F443648

General Info

Members Datasets Scaffolds Average Seq Length
436 241 872 488

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_215044_c1|nmdc:mga0n895_215044_c1_299_1897
Length 532
Sequence MAQKGLNIRYSSDYAGSLAAGPGAAIRKFRGESEMNRVLARALVLMVGVGLIAACTSGSNNTSSNNKFSGTTIRVVTFTGPQIAEPLQRRAPDFEKLTGAKVQVITVPFSDLYQKVLTDFATKTNSYDATVFDPQWMGDYVPPGYLEDLSDRVKNDSAIQWNDIAPFFRDFSATFKGKIYTIPLDGDFQMVYYRTDLLQKDGLKPPETWDDYVSIAQHFQGKDLNGDGKADYGSCMAMKRSAQSYWMIISIAAALLQSQGTKQGTFFSTDNMQPLINNPAMARALGIYKTLSRLGPPDQLNNDVGDSRGLFVTGRCALSLDWGDIGPLAVDKTQSKVIDKVGAVILPGSKQVLDRSSGQLADCNSTLCPYATNGVNHSPFAAFGGWSGAVNKAAPTKVKDAAYAFLSYMSQPAQSGVDVTIGKTGFNPYRLSHFNNLKNWLDSGMSEQAAKDYLGAIQTSLQSPNMVLDLRIPQSAFYEGTALDTAIAQFLAGELSANQTMAQITDQWNKKTDEVGRPAQLDAYKASLSVTK

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
108 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
109 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
220 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
225 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
226 2818991450 Burkholderia sp. 604 Isolate Unclassified
227 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
228 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
229 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
230 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
231 2909042592 Labrys sp. LIt4 Isolate Nodule
232 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
233 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
234 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
235 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
236 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
237 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
238 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
239 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
240 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
241 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 0.92
Isolates 4.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 2.75
Rhizoplane 6.19
Rhizosphere 85.78
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_215044_c1 3300050512 Bacteria 1952
2 JGI24735J21928_10004231 3300002067 Bacteria 4842
3 JGI25406J46586_10007689 3300003203 Bacteria 4901
4 JGI25406J46586_10034401 3300003203 Bacteria 1860
5 JGI25153J46596_10000010 3300003215 Bacteria 337769
6 Ga0070690_100139061 3300005330 Bacteria 1647
7 Ga0070692_10004445 3300005345 Bacteria 5862
8 Ga0070668_100050819 3300005347 Bacteria 3193
9 Ga0070674_100006880 3300005356 Bacteria 6665
10 Ga0070703_10001827 3300005406 Bacteria 6279
11 Ga0070703_10002732 3300005406 Bacteria 5065
12 Ga0070714_100077424 3300005435 Bacteria 2889
13 Ga0070705_100003101 3300005440 Bacteria 8176
14 Ga0070705_100023694 3300005440 Archaea 3301
15 Ga0070694_100012233 3300005444 Bacteria 5331
16 Ga0070694_100086944 3300005444 Bacteria 2186
17 Ga0070708_100000008 3300005445 Bacteria 146021
18 Ga0070708_100015657 3300005445 Bacteria 6267
19 Ga0070708_100043973 3300005445 Bacteria 3926
20 Ga0070708_100046129 3300005445 Bacteria 3844
21 Ga0070708_100095888 3300005445 Bacteria 2709
22 Ga0070708_100130303 3300005445 Bacteria 2327
23 Ga0070708_100138036 3300005445 Bacteria 2260
24 Ga0070663_100058532 3300005455 Bacteria 2767
25 Ga0070663_100133629 3300005455 Bacteria 1887
26 Ga0070662_100011720 3300005457 Bacteria 5788
27 Ga0070706_100000160 3300005467 Bacteria 85799
28 Ga0070706_100000372 3300005467 Bacteria 53887
29 Ga0070706_100000396 3300005467 Bacteria 52498
30 Ga0070706_100005357 3300005467 Bacteria 12228
31 Ga0070706_100015374 3300005467 Bacteria 7068
32 Ga0070706_100029323 3300005467 Bacteria 5070
33 Ga0070706_100079243 3300005467 Bacteria 3040
34 Ga0070706_100124601 3300005467 Bacteria 2402
35 Ga0070707_100000004 3300005468 Bacteria 265003
36 Ga0070707_100003116 3300005468 Bacteria 15677
37 Ga0070707_100009054 3300005468 Bacteria 9232
38 Ga0070707_100016110 3300005468 Bacteria 7014
39 Ga0070707_100022604 3300005468 Bacteria 5946
40 Ga0070707_100040418 3300005468 Bacteria 4462
41 Ga0070707_100065128 3300005468 Bacteria 3500
42 Ga0070698_100002382 3300005471 Bacteria 20736
43 Ga0070698_100003112 3300005471 Bacteria 18293
44 Ga0070698_100060915 3300005471 Bacteria 3807
45 Ga0070698_100164547 3300005471 Bacteria 2161
46 Ga0070699_100000084 3300005518 Bacteria 89070
