F443603

General Info

Members Datasets Scaffolds Average Seq Length
436 273 432 118

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0090657|Ga0451791_0090657_102_440
Length 112
Sequence MNDASLAEQLRVLRLETMTAIAQRQGKPAILRLSVEGGGCAGFSYRFGLADEVEADDLVAGQSGVTLVVDPMTHDLVKGGAVDYVESLGGAAFQVRNPNAASGCGCGSSFSV

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
3 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
4 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
182 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
246 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
247 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
248 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
251 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
252 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
253 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
258 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
262 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
267 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
270 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.02
Metatranscriptomes 2.06
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.61
Nodule 0
Rhizoplane 2.06
Rhizosphere 79.36
Stem 0
Stem Tuber 0
Unclassified 5.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000938 3300003187 Bacteria 22546
2 JGI25160J50197_1006381 3300003354 Bacteria 4782
3 Ga0055531_10013026 3300003794 Bacteria 3864
4 Ga0065165_1086731 3300005262 Bacteria 804
5 Ga0070658_10648758 3300005327 Bacteria 916
6 Ga0070683_100716054 3300005329 Bacteria 959
7 Ga0070690_101085792 3300005330 Bacteria 634
8 Ga0070680_100181490 3300005336 Bacteria 1773
9 Ga0068868_100155612 3300005338 Bacteria 1885
10 Ga0068868_101563951 3300005338 Bacteria 619
11 Ga0070692_10859013 3300005345 Bacteria 624
12 Ga0070668_100535991 3300005347 Bacteria 1017
13 Ga0070669_100012775 3300005353 Bacteria 5963
14 Ga0070671_100017490 3300005355 Bacteria 5808
15 Ga0070673_100299655 3300005364 Bacteria 1415
16 Ga0070709_10042623 3300005434 Bacteria 2804
17 Ga0070709_10097951 3300005434 Bacteria 1948
18 Ga0070709_10518973 3300005434 Bacteria 907
19 Ga0070714_100052684 3300005435 Bacteria 3471
20 Ga0070714_100521676 3300005435 Bacteria 1135
21 Ga0070714_100682735 3300005435 Bacteria 990
22 Ga0070714_100847151 3300005435 Bacteria 886
23 Ga0070714_102416186 3300005435 Bacteria 510
24 Ga0070713_100147249 3300005436 Bacteria 2091
25 Ga0070713_100168870 3300005436 Bacteria 1958
26 Ga0070713_100841861 3300005436 Bacteria 880
27 Ga0070713_101704353 3300005436 Unclassified 612
28 Ga0070713_102050708 3300005436 Unclassified 555
29 Ga0070710_10828955 3300005437 Bacteria 663
30 Ga0070711_100048649 3300005439 Bacteria 2901
31 Ga0070711_100158936 3300005439 Bacteria 1711
32 Ga0070711_100277408 3300005439 Bacteria 1325
33 Ga0070700_100618199 3300005441 Bacteria 851
