 Ga0207671_1000096734 340
236 3300025914 Ga0207671_10001786 Ga0207671_100017869 340
237 3300025914 Ga0207671_10009391 Ga0207671_100093912 340
238 3300025914 Ga0207671_10012352 Ga0207671_100123528 340
239 3300025917 Ga0207660_10377419 Ga0207660_103774191 340
240 3300025919 Ga0207657_10015475 Ga0207657_100154754 340
241 3300025919 Ga0207657_10021682 Ga0207657_100216823 340
242 3300025921 Ga0207652_10002572 Ga0207652_1000257211 340
243 3300025921 Ga0207652_10006324 Ga0207652_1000632411 340
244 3300025921 Ga0207652_10216052 Ga0207652_102160521 340
245 3300025925 Ga0207650_10146678 Ga0207650_101466781 340
246 3300025932 Ga0207690_10000668 Ga0207690_100006686 340
247 3300025932 Ga0207690_10018404 Ga0207690_100184043 340
248 3300025933 Ga0207706_10000380 Ga0207706_1000038040 340
249 3300025933 Ga0207706_10001186 Ga0207706_100011862 340
250 3300025935 Ga0207709_10000007 Ga0207709_10000007463 340
251 3300025938 Ga0207704_10210580 Ga0207704_102105801 340
252 3300025938 Ga0207704_10233617 Ga0207704_102336171 340
253 3300025940 Ga0207691_10029493 Ga0207691_100294933 340
254 3300025942 Ga0207689_10001528 Ga0207689_100015286 340
255 3300025942 Ga0207689_10037062 Ga0207689_100370623 340
256 3300025949 Ga0207667_10001065 Ga0207667_1000106515 340
257 3300025949 Ga0207667_10007843 Ga0207667_100078433 340
258 3300025949 Ga0207667_10084388 Ga0207667_100843882 340
259 3300025949 Ga0207667_10111230 Ga0207667_101112304 340
260 3300025949 Ga0207667_10450735 Ga0207667_104507351 340
261 3300025960 Ga0207651_10264433 Ga0207651_102644331 340
262 3300025986 Ga0207658_10016984 Ga0207658_100169844 340
263 3300025986 Ga0207658_10119885 Ga0207658_101198852 340
264 3300026023 Ga0207677_10017050 Ga0207677_100170503 340
265 3300026023 Ga0207677_10055752 Ga0207677_100557522 340
266 3300026035 Ga0207703_10005772 Ga0207703_100057722 340
267 3300026041 Ga0207639_10015679 Ga0207639_100156794 340
268 3300026041 Ga0207639_10116364 Ga0207639_101163642 340
269 3300026041 Ga0207639_10159066 Ga0207639_101590662 340
270 3300026041 Ga0207639_10244663 Ga0207639_102446632 340
271 3300026041 Ga0207639_10373371 Ga0207639_103733711 340
272 3300026067 Ga0207678_10004400 Ga0207678_100044009 340
273 3300026078 Ga0207702_10008555 Ga0207702_100085553 340
274 3300026088 Ga0207641_10001176 Ga0207641_1000117612 340
275 3300026089 Ga0207648_10001944 Ga0207648_1000194414 340
276 3300026089 Ga0207648_10008386 Ga0207648_100083864 340
277 3300026095 Ga0207676_10004759 Ga0207676_100047592 340
278 3300026095 Ga0207676_10261484 Ga0207676_102614842 340
279 3300026095 Ga0207676_10322340 Ga0207676_103223401 340
280 3300026116 Ga0207674_10029340 Ga0207674_100293405 340
281 3300026118 Ga0207675_100064132 Ga0207675_1000641322 340
282 3300026118 Ga0207675_100085507 Ga0207675_1000855071 340
283 3300026121 Ga0207683_10005647 Ga0207683_100056477 340
284 3300026142 Ga0207698_10006065 Ga0207698_100060654 340
285 3300026142 Ga0207698_10008804 Ga0207698_100088043 340
286 3300027111 Ga0209281_1000216 Ga0209281_10002166 340
287 3300028379 Ga0268266_10000018 Ga0268266_10000018437 340
288 3300028379 Ga0268266_10047917 Ga0268266_100479173 340
289 3300028380 Ga0268265_10314818 Ga0268265_103148182 340
290 3300028381 Ga0268264_10000013 Ga0268264_10000013242 340
291 3300028381 Ga0268264_10016796 Ga0268264_100167963 340
292 3300028381 Ga0268264_10029803 Ga0268264_100298033 340
293 3300028381 Ga0268264_10091047 Ga0268264_100910471 340
294 3300028794 Ga0307515_10000280 Ga0307515_10000280115 340