47 Ga0070699_100000087 3300005518 Bacteria 88377
48 Ga0070699_100000877 3300005518 Bacteria 27967
49 Ga0070699_100002109 3300005518 Bacteria 18029
50 Ga0070699_100004742 3300005518 Bacteria 12016
51 Ga0070684_100030341 3300005535 Bacteria 4592
52 Ga0070697_100000007 3300005536 Bacteria 197603
53 Ga0070697_100001457 3300005536 Bacteria 18017
54 Ga0070697_100003645 3300005536 Bacteria 11837
55 Ga0070697_100010198 3300005536 Bacteria 7327
56 Ga0070697_100026410 3300005536 Bacteria 4638
57 Ga0070697_100056652 3300005536 Bacteria 3188
58 Ga0070697_100073862 3300005536 Bacteria 2801
59 Ga0070697_100092478 3300005536 Bacteria 2503
60 Ga0070697_100114339 3300005536 Bacteria 2252
61 Ga0070695_100011657 3300005545 Bacteria 5260
62 Ga0070695_100027093 3300005545 Bacteria 3548
63 Ga0070696_100026890 3300005546 Unclassified 3916
64 Ga0070696_100030078 3300005546 Bacteria 3716
65 Ga0070693_100055265 3300005547 Bacteria 2287
66 Ga0070665_100038395 3300005548 Bacteria 4814
67 Ga0070704_100046432 3300005549 Bacteria 3028
68 Ga0070704_100093775 3300005549 Bacteria 2244
69 Ga0070704_100101430 3300005549 Unclassified 2170
70 Ga0068861_100004758 3300005719 Bacteria 9127
71 Ga0068861_100070480 3300005719 Bacteria 2707
72 Ga0068860_100022146 3300005843 Bacteria 6152
73 Ga0081455_10043422 3300005937 Bacteria 3932
74 Ga0081455_10055256 3300005937 Bacteria 3378
75 Ga0081455_10118400 3300005937 Bacteria 2091
76 Ga0081538_10005429 3300005981 Bacteria 11446
77 Ga0081538_10008117 3300005981 Bacteria 8961
78 Ga0081538_10075224 3300005981 Bacteria 1834
79 Ga0081539_10003699 3300005985 Bacteria 18239
80 Ga0081539_10005576 3300005985 Bacteria 12726
81 Ga0081539_10010361 3300005985 Bacteria 7586
82 Ga0081539_10020932 3300005985 Bacteria 4393
83 Ga0075432_10004731 3300006058 Bacteria 4635
84 Ga0075369_10008424 3300006186 Bacteria 3966
85 Ga0075427_10001153 3300006194 Bacteria 3347
86 Ga0075427_10002270 3300006194 Unclassified 2563
87 Ga0075428_100017961 3300006844 Bacteria 7816
88 Ga0075430_100000732 3300006846 Bacteria 25147
89 Ga0075430_100111783 3300006846 Bacteria 2278
90 Ga0075431_100004312 3300006847 Bacteria 13938
91 Ga0075431_100010500 3300006847 Bacteria 9310
92 Ga0075431_100102525 3300006847 Bacteria 2953
93 Ga0075433_10011817 3300006852 Bacteria 7032
94 Ga0075433_10035425 3300006852 Bacteria 4292
95 Ga0075433_10059201 3300006852 Bacteria 3351
96 Ga0075433_10088405 3300006852 Bacteria 2738
97 Ga0075434_100013596 3300006871 Bacteria 7755
98 Ga0075434_100053489 3300006871 Bacteria 4011
99 Ga0075434_100063219 3300006871 Bacteria 3684
100 Ga0075434_100075750 3300006871 Bacteria 3359
101 Ga0075434_100114967 3300006871 Bacteria 2703
102 Ga0075434_100154161 3300006871 Bacteria 2317
103 Ga0075429_100009337 3300006880 Bacteria 8517
104 Ga0075429_100036978 3300006880 Bacteria 4249
105 Ga0075429_100045300 3300006880 Bacteria 3826
106 Ga0075429_100051733 3300006880 Unclassified 3573
107 Ga0075436_100005578 3300006914 Bacteria 8638
108 Ga0075436_100008016 3300006914 Bacteria 7231
109 Ga0075435_100002761 3300007076 Bacteria 11727
110 Ga0075435_100016615 3300007076 Bacteria 5550
111 Ga0075435_100020519 3300007076 Bacteria 5065
112 Ga0099794_10031490 3300007265 Bacteria 2484
113 Ga0105251_10000072 3300009011 Bacteria 97611
114 Ga0105251_10001706 3300009011 Bacteria 18392
115 Ga0105240_10165735 3300009093 Bacteria 2621
116 Ga0111539_10000600 3300009094 Bacteria 46579
117 Ga0111539_10017567 3300009094 Bacteria 8853
118 Ga0105245_10017716 3300009098 Bacteria 6217
119 Ga0105247_10037650 3300009101 Unclassified 2951
120 Ga0114129_10002269 3300009147 Bacteria 26610
121 Ga0114129_10002631 3300009147 Bacteria 24980
122 Ga0114129_10046098 3300009147 Bacteria 6128
123 Ga0114129_10078120 3300009147 Bacteria 4604
124 Ga0114129_10107120 3300009147 Bacteria 3861
125 Ga0105243_10080039 3300009148 Unclassified 2664
126 Ga0105243_10105216 3300009148 Bacteria 2350
127 Ga0105243_10128502 3300009148 Bacteria 2147
128 Ga0105237_10028222 3300009545 Bacteria 5719
129 Ga0105238_10029239 3300009551 Bacteria 5615
130 Ga0105249_10049906 3300009553 Bacteria 3816
131 Ga0105249_10060556 3300009553 Bacteria 3473
132 Ga0105249_10095325 3300009553 Unclassified 2790
133 Ga0157374_10039641 3300013296 Bacteria 4335
134 Ga0157378_10212895 3300013297 Bacteria 1833
135 Ga0163162_10001279 3300013306 Bacteria 23543