34 Ga0070708_100220155 3300005445 Bacteria 1780
35 Ga0070678_100306599 3300005456 Bacteria 1351
36 Ga0070681_10008045 3300005458 Bacteria 10320
37 Ga0070681_10064639 3300005458 Bacteria 3629
38 Ga0070681_10088517 3300005458 Bacteria 3048
39 Ga0070681_10242483 3300005458 Bacteria 1716
40 Ga0070681_10664733 3300005458 Bacteria 957
41 Ga0070681_11010505 3300005458 Bacteria 751
42 Ga0070707_100004277 3300005468 Bacteria 13376
43 Ga0070707_100622150 3300005468 Bacteria 1042
44 Ga0070707_101888488 3300005468 Bacteria 565
45 Ga0070698_100043988 3300005471 Bacteria 4575
46 Ga0070699_100405313 3300005518 Bacteria 1233
47 Ga0070699_100423688 3300005518 Bacteria 1205
48 Ga0070699_100631527 3300005518 Bacteria 977
49 Ga0070699_100655318 3300005518 Bacteria 958
50 Ga0070679_100261879 3300005530 Bacteria 1684
51 Ga0070684_100936689 3300005535 Bacteria 812
52 Ga0070697_100050209 3300005536 Bacteria 3386
53 Ga0070697_100174206 3300005536 Bacteria 1822
54 Ga0068853_100014295 3300005539 Bacteria 6496
55 Ga0070672_101039124 3300005543 Bacteria 727
56 Ga0070686_100845953 3300005544 Bacteria 741
57 Ga0070695_100480992 3300005545 Bacteria 957
58 Ga0070693_100680530 3300005547 Bacteria 751
59 Ga0070693_100884663 3300005547 Bacteria 668
60 Ga0068855_100559784 3300005563 Bacteria 1237
61 Ga0068855_100661730 3300005563 Bacteria 1121
62 Ga0070664_101345162 3300005564 Bacteria 675
63 Ga0068854_101496359 3300005578 Bacteria 613
64 Ga0068856_100080249 3300005614 Bacteria 3236
65 Ga0068856_101163768 3300005614 Bacteria 788
66 Ga0068852_100667094 3300005616 Bacteria 1048
67 Ga0068859_102258560 3300005617 Bacteria 600
68 Ga0068864_100907585 3300005618 Bacteria 870
69 Ga0068861_100118207 3300005719 Bacteria 2135
70 Ga0068863_100338710 3300005841 Bacteria 1463
71 Ga0068863_101472778 3300005841 Bacteria 689
72 Ga0068860_100696168 3300005843 Bacteria 1026
73 Ga0068860_100766682 3300005843 Bacteria 977
74 Ga0068862_100008974 3300005844 Bacteria 8279
75 Ga0068862_100013738 3300005844 Bacteria 6711
76 Ga0081538_10000854 3300005981 Bacteria 32885
77 Ga0081540_1007828 3300005983 Bacteria 7558
78 Ga0081539_10096023 3300005985 Bacteria 1521
79 Ga0070717_10124166 3300006028 Bacteria 2214
80 Ga0070715_10251032 3300006163 Bacteria 925
81 Ga0070716_100642247 3300006173 Bacteria 804
82 Ga0070716_101607742 3300006173 Bacteria 534
83 Ga0070712_100165307 3300006175 Bacteria 1712
84 Ga0070712_100311448 3300006175 Bacteria 1277
85 Ga0070712_100461705 3300006175 Bacteria 1059
86 Ga0070712_100495779 3300006175 Bacteria 1023
87 Ga0070712_100530763 3300006175 Bacteria 990
88 Ga0070712_100630448 3300006175 Bacteria 909
89 Ga0075366_10420853 3300006195 Bacteria 823
90 Ga0075366_10430971 3300006195 Bacteria 813
91 Ga0097621_100729661 3300006237 Bacteria 914
92 Ga0075428_100066813 3300006844 Bacteria 3937
93 Ga0075431_100501640 3300006847 Bacteria 1205