295 3300028794 Ga0307515_10001742 Ga0307515_100017427 340
296 3300028794 Ga0307515_10009106 Ga0307515_1000910616 340
297 3300028794 Ga0307515_10014354 Ga0307515_100143546 340
298 3300030731 Ga0316177_1078782 Ga0316177_10787822 340
299 3300030732 Ga0316176_1219093 Ga0316176_121909322 340
300 3300030742 Ga0316183_1074350 Ga0316183_107435049 340
301 3300030744 Ga0316181_1088231 Ga0316181_10882317 340
302 3300030745 Ga0316182_1411663 Ga0316182_14116632 340
303 3300031456 Ga0307513_10022679 Ga0307513_100226794 340
304 3300031456 Ga0307513_10191379 Ga0307513_101913792 340
305 3300031456 Ga0307513_10216702 Ga0307513_102167022 340
306 3300031456 Ga0307513_10319203 Ga0307513_103192032 340
307 3300031507 Ga0307509_10106342 Ga0307509_101063422 340
308 3300031507 Ga0307509_10190468 Ga0307509_101904683 340
309 3300031548 Ga0307408_100007304 Ga0307408_1000073044 340
310 3300031731 Ga0307405_10000006 Ga0307405_10000006171 340
311 3300031852 Ga0307410_10002011 Ga0307410_100020113 340
312 3300031901 Ga0307406_10000114 Ga0307406_1000011420 340
313 3300031903 Ga0307407_10000005 Ga0307407_10000005101 340
314 3300031911 Ga0307412_10280191 Ga0307412_102801912 340
315 3300032002 Ga0307416_100000001 Ga0307416_10000000183 340
316 3300032002 Ga0307416_100005670 Ga0307416_1000056703 340
317 3300032004 Ga0307414_10000002 Ga0307414_10000002522 340
318 3300032004 Ga0307414_10006592 Ga0307414_100065926 340
319 3300032004 Ga0307414_10061111 Ga0307414_100611112 340
320 3300032005 Ga0307411_10000001 Ga0307411_10000001605 340
321 3300033180 Ga0307510_10000230 Ga0307510_1000023028 340
322 3300033180 Ga0307510_10089067 Ga0307510_100890672 340
323 3300033180 Ga0307510_10272206 Ga0307510_102722061 340
324 3300037312 Ga0395899_0000339 Ga0395899_0000339_8722_9744 340
325 3300037312 Ga0395899_0001258 Ga0395899_0001258_19879_20901 340
326 3300037418 Ga0395900_0000140 Ga0395900_0000140_3203_4225 340
327 3300037418 Ga0395900_0000231 Ga0395900_0000231_63661_64683 340
328 3300037418 Ga0395900_0010483 Ga0395900_0010483_289_1311 340
329 3300037418 Ga0395900_0016691 Ga0395900_0016691_2766_3824 340
330 3300037466 Ga0395898_0084142 Ga0395898_0084142_376_1398 340
331 3300037466 Ga0395898_0215103 Ga0395898_0215103_501_1523 340
332 3300037466 Ga0395898_0522332 Ga0395898_0522332_91_1113 340
333 3300037471 Ga0395905_0000261 Ga0395905_0000261_63655_64677 340
334 3300037471 Ga0395905_0000579 Ga0395905_0000579_19770_20828 340
335 3300038443 Ga0395901_0000236 Ga0395901_0000236_4856_5878 340
336 3300038443 Ga0395901_0015933 Ga0395901_0015933_4610_5668 340
337 3300038443 Ga0395901_0110565 Ga0395901_0110565_1433_2455 340
338 3300038443 Ga0395901_0404933 Ga0395901_0404933_349_1371 340
339 3300039447 Ga0436361_1163642 Ga0436361_1163642_4528_5550 340
340 3300041407 Ga0439447_001865 Ga0439447_001865_4848_5870 340
341 3300041451 Ga0451791_0509542 Ga0451791_0509542_158_1180 340
342 3300044658 Ga0466972_0000010 Ga0466972_0000010_29098_30120 340
343 3300044658 Ga0466972_0000031 Ga0466972_0000031_136153_137175 340
344 3300044658 Ga0466972_0051643 Ga0466972_0051643_553_1575 340
345 3300044693 Ga0466961_0220350 Ga0466961_0220350_55_1077 340
346 3300044735 Ga0466968_0017136 Ga0466968_0017136_734_1756 340
347 3300044765 Ga0466970_0019353 Ga0466970_0019353_1823_2845 340
348 3300044842 Ga0466957_0012643 Ga0466957_0012643_2729_3751 340
349 3300045049 Ga0466959_0006440 Ga0466959_0006440_6761_7783 340
350 3300045049 Ga0466959_0066687 Ga0466959_0066687_343_1365 340