136 Ga0163162_10035817 3300013306 Bacteria 4944
137 Ga0157375_10014784 3300013308 Bacteria 6973
138 Ga0163163_10033770 3300014325 Bacteria 4951
139 Ga0182008_10027850 3300014497 Bacteria 2860
140 Ga0157379_10040325 3300014968 Bacteria 4167
141 Ga0182007_10000922 3300015262 Bacteria 16257
142 Ga0163161_10094221 3300017792 Bacteria 2220
143 Ga0209758_1000033 3300025297 Bacteria 469998
144 Ga0207713_1000651 3300025735 Bacteria 33250
145 Ga0207713_1002779 3300025735 Bacteria 12367
146 Ga0207653_10001363 3300025885 Bacteria 7963
147 Ga0207653_10007827 3300025885 Bacteria 3333
148 Ga0207647_10011214 3300025904 Bacteria 6294
149 Ga0207647_10012135 3300025904 Bacteria 6012
150 Ga0207684_10000005 3300025910 Bacteria 736617
151 Ga0207684_10000014 3300025910 Bacteria 440027
152 Ga0207684_10000034 3300025910 Bacteria 291009
153 Ga0207684_10000035 3300025910 Bacteria 289353
154 Ga0207684_10000183 3300025910 Bacteria 100388
155 Ga0207684_10000741 3300025910 Bacteria 38273
156 Ga0207684_10067362 3300025910 Bacteria 3043
157 Ga0207684_10073181 3300025910 Bacteria 2910
158 Ga0207684_10110066 3300025910 Bacteria 2358
159 Ga0207684_10120565 3300025910 Bacteria 2249
160 Ga0207684_10125368 3300025910 Bacteria 2203
161 Ga0207671_10016856 3300025914 Bacteria 5659
162 Ga0207662_10078961 3300025918 Bacteria 2004
163 Ga0207646_10000018 3300025922 Bacteria 291009
164 Ga0207646_10000435 3300025922 Bacteria 55844
165 Ga0207646_10001367 3300025922 Bacteria 30219
166 Ga0207646_10008342 3300025922 Bacteria 10395
167 Ga0207646_10010941 3300025922 Bacteria 8811
168 Ga0207646_10014396 3300025922 Bacteria 7513
169 Ga0207646_10032974 3300025922 Bacteria 4685
170 Ga0207646_10044548 3300025922 Bacteria 3982
171 Ga0207646_10128547 3300025922 Bacteria 2279
172 Ga0207694_10046786 3300025924 Bacteria 3345
173 Ga0207687_10048755 3300025927 Bacteria 2943
174 Ga0207687_10062552 3300025927 Archaea 2632
175 Ga0207664_10074691 3300025929 Bacteria 2740
176 Ga0207706_10014580 3300025933 Bacteria 7118
177 Ga0207704_10078467 3300025938 Bacteria 2124
178 Ga0207711_10138745 3300025941 Bacteria 2186
179 Ga0207689_10079249 3300025942 Unclassified 2700
180 Ga0207668_10045968 3300025972 Bacteria 2980
181 Ga0207678_10039078 3300026067 Bacteria 4119
182 Ga0207678_10178279 3300026067 Bacteria 1814
183 Ga0207675_100012277 3300026118 Bacteria 8002
184 Ga0207675_100098513 3300026118 Bacteria 2753
185 Ga0207428_10000630 3300027907 Bacteria 41466
186 Ga0207428_10000874 3300027907 Bacteria 33852
187 Ga0268266_10026563 3300028379 Bacteria 4927
188 Ga0265318_10003704 3300028577 Bacteria 7630
189 Ga0307405_10018903 3300031731 Bacteria 3813
190 Ga0307405_10021154 3300031731 Bacteria 3652
191 Ga0307413_10038745 3300031824 Bacteria 2765
192 Ga0307413_10054781 3300031824 Bacteria 2422
193 Ga0307413_10079197 3300031824 Bacteria 2099
194 Ga0307410_10006469 3300031852 Bacteria 6327
195 Ga0307410_10032156 3300031852 Bacteria 3373
196 Ga0307406_10004198 3300031901 Bacteria 7842
197 Ga0307406_10006762 3300031901 Bacteria 6342
198 Ga0307406_10076094 3300031901 Bacteria 2216
199 Ga0307407_10000616 3300031903 Bacteria 11349
200 Ga0307412_10032944 3300031911 Bacteria 3288
201 Ga0307409_100005913 3300031995 Bacteria 7112
202 Ga0307409_100015681 3300031995 Bacteria 4982
203 Ga0307409_100021278 3300031995 Bacteria 4443
204 Ga0307416_100001809 3300032002 Bacteria 11879
205 Ga0307416_100004859 3300032002 Bacteria 8178
206 Ga0307416_100066089 3300032002 Bacteria 2975
207 Ga0307411_10051848 3300032005 Bacteria 2679
208 Ga0307411_10119571 3300032005 Bacteria 1903
209 Ga0307415_100007364 3300032126 Bacteria 6016
210 Ga0316593_10015382 3300032168 Bacteria 2301
211 Ga0316586_1006112 3300033527 Bacteria 1721
212 Ga0316588_1014313 3300033528 Bacteria 1734
213 Ga0316588_1014863 3300033528 Bacteria 1710
214 Ga0373923_0026620 3300035111 Bacteria 2302
215 Ga0373956_0025799 3300035119 Bacteria 2542
216 Ga0316574_0067970 3300035398 Bacteria 2247
217 Ga0373927_0052157 3300035695 Bacteria 2646
218 Ga0373933_0049705 3300035724 Bacteria 2501
219 Ga0373947_0017215 3300035725 Bacteria 4157
220 Ga0373937_0006847 3300036401 Bacteria 9836
221 Ga0373937_0097224 3300036401 Bacteria 2731
222 Ga0373925_0054962 3300037068 Bacteria 2979
223 Ga0373925_0132851 3300037068 Unclassified 1942
224 Ga0395905_0084393 3300037471 Bacteria 2976
225 Ga0395901_0021846 3300038443 Bacteria 6558