94 Ga0075433_10353669 3300006852 Bacteria 1298
95 Ga0075434_101462116 3300006871 Bacteria 693
96 Ga0075434_101849478 3300006871 Bacteria 610
97 Ga0075429_101098320 3300006880 Bacteria 695
98 Ga0068865_100300197 3300006881 Bacteria 1285
99 Ga0097620_102259280 3300006931 Bacteria 600
100 Ga0075435_100273003 3300007076 Bacteria 1442
101 Ga0099794_10497631 3300007265 Bacteria 641
102 Ga0099795_10012526 3300007788 Bacteria 2575
103 Ga0099795_10021156 3300007788 Bacteria 2130
104 Ga0099795_10250451 3300007788 Bacteria 764
105 Ga0105240_10154081 3300009093 Bacteria 2735
106 Ga0105240_10371051 3300009093 Bacteria 1618
107 Ga0105240_10752537 3300009093 Bacteria 1059
108 Ga0105240_10881467 3300009093 Bacteria 964
109 Ga0105240_11179249 3300009093 Bacteria 812
110 Ga0111539_10005924 3300009094 Bacteria 15790
111 Ga0111539_10797054 3300009094 Bacteria 1099
112 Ga0111539_11298481 3300009094 Bacteria 845
113 Ga0114129_10079481 3300009147 Bacteria 4560
114 Ga0114129_10359110 3300009147 Bacteria 1928
115 Ga0105243_10666069 3300009148 Bacteria 1010
116 Ga0105241_11677899 3300009174 Unclassified 617
117 Ga0105241_11809087 3300009174 Bacteria 596
118 Ga0105242_11128770 3300009176 Bacteria 799
119 Ga0105242_11163360 3300009176 Bacteria 789
120 Ga0105248_10677770 3300009177 Bacteria 1163
121 Ga0105248_11127551 3300009177 Unclassified 887
122 Ga0105238_10021538 3300009551 Bacteria 6566
123 Ga0105238_12572987 3300009551 Bacteria 545
124 Ga0105249_10178437 3300009553 Bacteria 2065
125 Ga0105239_10976858 3300010375 Bacteria 973
126 Ga0105239_11146595 3300010375 Bacteria 895
127 Ga0157370_10080195 3300013104 Bacteria 3073
128 Ga0157370_10313079 3300013104 Bacteria 1448
129 Ga0157369_10114950 3300013105 Bacteria 2858
130 Ga0157369_10212046 3300013105 Bacteria 2030
131 Ga0157374_10091060 3300013296 Bacteria 2908
132 Ga0163162_10745890 3300013306 Bacteria 1099
133 Ga0163162_10781969 3300013306 Bacteria 1073
134 Ga0157372_11298034 3300013307 Unclassified 840
135 Ga0157372_12150478 3300013307 Bacteria 641
136 Ga0157375_10277248 3300013308 Bacteria 1839
137 Ga0163163_10091845 3300014325 Bacteria 3051
138 Ga0157380_10120686 3300014326 Bacteria 2220
139 Ga0182008_10070360 3300014497 Bacteria 1721
140 Ga0157379_10219870 3300014968 Bacteria 1721
141 Ga0157379_10493526 3300014968 Bacteria 1134
142 Ga0157376_10856158 3300014969 Bacteria 925
143 Ga0157376_12920305 3300014969 Bacteria 517
144 Ga0182007_10051026 3300015262 Bacteria 1365
145 Ga0184596_123955 3300019176 Bacteria 590
146 Ga0184598_141472 3300019182 Bacteria 567
147 Ga0206353_11192305 3300020082 Bacteria 1313
148 Ga0154015_1103175 3300020610 Unclassified 629
149 Ga0213874_10109940 3300021377 Unclassified 926
150 Ga0213876_10193398 3300021384 Bacteria 1082
151 Ga0213876_10214298 3300021384 Bacteria 1024
152 Ga0213875_10002178 3300021388 Bacteria 11962
153 Ga0213875_10059183 3300021388 Bacteria 1793