351 3300045836 Ga0466958_0032476 Ga0466958_0032476_1000_2022 340
352 3300046471 Ga0495650_0000132 Ga0495650_0000132_110310_111332 340
353 3300046492 Ga0495585_0000786 Ga0495585_0000786_24826_25851 340
354 3300046507 Ga0495606_0004976 Ga0495606_0004976_8640_9662 340
355 3300046507 Ga0495606_0061011 Ga0495606_0061011_369_1391 340
356 3300046512 Ga0495610_0000539 Ga0495610_0000539_2019_3041 340
357 3300046513 Ga0495616_0001663 Ga0495616_0001663_4643_5665 340
358 3300046524 Ga0495648_0016642 Ga0495648_0016642_2202_3227 340
359 3300046524 Ga0495648_0048276 Ga0495648_0048276_147_1172 340
360 3300046538 Ga0495609_0019056 Ga0495609_0019056_2026_3051 340
361 3300046557 Ga0495622_0022161 Ga0495622_0022161_1344_2369 340
362 3300046558 Ga0495633_0000156 Ga0495633_0000156_58669_59694 340
363 3300046558 Ga0495633_0019737 Ga0495633_0019737_1143_2165 340
364 3300046616 Ga0495668_0000643 Ga0495668_0000643_35961_36986 340
365 3300046616 Ga0495668_0002482 Ga0495668_0002482_4672_5694 340
366 3300046660 Ga0495625_0000036 Ga0495625_0000036_86676_87698 340
367 3300046660 Ga0495625_0000222 Ga0495625_0000222_69384_70409 340
368 3300046660 Ga0495625_0004120 Ga0495625_0004120_1979_3079 340
369 3300046660 Ga0495625_0083591 Ga0495625_0083591_1166_2188 340
370 3300046665 Ga0495661_0053609 Ga0495661_0053609_457_1479 340
371 3300046694 Ga0495649_0000017 Ga0495649_0000017_134018_135040 340
372 3300046694 Ga0495649_0051111 Ga0495649_0051111_647_1702 340
373 3300046809 Ga0495600_0137422 Ga0495600_0137422_116_1141 340
374 3300047319 Ga0495674_0007847 Ga0495674_0007847_5421_6443 340
375 3300047443 Ga0495687_000119 Ga0495687_000119_23056_24078 340
376 3300047443 Ga0495687_000541 Ga0495687_000541_26552_27574 340
377 3300048089 Ga0495614_0035840 Ga0495614_0035840_967_1992 340
378 3300048913 Ga0496110_0029052 Ga0496110_0029052_1354_2376 340
379 3300048915 Ga0496112_0464023 Ga0496112_0464023_48_1070 340
380 3300048918 Ga0496115_0034010 Ga0496115_0034010_1444_2466 340
381 3300048919 Ga0496116_0000032 Ga0496116_0000032_391448_392470 340
382 3300048919 Ga0496116_0005747 Ga0496116_0005747_3167_4189 340
383 3300048920 Ga0496117_0000897 Ga0496117_0000897_28276_29298 340
384 3300048920 Ga0496117_0098258 Ga0496117_0098258_739_1761 340
385 3300048921 Ga0496118_0025760 Ga0496118_0025760_2602_3624 340
386 3300048924 Ga0496121_0000028 Ga0496121_0000028_385467_386489 340
387 3300048924 Ga0496121_0021305 Ga0496121_0021305_2609_3631 340
388 3300048925 Ga0496122_0009309 Ga0496122_0009309_7104_8126 340
389 3300048925 Ga0496122_0020451 Ga0496122_0020451_2238_3260 340
390 3300048926 Ga0496123_0021240 Ga0496123_0021240_3981_5003 340
391 3300048926 Ga0496123_0056643 Ga0496123_0056643_1101_2123 340
392 3300048927 Ga0496124_0050674 Ga0496124_0050674_2216_3238 340
393 3300048927 Ga0496124_0076568 Ga0496124_0076568_452_1474 340
394 3300048928 Ga0496125_0000111 Ga0496125_0000111_53881_54903 340
395 3300048928 Ga0496125_0130065 Ga0496125_0130065_615_1637 340
396 3300048929 Ga0496126_0020260 Ga0496126_0020260_4562_5584 340
397 3300048929 Ga0496126_0035848 Ga0496126_0035848_956_1978 340
398 3300049459 Ga0495678_020157 Ga0495678_020157_607_1707 340
399 3300049569 Ga0501032_0101228 Ga0501032_0101228_110_1150 340
400 3300049571 Ga0501034_0048843 Ga0501034_0048843_1842_2864 340
401 3300049571 Ga0501034_0061606 Ga0501034_0061606_449_1489 340
402 3300049571 Ga0501034_0087863 Ga0501034_0087863_1324_2346 340
403 3300049571 Ga0501034_0417927 Ga0501034_0417927_67_1089 340