226 Ga0400483_182912 3300039062 Bacteria 2291
227 Ga0400489_69181 3300039093 Bacteria 15939
228 Ga0400489_89995 3300039093 Bacteria 10184
229 Ga0450910_005454 3300042147 Unclassified 1735
230 Ga0453684_0277634 3300044712 Bacteria 1912
231 Ga0451576_0024613 3300045051 Bacteria 6501
232 Ga0495590_0000522 3300046457 Bacteria 18540
233 Ga0495629_0000184 3300046459 Bacteria 56265
234 Ga0495629_0025417 3300046459 Bacteria 4208
235 Ga0495638_0008649 3300046460 Bacteria 7200
236 Ga0495641_0011460 3300046461 Bacteria 5049
237 Ga0495651_0054916 3300046462 Bacteria 3061
238 Ga0495651_0110968 3300046462 Bacteria 2028
239 Ga0495653_0000402 3300046463 Bacteria 34782
240 Ga0495653_0009764 3300046463 Bacteria 7846
241 Ga0495650_0000155 3300046471 Bacteria 155947
242 Ga0495580_0001100 3300046472 Bacteria 23724
243 Ga0495582_0004584 3300046473 Bacteria 7763
244 Ga0495582_0034414 3300046473 Bacteria 2784
245 Ga0495605_0005428 3300046474 Bacteria 7424
246 Ga0495662_0007105 3300046476 Bacteria 5555
247 Ga0495664_0002247 3300046477 Bacteria 10351
248 Ga0495664_0034165 3300046477 Bacteria 2990
249 Ga0495607_0028017 3300046501 Bacteria 3479
250 Ga0495606_0003521 3300046507 Bacteria 16538
251 Ga0495618_0005162 3300046514 Bacteria 7982
252 Ga0495628_0017130 3300046516 Bacteria 6036
253 Ga0495630_0000603 3300046517 Bacteria 26089
254 Ga0495630_0047056 3300046517 Bacteria 3226
255 Ga0495630_0060638 3300046517 Bacteria 2840
256 Ga0495630_0081284 3300046517 Bacteria 2445
257 Ga0495666_0000064 3300046526 Bacteria 40955
258 Ga0495642_0018034 3300046528 Bacteria 2760
259 Ga0495642_0019326 3300046528 Bacteria 2670
260 Ga0495652_0009733 3300046529 Bacteria 8718
261 Ga0495652_0040306 3300046529 Bacteria 4036
262 Ga0495665_0000096 3300046531 Bacteria 40491
263 Ga0495665_0002840 3300046531 Bacteria 9354
264 Ga0495640_0001956 3300046533 Bacteria 16435
265 Ga0495586_0000314 3300046535 Bacteria 30664
266 Ga0495587_0004876 3300046536 Bacteria 8804
267 Ga0495645_0000102 3300046543 Bacteria 59126
268 Ga0495645_0005993 3300046543 Bacteria 8406
269 Ga0495656_0002443 3300046615 Bacteria 6177
270 Ga0495634_0020961 3300046642 Bacteria 4629
271 Ga0495635_0004529 3300046663 Bacteria 9633
272 Ga0495635_0007191 3300046663 Bacteria 7775
273 Ga0495661_0004510 3300046665 Bacteria 10032
274 Ga0495599_0000578 3300046678 Bacteria 20921
275 Ga0495623_0025415 3300046679 Bacteria 3815
276 Ga0495623_0027175 3300046679 Bacteria 3679
277 Ga0495646_0032028 3300046680 Bacteria 3273
278 Ga0495646_0032261 3300046680 Bacteria 3260
279 Ga0495669_0006297 3300046684 Bacteria 4955
280 Ga0495669_0013076 3300046684 Bacteria 3535
281 Ga0495613_0017023 3300046689 Bacteria 5411
282 Ga0495613_0023652 3300046689 Bacteria 4579
283 Ga0495624_0011389 3300046690 Bacteria 6111
284 Ga0495624_0013313 3300046690 Bacteria 5609
285 Ga0495624_0015532 3300046690 Bacteria 5138
286 Ga0495624_0069815 3300046690 Bacteria 2188
287 Ga0495671_0051773 3300046692 Bacteria 2042
288 Ga0495649_0002250 3300046694 Bacteria 13705
289 Ga0495589_0006379 3300046794 Bacteria 6232
290 Ga0495589_0011704 3300046794 Bacteria 4554
291 Ga0495600_0025937 3300046809 Bacteria 3780
292 Ga0495581_0000479 3300047315 Bacteria 20370
293 Ga0495581_0020341 3300047315 Bacteria 3852
294 Ga0495604_0000954 3300047317 Bacteria 24110
295 Ga0495604_0004914 3300047317 Bacteria 10598
296 Ga0495636_0053560 3300047318 Bacteria 1694
297 Ga0495674_0028622 3300047319 Bacteria 5077
298 Ga0495674_0029567 3300047319 Bacteria 4988
299 Ga0495674_0073918 3300047319 Bacteria 2936
300 Ga0495672_0004363 3300047320 Bacteria 11621
301 Ga0495672_0037670 3300047320 Bacteria 2957
302 Ga0495676_0029101 3300047321 Bacteria 4706
303 Ga0495680_0023820 3300047322 Bacteria 5086
304 Ga0495675_0002641 3300047444 Bacteria 10742
305 Ga0495677_0020824 3300047445 Bacteria 2376
306 Ga0495679_000619 3300047446 Bacteria 23978
307 Ga0495679_020573 3300047446 Bacteria 2296
308 Ga0495684_0003315 3300047471 Bacteria 12638
309 Ga0495593_0005956 3300047673 Bacteria 7182
310 Ga0495602_0006713 3300048088 Bacteria 12071
311 Ga0495602_0119228 3300048088 Bacteria 2126
312 Ga0495614_0000793 3300048089 Bacteria 13381
313 Ga0496100_0004560 3300048903 Bacteria 7361
314 Ga0496100_0028700 3300048903 Bacteria 3434
315 Ga0496101_0003250 3300048904 Bacteria 10093
316 Ga0496101_0183825 3300048904 Bacteria 1611