154 Ga0213875_10116725 3300021388 Bacteria 1247
155 Ga0224712_10047130 3300022467 Bacteria 1657
156 Ga0224712_10599332 3300022467 Bacteria 538
157 Ga0247554_101114 3300023547 Bacteria 892
158 Ga0247550_103277 3300023660 Bacteria 583
159 Ga0209130_1000473 3300025284 Bacteria 41414
160 Ga0209025_1002075 3300025294 Bacteria 22753
161 Ga0209758_1000028 3300025297 Bacteria 530102
162 Ga0209758_1034558 3300025297 Bacteria 2008
163 Ga0209050_1033760 3300025298 Bacteria 1545
164 Ga0207426_1000548 3300025302 Bacteria 52429
165 Ga0209051_1104534 3300025303 Bacteria 753
166 Ga0209257_1012625 3300025304 Bacteria 3875
167 Ga0209257_1020460 3300025304 Bacteria 2446
168 Ga0209257_1056770 3300025304 Bacteria 1080
169 Ga0207692_10155025 3300025898 Bacteria 1315
170 Ga0207699_10060560 3300025906 Bacteria 2274
171 Ga0207705_10527147 3300025909 Bacteria 918
172 Ga0207684_10195820 3300025910 Bacteria 1743
173 Ga0207684_10241378 3300025910 Bacteria 1559
174 Ga0207707_10006299 3300025912 Bacteria 10362
175 Ga0207707_10104665 3300025912 Bacteria 2473
176 Ga0207707_10397337 3300025912 Bacteria 1184
177 Ga0207695_10115059 3300025913 Bacteria 2664
178 Ga0207695_10269025 3300025913 Bacteria 1600
179 Ga0207695_10513376 3300025913 Bacteria 1080
180 Ga0207693_10003868 3300025915 Bacteria 12754
181 Ga0207693_10030583 3300025915 Bacteria 4254
182 Ga0207693_10115019 3300025915 Bacteria 2112
183 Ga0207693_10396360 3300025915 Bacteria 1079
184 Ga0207693_10880132 3300025915 Bacteria 688
185 Ga0207660_10094319 3300025917 Bacteria 2224
186 Ga0207660_10159273 3300025917 Bacteria 1740
187 Ga0207660_10179572 3300025917 Bacteria 1643
188 Ga0207657_11001088 3300025919 Bacteria 641
189 Ga0207652_10007091 3300025921 Bacteria 9029
190 Ga0207652_10058112 3300025921 Bacteria 3332
191 Ga0207652_10770982 3300025921 Bacteria 855
192 Ga0207646_10015509 3300025922 Bacteria 7194
193 Ga0207646_10310651 3300025922 Bacteria 1424
194 Ga0207681_10041953 3300025923 Bacteria 3053
195 Ga0207694_10263658 3300025924 Bacteria 1412
196 Ga0207694_11811951 3300025924 Bacteria 513
197 Ga0207659_10535873 3300025926 Bacteria 994
198 Ga0207700_10029958 3300025928 Bacteria 3847
199 Ga0207700_10359491 3300025928 Bacteria 1269
200 Ga0207664_10038320 3300025929 Bacteria 3716
201 Ga0207664_10207526 3300025929 Bacteria 1694
202 Ga0207644_10026331 3300025931 Bacteria 4006
203 Ga0207665_10071171 3300025939 Bacteria 2374
204 Ga0207691_10311355 3300025940 Bacteria 1351
205 Ga0207691_10793609 3300025940 Bacteria 796
206 Ga0207711_10885690 3300025941 Bacteria 830
207 Ga0207679_11297467 3300025945 Bacteria 668
208 Ga0207667_10932003 3300025949 Unclassified 859
209 Ga0207667_11411626 3300025949 Bacteria 669
210 Ga0207667_11639922 3300025949 Unclassified 611
211 Ga0207651_10326808 3300025960 Bacteria 1284
212 Ga0207712_10132674 3300025961 Bacteria 1900
213 Ga0207668_10529566 3300025972 Bacteria 1018