404 3300049573 Ga0501037_0012109 Ga0501037_0012109_68_1090 340
405 3300049573 Ga0501037_0151385 Ga0501037_0151385_399_1439 340
406 3300049580 Ga0501046_0255537 Ga0501046_0255537_83_1105 340
407 3300049581 Ga0501047_0073020 Ga0501047_0073020_255_1295 340
408 3300049583 Ga0501067_0055732 Ga0501067_0055732_498_1520 340
409 3300049588 Ga0501072_0297878 Ga0501072_0297878_180_1202 340
410 3300049589 Ga0501073_0017725 Ga0501073_0017725_1854_2876 340
411 3300049661 Ga0501217_000730 Ga0501217_000730_928_1950 340
412 3300049662 Ga0501222_002857 Ga0501222_002857_1238_2260 340
413 3300049671 Ga0501238_000054 Ga0501238_000054_524_1546 340
414 3300049671 Ga0501238_011126 Ga0501238_011126_153_1175 340
415 3300049674 Ga0501242_004059 Ga0501242_004059_81_1103 340
416 3300049686 Ga0501257_012641 Ga0501257_012641_310_1332 340
417 3300049763 Ga0501266_000016 Ga0501266_000016_115892_116914 340
418 3300049776 Ga0501280_000049 Ga0501280_000049_6786_7808 340
419 3300049822 Ga0501035_0450702 Ga0501035_0450702_30_1052 340
420 3300049823 Ga0501044_0114543 Ga0501044_0114543_1113_2153 340
421 3300049823 Ga0501044_0176722 Ga0501044_0176722_366_1388 340
422 3300050493 nmdc:mga0k408_496_c1 nmdc:mga0k408_496_c1_6420_7445 340
423 3300053086 Ga0500578_0048552 Ga0500578_0048552_1538_2560 340
424 3300053092 Ga0500583_0021706 Ga0500583_0021706_730_1890 340
425 3300053096 Ga0500641_0000013 Ga0500641_0000013_23767_24789 340
426 3300053108 Ga0500562_000011 Ga0500562_000011_158401_159423 340
427 3300053108 Ga0500562_006465 Ga0500562_006465_1885_2907 340
428 3300053123 Ga0500614_005510 Ga0500614_005510_1469_2494 340
429 3300053134 Ga0500658_0000019 Ga0500658_0000019_106238_107260 340
430 3300053153 Ga0500616_0000004 Ga0500616_0000004_848942_849964 340
431 3300053153 Ga0500616_0035577 Ga0500616_0035577_541_1563 340
432 3300053153 Ga0500616_0138005 Ga0500616_0138005_94_1116 340
433 3300053156 Ga0500622_0000927 Ga0500622_0000927_18138_19160 340
434 3300053156 Ga0500622_0000930 Ga0500622_0000930_15155_16177 340
435 3300053177 Ga0500636_0127501 Ga0500636_0127501_213_1235 340
436 3300054114 Ga0501084_0050445 Ga0501084_0050445_1644_2666 340
437 3300060353 Ga0501082_0027813 Ga0501082_0027813_1170_2192 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

47

305

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.7544 2 48
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.74 1 338
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.7344 3 335
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.7311 1 338
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.7242 3 335
ID Description Score Start End Superfamily
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.6976 1 313 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.6907 1 338 3.20.20.30
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.689 1 331 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.6873 3 335 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.6862 1 338 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A4V1UN71-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9807 189 340 GO:0005829
GO:0016705
AF-A0A3S0HD01-F1-model_v4 deleted 0.9803 181 340
AF-A0A529HRT2-F1-model_v4 deleted 0.9767 183 340
AF-A0A4V1UN71-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9744 189 340 GO:0005829
GO:0016705
AF-A0A3S0HD01-F1-model_v4 deleted 0.9743 181 340

Feature Viewer

pLDDT pTM Quality
83.28 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map