317 Ga0496102_0008000 3300048905 Bacteria 9035
318 Ga0496102_0183136 3300048905 Bacteria 1973
319 Ga0496103_0006156 3300048906 Bacteria 7170
320 Ga0496103_0109033 3300048906 Bacteria 1757
321 Ga0496105_0095067 3300048908 Bacteria 2461
322 Ga0496106_0013662 3300048909 Bacteria 5995
323 Ga0496106_0044310 3300048909 Bacteria 3339
324 Ga0496106_0045046 3300048909 Bacteria 3313
325 Ga0496107_0019283 3300048910 Bacteria 4812
326 Ga0496107_0034824 3300048910 Bacteria 3608
327 Ga0496108_0000076 3300048911 Bacteria 105286
328 Ga0496108_0018302 3300048911 Bacteria 5736
329 Ga0496108_0068951 3300048911 Bacteria 2984
330 Ga0496109_0027800 3300048912 Bacteria 5054
331 Ga0496109_0153704 3300048912 Bacteria 2155
332 Ga0496110_0012725 3300048913 Bacteria 6926
333 Ga0496110_0061089 3300048913 Bacteria 3325
334 Ga0496111_0009186 3300048914 Bacteria 6583
335 Ga0496112_0003027 3300048915 Bacteria 13744
336 Ga0496113_0009247 3300048916 Bacteria 6466
337 Ga0496113_0016943 3300048916 Bacteria 5044
338 Ga0496113_0019343 3300048916 Bacteria 4761
339 Ga0496114_0001973 3300048917 Bacteria 15587
340 Ga0496116_0005262 3300048919 Bacteria 12088
341 Ga0496116_0057635 3300048919 Bacteria 2538
342 Ga0496117_0011286 3300048920 Bacteria 8012
343 Ga0496117_0018697 3300048920 Bacteria 5726
344 Ga0496117_0048610 3300048920 Bacteria 3027
345 Ga0496118_0027956 3300048921 Bacteria 4762
346 Ga0496118_0028206 3300048921 Bacteria 4735
347 Ga0496121_0076631 3300048924 Bacteria 2666
348 Ga0496122_0002609 3300048925 Bacteria 25235
349 Ga0496124_0037404 3300048927 Bacteria 4221
350 Ga0496126_0000679 3300048929 Bacteria 62626
351 Ga0501033_0060593 3300049570 Bacteria 2791
352 Ga0501034_0008006 3300049571 Bacteria 11217
353 Ga0501034_0106153 3300049571 Bacteria 2801
354 Ga0501036_0003487 3300049572 Bacteria 12574
355 Ga0501037_0007986 3300049573 Bacteria 7755
356 Ga0501038_0035862 3300049574 Bacteria 4353
357 Ga0501038_0086618 3300049574 Bacteria 2631
358 Ga0501039_0010666 3300049575 Bacteria 7001
359 Ga0501039_0037802 3300049575 Bacteria 3727
360 Ga0501040_0000175 3300049576 Bacteria 36317
361 Ga0501041_0000495 3300049577 Bacteria 20213
362 Ga0501043_0009295 3300049579 Bacteria 7724
363 Ga0501046_0001719 3300049580 Bacteria 20894
364 Ga0501047_0113374 3300049581 Bacteria 2593
365 Ga0501048_0000979 3300049582 Bacteria 21153
366 Ga0501069_0026293 3300049585 Bacteria 3187
367 Ga0501070_0123988 3300049586 Bacteria 2135
368 Ga0501072_0002261 3300049588 Bacteria 14390
369 Ga0501074_0000618 3300049590 Bacteria 22144
370 Ga0501075_0006094 3300049591 Bacteria 8279
371 Ga0501077_0011214 3300049593 Bacteria 5592
372 Ga0501079_0000250 3300049741 Bacteria 32653
373 Ga0501080_0012015 3300049742 Bacteria 7929
374 Ga0501080_0051378 3300049742 Bacteria 3836
375 Ga0501080_0055591 3300049742 Bacteria 3687
376 Ga0501080_0079032 3300049742 Bacteria 3058
377 Ga0501081_0000397 3300049743 Bacteria 23982
378 Ga0501044_0013850 3300049823 Bacteria 8716
379 Ga0501044_0074039 3300049823 Bacteria 3461
380 Ga0501044_0128629 3300049823 Bacteria 2528
381 Ga0501045_0018347 3300049824 Bacteria 4976
382 nmdc:mga05p37_103561_c1 3300050507 Unclassified 3503
383 nmdc:mga05p37_124367_c1 3300050507 Bacteria 3168
384 nmdc:mga05p37_2680_c1 3300050507 Bacteria 20724
385 nmdc:mga05p37_273288_c1 3300050507 Bacteria 2018
386 nmdc:mga05p37_43681_c1 3300050507 Bacteria 5514
387 nmdc:mga05p37_51446_c1 3300050507 Bacteria 5066
388 nmdc:mga05p37_5339_c1 3300050507 Bacteria 15091
389 nmdc:mga05p37_67400_c1 3300050507 Bacteria 4403
390 nmdc:mga09592_30591_c1 3300050508 Unclassified 2216
391 nmdc:mga09592_6044_c1 3300050508 Bacteria 9874
392 nmdc:mga0qj67_1327_c1 3300050509 Bacteria 17394
393 nmdc:mga0qj67_96350_c1 3300050509 Bacteria 2382
394 nmdc:mga06r32_1471_c1 3300050510 Bacteria 21194
395 nmdc:mga06r32_14827_c1 3300050510 Bacteria 7071
396 nmdc:mga06r32_47732_c1 3300050510 Bacteria 4091
397 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
398 nmdc:mga08y16_2151_c1 3300050511 Bacteria 20215
399 nmdc:mga0n895_144067_c1 3300050512 Bacteria 2412
400 nmdc:mga0n895_29147_c1 3300050512 Bacteria 5260
401 nmdc:mga0n895_4901_c1 3300050512 Bacteria 11092
402 nmdc:mga0n895_75940_c1 3300050512 Bacteria 3341
403 nmdc:mga0n895_97696_c1 3300050512 Bacteria 2943
404 nmdc:mga0rr50_16040_c1 3300050513 Bacteria 4963
405 nmdc:mga0rr50_5449_c1 3300050513 Bacteria 7592