214 Ga0207640_11815291 3300025981 Bacteria 551
215 Ga0207677_10405589 3300026023 Bacteria 1157
216 Ga0207703_11547172 3300026035 Bacteria 638
217 Ga0207639_10336120 3300026041 Bacteria 1345
218 Ga0207708_10610925 3300026075 Bacteria 925
219 Ga0207702_10045263 3300026078 Bacteria 3702
220 Ga0207702_10745430 3300026078 Unclassified 967
221 Ga0207702_10753014 3300026078 Bacteria 962
222 Ga0207676_10301955 3300026095 Bacteria 1462
223 Ga0207675_100027997 3300026118 Bacteria 5247
224 Ga0207675_100209025 3300026118 Bacteria 1876
225 Ga0207675_101316978 3300026118 Bacteria 743
226 Ga0207698_11949248 3300026142 Unclassified 602
227 Ga0268265_10020054 3300028380 Bacteria 4659
228 Ga0268265_10030070 3300028380 Bacteria 3907
229 Ga0268264_10920870 3300028381 Bacteria 878
230 Ga0307517_10229315 3300028786 Bacteria 1117
231 Ga0265324_10019659 3300029957 Bacteria 2431
232 Ga0307512_10221534 3300030522 Bacteria 988
233 Ga0265330_10292712 3300031235 Bacteria 686
234 Ga0265331_10041443 3300031250 Bacteria 2237
235 Ga0265327_10000422 3300031251 Bacteria 77471
236 Ga0265316_10027414 3300031344 Bacteria 4718
237 Ga0307513_10030576 3300031456 Bacteria 6115
238 Ga0307513_10382758 3300031456 Bacteria 1146
239 Ga0307513_10595610 3300031456 Bacteria 815
240 Ga0265313_10000267 3300031595 Bacteria 57016
241 Ga0307508_10103755 3300031616 Bacteria 2440
242 Ga0307508_10174292 3300031616 Bacteria 1754
243 Ga0265342_10053401 3300031712 Bacteria 2405
244 Ga0316053_121606 3300032120 Bacteria 506
245 Ga0373930_0028914 3300034816 Bacteria 1130
246 Ga0373926_0076281 3300035083 Bacteria 1236
247 Ga0373923_0202046 3300035111 Bacteria 919
248 Ga0373936_0158686 3300035113 Bacteria 984
249 Ga0373939_0480864 3300035114 Bacteria 527
250 Ga0373954_0349782 3300035118 Bacteria 730
251 Ga0373957_0100472 3300035120 Bacteria 1158
252 Ga0373960_0041149 3300035121 Bacteria 1337
253 Ga0373931_0108949 3300035691 Bacteria 1569
254 Ga0373935_0595962 3300035692 Bacteria 808
255 Ga0373935_0787022 3300035692 Bacteria 702
256 Ga0373927_0373427 3300035695 Bacteria 940
257 Ga0373927_0467297 3300035695 Bacteria 833
258 Ga0373933_0338377 3300035724 Bacteria 977
259 Ga0373933_0616684 3300035724 Bacteria 713
260 Ga0373947_0243524 3300035725 Bacteria 1187
261 Ga0373937_0301647 3300036401 Bacteria 1514
262 Ga0373937_0888956 3300036401 Bacteria 840
263 Ga0373925_0049214 3300037068 Bacteria 3142
264 Ga0373925_0341418 3300037068 Bacteria 1215
265 Ga0373925_0400122 3300037068 Bacteria 1120
266 Ga0395900_1476820 3300037418 Bacteria 592
267 Ga0395898_1099746 3300037466 Bacteria 728
268 Ga0395905_0368151 3300037471 Bacteria 1330
269 Ga0436364_0231405 3300037853 Bacteria 2541
270 Ga0436364_0514631 3300037853 Bacteria 102563
271 Ga0436364_0914454 3300037853 Bacteria 805
272 Ga0436364_1373008 3300037853 Bacteria 2021
273 Ga0436365_0449880 3300039437 Bacteria 1312