406 nmdc:mga08x19_7759_c1 3300050514 Bacteria 6375
407 nmdc:mga0a205_160872_c1 3300050515 Bacteria 2142
408 nmdc:mga0a205_174448_c1 3300050515 Bacteria 2045
409 nmdc:mga0a205_4813_c1 3300050515 Bacteria 12137
410 nmdc:mga0a205_9924_c1 3300050515 Bacteria 8732
411 Ga0495612_0000082 3300053078 Bacteria 42620
412 Ga0495619_0121513 3300053085 Unclassified 1791
413 Ga0500628_008592 3300053129 Bacteria 1782
414 Ga0500609_000155 3300053731 Bacteria 9375
415 Ga0501084_0020242 3300054114 Bacteria 5547
416 Ga0501082_0006200 3300060353 Bacteria 10377
417 Ga0530510_0002682 3300061734 Bacteria 12229
418 Ga0530510_0013568 3300061734 Bacteria 5731
419 2509139921 2508501127 Bacteria 7037543
420 2597812608 2597489875 Bacteria 7010078
421 2819620571 2818991450 Bacteria 6962147
422 2841738601 2841734538 Bacteria 6784580
423 2871479076 2871474448 Bacteria 6806570
424 2878793010 2878788777 Bacteria 6567085
425 2896388766 2896384573 Bacteria 7700774
426 2909046395 2909042592 Bacteria 6499737
427 2924755184 2924754689 Bacteria 6774424
428 2928108830 2928108538 Bacteria 7360024
429 2928136054 2928135762 Bacteria 7259641
430 2928504166 2928503688 Bacteria 7268108
431 2937841883 2937836603 Bacteria 6811263
432 2958077776 2958071322 Bacteria 6815895
433 2970547877 2970540015 Bacteria 6977556
434 8004399967 8004395343 Bacteria 6620908
435 8004638367 8004633249 Bacteria 6723080
436 8055620232 8055617313 Bacteria 7548464
437 nmdc:mga0n895_215044_c1
438 JGI24735J21928_10004231
439 JGI25406J46586_10007689
440 JGI25406J46586_10034401
441 JGI25153J46596_10000010
442 Ga0070690_100139061
443 Ga0070692_10004445
444 Ga0070668_100050819
445 Ga0070674_100006880
446 Ga0070703_10001827
447 Ga0070703_10002732
448 Ga0070714_100077424
449 Ga0070705_100003101
450 Ga0070705_100023694
451 Ga0070694_100012233
452 Ga0070694_100086944
453 Ga0070708_100000008
454 Ga0070708_100015657
455 Ga0070708_100043973
456 Ga0070708_100046129
457 Ga0070708_100095888
458 Ga0070708_100130303
459 Ga0070708_100138036
460 Ga0070663_100058532
461 Ga0070663_100133629
462 Ga0070662_100011720
463 Ga0070706_100000160
464 Ga0070706_100000372
465 Ga0070706_100000396
466 Ga0070706_100005357
467 Ga0070706_100015374
468 Ga0070706_100029323
469 Ga0070706_100079243
470 Ga0070706_100124601
471 Ga0070707_100000004
472 Ga0070707_100003116
473 Ga0070707_100009054
474 Ga0070707_100016110
475 Ga0070707_100022604
476 Ga0070707_100040418
477 Ga0070707_100065128
478 Ga0070698_100002382
479 Ga0070698_100003112
480 Ga0070698_100060915
481 Ga0070698_100164547
482 Ga0070699_100000084
483 Ga0070699_100000087
484 Ga0070699_100000877
485 Ga0070699_100002109
486 Ga0070699_100004742
487 Ga0070684_100030341
488 Ga0070697_100000007
489 Ga0070697_100001457
490 Ga0070697_100003645
491 Ga0070697_100010198
492 Ga0070697_100026410
493 Ga0070697_100056652
494 Ga0070697_100073862
495 Ga0070697_100092478
496 Ga0070697_100114339
497 Ga0070695_100011657
498 Ga0070695_100027093
499 Ga0070696_100026890
500 Ga0070696_100030078
501 Ga0070693_100055265
502 Ga0070665_100038395
503 Ga0070704_100046432
504 Ga0070704_100093775
505 Ga0070704_100101430
506 Ga0068861_100004758
507 Ga0068861_100070480
508 Ga0068860_100022146
509 Ga0081455_10043422
510 Ga0081455_10055256
511 Ga0081455_10118400
512 Ga0081538_10005429
513 Ga0081538_10008117
514 Ga0081538_10075224
515 Ga0081539_10003699
516 Ga0081539_10005576
517 Ga0081539_10010361
518 Ga0081539_10020932
519 Ga0075432_10004731
520 Ga0075369_10008424
521 Ga0075427_10001153
522 Ga0075427_10002270
523 Ga0075428_100017961
524 Ga0075430_100000732
525 Ga0075430_100111783
526 Ga0075431_100004312
527 Ga0075431_100010500
528 Ga0075431_100102525
529 Ga0075433_10011817
530 Ga0075433_10035425
531 Ga0075433_10059201
532 Ga0075433_10088405
533 Ga0075434_100013596
534 Ga0075434_100053489
535 Ga0075434_100063219
536 Ga0075434_100075750
537 Ga0075434_100114967
538 Ga0075434_100154161
539 Ga0075429_100009337
540 Ga0075429_100036978
541 Ga0075429_100045300
542 Ga0075429_100051733
543 Ga0075436_100005578
544 Ga0075436_100008016
545 Ga0075435_100002761
546 Ga0075435_100016615
547 Ga0075435_100020519
548 Ga0099794_10031490
549 Ga0105251_10000072
550 Ga0105251_10001706
551 Ga0105240_10165735
552 Ga0111539_10000600
553 Ga0111539_10017567
554 Ga0105245_10017716
555 Ga0105247_10037650
556 Ga0114129_10002269
557 Ga0114129_10002631
558 Ga0114129_10046098
559 Ga0114129_10078120
560 Ga0114129_10107120
561 Ga0105243_10080039
562 Ga0105243_10105216
563 Ga0105243_10128502
564 Ga0105237_10028222
565 Ga0105238_10029239
566 Ga0105249_10049906
567 Ga0105249_10060556
568 Ga0105249_10095325
569 Ga0157374_10039641
570 Ga0157378_10212895
571 Ga0163162_10001279
572 Ga0163162_10035817
573 Ga0157375_10014784
574 Ga0163163_10033770
575 Ga0182008_10027850
576 Ga0157379_10040325
577 Ga0182007_10000922
578 Ga0163161_10094221
579 Ga0209758_1000033
580 Ga0207713_1000651
581 Ga0207713_1002779
582 Ga0207653_10001363
583 Ga0207653_10007827
584 Ga0207647_10011214
585 Ga0207647_10012135
586 Ga0207684_10000005
587 Ga0207684_10000014
588 Ga0207684_10000034
589 Ga0207684_10000035
590 Ga0207684_10000183
591 Ga0207684_10000741
592 Ga0207684_10067362
593 Ga0207684_10073181
594 Ga0207684_10110066
595 Ga0207684_10120565
596 Ga0207684_10125368
597 Ga0207671_10016856
598 Ga0207662_10078961
599 Ga0207646_10000018
600 Ga0207646_10000435
601 Ga0207646_10001367
602 Ga0207646_10008342
603 Ga0207646_10010941
604 Ga0207646_10014396
605 Ga0207646_10032974
606 Ga0207646_10044548
607 Ga0207646_10128547
608 Ga0207694_10046786
609 Ga0207687_10048755
610 Ga0207687_10062552
611 Ga0207664_10074691
612 Ga0207706_10014580
613 Ga0207704_10078467
614 Ga0207711_10138745
615 Ga0207689_10079249
616 Ga0207668_10045968
617 Ga0207678_10039078
618 Ga0207678_10178279
619 Ga0207675_100012277
620 Ga0207675_100098513
621 Ga0207428_10000630
622 Ga0207428_10000874
623 Ga0268266_10026563
624 Ga0265318_10003704
625 Ga0307405_10018903
626 Ga0307405_10021154
627 Ga0307413_10038745
628 Ga0307413_10054781
629 Ga0307413_10079197
630 Ga0307410_10006469
631 Ga0307410_10032156
632 Ga0307406_10004198
633 Ga0307406_10006762
634 Ga0307406_10076094
635 Ga0307407_10000616
636 Ga0307412_10032944
637 Ga0307409_100005913
638 Ga0307409_100015681
639 Ga0307409_100021278
640 Ga0307416_100001809
641 Ga0307416_100004859
642 Ga0307416_100066089
643 Ga0307411_10051848
644 Ga0307411_10119571
645 Ga0307415_100007364
646 Ga0316593_10015382
647 Ga0316586_1006112
648 Ga0316588_1014313
649 Ga0316588_1014863
650 Ga0373923_0026620
651 Ga0373956_0025799
652 Ga0316574_0067970
653 Ga0373927_0052157
654 Ga0373933_0049705
655 Ga0373947_0017215
656 Ga0373937_0006847
657 Ga0373937_0097224
658 Ga0373925_0054962
659 Ga0373925_0132851
660 Ga0395905_0084393
661 Ga0395901_0021846
662 Ga0400483_182912
663 Ga0400489_69181
664 Ga0400489_89995
665 Ga0450910_005454
666 Ga0453684_0277634
667 Ga0451576_0024613
668 Ga0495590_0000522
669 Ga0495629_0000184
670 Ga0495629_0025417
671 Ga0495638_0008649
672 Ga0495641_0011460
673 Ga0495651_0054916
674 Ga0495651_0110968
675 Ga0495653_0000402
676 Ga0495653_0009764
677 Ga0495650_0000155
678 Ga0495580_0001100
679 Ga0495582_0004584
680 Ga0495582_0034414
681 Ga0495605_0005428
682 Ga0495662_0007105
683 Ga0495664_0002247
684 Ga0495664_0034165
685 Ga0495607_0028017
686 Ga0495606_0003521
687 Ga0495618_0005162
688 Ga0495628_0017130
689 Ga0495630_0000603
690 Ga0495630_0047056
691 Ga0495630_0060638
692 Ga0495630_0081284
693 Ga0495666_0000064
694 Ga0495642_0018034
695 Ga0495642_0019326
696 Ga0495652_0009733
697 Ga0495652_0040306
698 Ga0495665_0000096
699 Ga0495665_0002840
700 Ga0495640_0001956
701 Ga0495586_0000314
702 Ga0495587_0004876
703 Ga0495645_0000102
704 Ga0495645_0005993
705 Ga0495656_0002443
706 Ga0495634_0020961
707 Ga0495635_0004529
708 Ga0495635_0007191
709 Ga0495661_0004510
710 Ga0495599_0000578
711 Ga0495623_0025415
712 Ga0495623_0027175
713 Ga0495646_0032028
714 Ga0495646_0032261
715 Ga0495669_0006297
716 Ga0495669_0013076
717 Ga0495613_0017023
718 Ga0495613_0023652
719 Ga0495624_0011389
720 Ga0495624_0013313
721 Ga0495624_0015532
722 Ga0495624_0069815
723 Ga0495671_0051773
724 Ga0495649_0002250
725 Ga0495589_0006379
726 Ga0495589_0011704
727 Ga0495600_0025937
728 Ga0495581_0000479
729 Ga0495581_0020341
730 Ga0495604_0000954
731 Ga0495604_0004914
732 Ga0495636_0053560
733 Ga0495674_0028622
734 Ga0495674_0029567
735 Ga0495674_0073918
736 Ga0495672_0004363
737 Ga0495672_0037670
738 Ga0495676_0029101
739 Ga0495680_0023820
740 Ga0495675_0002641
741 Ga0495677_0020824
742 Ga0495679_000619
743 Ga0495679_020573
744 Ga0495684_0003315
745 Ga0495593_0005956
746 Ga0495602_0006713
747 Ga0495602_0119228
748 Ga0495614_0000793
749 Ga0496100_0004560