274 Ga0436365_1634803 3300039437 Bacteria 796
275 Ga0436365_1788685 3300039437 Bacteria 3434
276 Ga0436365_1829761 3300039437 Bacteria 1899
277 Ga0436360_0751034 3300039438 Bacteria 2303
278 Ga0436360_0934270 3300039438 Bacteria 566
279 Ga0436360_1280115 3300039438 Bacteria 2363
280 Ga0436361_0044958 3300039447 Bacteria 1930
281 Ga0436363_0642921 3300039450 Bacteria 922
282 Ga0436363_1324983 3300039450 Bacteria 753
283 Ga0436363_1465113 3300039450 Bacteria 3708
284 Ga0436362_0583099 3300039453 Bacteria 579
285 Ga0436362_0825019 3300039453 Bacteria 1212
286 Ga0436362_1124651 3300039453 Bacteria 5324
287 Ga0451791_0090657 3300041451 Unclassified 534
288 Ga0451798_0562738 3300041458 Bacteria 543
289 Ga0451804_0224854 3300041463 Bacteria 827
290 Ga0451807_0090560 3300041486 Bacteria 747
291 Ga0450889_009342 3300042144 Bacteria 1004
292 Ga0439458_0225121 3300042157 Bacteria 517
293 Ga0439459_0033945 3300042438 Bacteria 1053
294 Ga0466963_0525947 3300044694 Bacteria 835
295 Ga0466957_0695905 3300044842 Bacteria 717
296 Ga0466967_0190672 3300045976 Bacteria 1937
297 Ga0466967_0214373 3300045976 Bacteria 1827
298 Ga0495638_0191888 3300046460 Bacteria 1159
299 Ga0495580_0867751 3300046472 Bacteria 582
300 Ga0495583_0264251 3300046506 Bacteria 688
301 Ga0495610_0038893 3300046512 Bacteria 2410
302 Ga0495630_0930501 3300046517 Bacteria 662
303 Ga0495611_0323928 3300046648 Bacteria 709
304 Ga0495625_0135115 3300046660 Bacteria 1668
305 Ga0495625_0463459 3300046660 Bacteria 781
306 Ga0495649_0344245 3300046694 Bacteria 754
307 Ga0495604_0560313 3300047317 Bacteria 736
308 Ga0495684_0252445 3300047471 Bacteria 1283
309 Ga0495686_0344942 3300047472 Bacteria 811
310 Ga0495602_1110135 3300048088 Bacteria 518
311 Ga0496104_0054948 3300048907 Bacteria 3764
312 Ga0496108_0204850 3300048911 Bacteria 1712
313 Ga0496109_0597899 3300048912 Bacteria 1039
314 Ga0496113_0029775 3300048916 Bacteria 3946
315 Ga0496115_0131458 3300048918 Unclassified 2063
316 Ga0501032_0708824 3300049569 Bacteria 638
317 Ga0501033_0022203 3300049570 Bacteria 4788
318 Ga0501034_0024199 3300049571 Bacteria 6176
319 Ga0501034_0080607 3300049571 Bacteria 3258
320 Ga0501034_0167039 3300049571 Bacteria 2169
321 Ga0501034_0443191 3300049571 Bacteria 1217
322 Ga0501034_0567320 3300049571 Bacteria 1043
323 Ga0501036_0019145 3300049572 Bacteria 5743
324 Ga0501036_0192485 3300049572 Bacteria 1716
325 Ga0501037_0003435 3300049573 Bacteria 11514
326 Ga0501037_0208185 3300049573 Bacteria 1380
327 Ga0501038_0247116 3300049574 Bacteria 1414
328 Ga0501039_0008345 3300049575 Bacteria 7895
329 Ga0501039_0637336 3300049575 Bacteria 835
330 Ga0501040_0140026 3300049576 Bacteria 1704
331 Ga0501041_0046176 3300049577 Bacteria 2650
332 Ga0501043_0033039 3300049579 Bacteria 4069
333 Ga0501043_0038510 3300049579 Bacteria 3759
334 Ga0501046_0027145 3300049580 Bacteria 4675