750 Ga0496100_0028700
751 Ga0496101_0003250
752 Ga0496101_0183825
753 Ga0496102_0008000
754 Ga0496102_0183136
755 Ga0496103_0006156
756 Ga0496103_0109033
757 Ga0496105_0095067
758 Ga0496106_0013662
759 Ga0496106_0044310
760 Ga0496106_0045046
761 Ga0496107_0019283
762 Ga0496107_0034824
763 Ga0496108_0000076
764 Ga0496108_0018302
765 Ga0496108_0068951
766 Ga0496109_0027800
767 Ga0496109_0153704
768 Ga0496110_0012725
769 Ga0496110_0061089
770 Ga0496111_0009186
771 Ga0496112_0003027
772 Ga0496113_0009247
773 Ga0496113_0016943
774 Ga0496113_0019343
775 Ga0496114_0001973
776 Ga0496116_0005262
777 Ga0496116_0057635
778 Ga0496117_0011286
779 Ga0496117_0018697
780 Ga0496117_0048610
781 Ga0496118_0027956
782 Ga0496118_0028206
783 Ga0496121_0076631
784 Ga0496122_0002609
785 Ga0496124_0037404
786 Ga0496126_0000679
787 Ga0501033_0060593
788 Ga0501034_0008006
789 Ga0501034_0106153
790 Ga0501036_0003487
791 Ga0501037_0007986
792 Ga0501038_0035862
793 Ga0501038_0086618
794 Ga0501039_0010666
795 Ga0501039_0037802
796 Ga0501040_0000175
797 Ga0501041_0000495
798 Ga0501043_0009295
799 Ga0501046_0001719
800 Ga0501047_0113374
801 Ga0501048_0000979
802 Ga0501069_0026293
803 Ga0501070_0123988
804 Ga0501072_0002261
805 Ga0501074_0000618
806 Ga0501075_0006094
807 Ga0501077_0011214
808 Ga0501079_0000250
809 Ga0501080_0012015
810 Ga0501080_0051378
811 Ga0501080_0055591
812 Ga0501080_0079032
813 Ga0501081_0000397
814 Ga0501044_0013850
815 Ga0501044_0074039
816 Ga0501044_0128629
817 Ga0501045_0018347
818 nmdc:mga05p37_103561_c1
819 nmdc:mga05p37_124367_c1
820 nmdc:mga05p37_2680_c1
821 nmdc:mga05p37_273288_c1
822 nmdc:mga05p37_43681_c1
823 nmdc:mga05p37_51446_c1
824 nmdc:mga05p37_5339_c1
825 nmdc:mga05p37_67400_c1
826 nmdc:mga09592_30591_c1
827 nmdc:mga09592_6044_c1
828 nmdc:mga0qj67_1327_c1
829 nmdc:mga0qj67_96350_c1
830 nmdc:mga06r32_1471_c1
831 nmdc:mga06r32_14827_c1
832 nmdc:mga06r32_47732_c1
833 nmdc:mga08y16_16_c1
834 nmdc:mga08y16_2151_c1
835 nmdc:mga0n895_144067_c1
836 nmdc:mga0n895_29147_c1
837 nmdc:mga0n895_4901_c1
838 nmdc:mga0n895_75940_c1
839 nmdc:mga0n895_97696_c1
840 nmdc:mga0rr50_16040_c1
841 nmdc:mga0rr50_5449_c1
842 nmdc:mga08x19_7759_c1
843 nmdc:mga0a205_160872_c1
844 nmdc:mga0a205_174448_c1
845 nmdc:mga0a205_4813_c1
846 nmdc:mga0a205_9924_c1
847 Ga0495612_0000082
848 Ga0495619_0121513
849 Ga0500628_008592
850 Ga0500609_000155
851 Ga0501084_0020242
852 Ga0501082_0006200
853 Ga0530510_0002682
854 Ga0530510_0013568
855 2509139921
856 2597812608
857 2819620571
858 2841738601
859 2871479076
860 2878793010
861 2896388766
862 2909046395
863 2924755184
864 2928108830
865 2928136054
866 2928504166
867 2937841883
868 2958077776
869 2970547877
870 8004399967
871 8004638367
872 8055620232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

80

415

0.92

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

89

439

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iai-assembly1.cif.gz_A crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol 0.8671 30 467
5iai-assembly1.cif.gz_A crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol 0.8487 30 467
7yzu-assembly1.cif.gz_A crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme 0.8318 35 472
7yzu-assembly1.cif.gz_A crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme 0.8258 35 472
7qhv-assembly1.cif.gz_AAA crystal structure of the sulfoquinovosyl binding protein smof complexed with sulfoquinovosyl diacylglycerol 0.8246 33 468
ID Description Score Start End Superfamily
3uorB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9185 33 149 3.40.190.10
5ysdB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9081 34 149 3.40.190.10
5iaiA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8858 30 149 3.40.190.10
3k02A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8673 34 149 3.40.190.10
2ghaA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8662 33 149 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2M8Q969-F1-model_v4 ABC transporter substrate-binding protein 0.9424 196 475
AF-A0A846G7J1-F1-model_v4 Extracellular solute-binding protein 0.9389 1 476 GO:0030313
AF-A0A536NEC2-F1-model_v4 Extracellular solute-binding protein 0.9373 1 475 GO:0030313
AF-A0A536EWA8-F1-model_v4 Extracellular solute-binding protein 0.9309 1 427 GO:0030313
AF-X1MIQ8-F1-model_v4 Uncharacterized protein 0.9308 24 132

Map