335 Ga0501046_0070959 3300049580 Bacteria 2707
336 Ga0501047_0001112 3300049581 Bacteria 26731
337 Ga0501047_0008381 3300049581 Bacteria 9758
338 Ga0501047_0333554 3300049581 Bacteria 1355
339 Ga0501048_0034429 3300049582 Bacteria 3654
340 Ga0501048_0596352 3300049582 Bacteria 793
341 Ga0501067_0051781 3300049583 Bacteria 2275
342 Ga0501068_0025888 3300049584 Bacteria 3452
343 Ga0501068_0217618 3300049584 Bacteria 1213
344 Ga0501069_0013375 3300049585 Bacteria 4376
345 Ga0501069_0387382 3300049585 Bacteria 826
346 Ga0501070_0005919 3300049586 Bacteria 10429
347 Ga0501070_0176967 3300049586 Bacteria 1756
348 Ga0501070_0180146 3300049586 Bacteria 1739
349 Ga0501070_0437252 3300049586 Bacteria 1056
350 Ga0501071_0469790 3300049587 Bacteria 963
351 Ga0501072_0467487 3300049588 Bacteria 998
352 Ga0501072_0731623 3300049588 Bacteria 777
353 Ga0501073_0014042 3300049589 Bacteria 5818
354 Ga0501073_0046161 3300049589 Bacteria 3065
355 Ga0501073_0046829 3300049589 Bacteria 3040
356 Ga0501073_0076174 3300049589 Bacteria 2334
357 Ga0501073_1094958 3300049589 Bacteria 548
358 Ga0501074_0005241 3300049590 Bacteria 9325
359 Ga0501075_0106785 3300049591 Bacteria 2128
360 Ga0501076_0051422 3300049592 Bacteria 3262
361 Ga0501077_0101115 3300049593 Bacteria 1827
362 Ga0501079_0162054 3300049741 Bacteria 1744
363 Ga0501080_0011900 3300049742 Bacteria 7971
364 Ga0501080_0038348 3300049742 Bacteria 4473
365 Ga0501080_0205184 3300049742 Bacteria 1808
366 Ga0501080_0326762 3300049742 Bacteria 1388
367 Ga0501083_0018486 3300049744 Bacteria 4856
368 Ga0501083_0020754 3300049744 Bacteria 4567
369 Ga0501083_0069743 3300049744 Bacteria 2339
370 Ga0501035_0006444 3300049822 Bacteria 11020
371 Ga0501035_0600267 3300049822 Bacteria 897
372 Ga0501035_0994030 3300049822 Bacteria 660
373 Ga0501044_0010863 3300049823 Bacteria 9878
374 Ga0501044_0042413 3300049823 Bacteria 4732
375 Ga0501044_0056947 3300049823 Bacteria 4012
376 Ga0501044_0972768 3300049823 Bacteria 721
377 Ga0501045_0235468 3300049824 Bacteria 1363
378 nmdc:mga0k408_170197_c1 3300050493 Bacteria 1298
379 nmdc:mga05p37_62323_c1 3300050507 Bacteria 4589
380 nmdc:mga06r32_268500_c1 3300050510 Bacteria 1693
381 nmdc:mga08y16_317144_c1 3300050511 Bacteria 1605
382 nmdc:mga08y16_35_c1 3300050511 Bacteria 157578
383 nmdc:mga08y16_728879_c1 3300050511 Bacteria 989
384 nmdc:mga0rr50_653000_c1 3300050513 Bacteria 898
385 nmdc:mga08x19_601783_c1 3300050514 Bacteria 779
386 nmdc:mga0a205_355686_c1 3300050515 Bacteria 1331
387 Ga0500578_0507526 3300053086 Bacteria 677
388 Ga0500643_017308 3300053087 Bacteria 2415
389 Ga0500644_0022239 3300053088 Bacteria 1910
390 Ga0500644_0519985 3300053088 Bacteria 524
391 Ga0500646_0007669 3300053090 Bacteria 2756
392 Ga0500583_0111105 3300053092 Bacteria 1350
393 Ga0500583_0133479 3300053092 Bacteria 1232
394 Ga0500651_0004182 3300053093 Bacteria 8050
395 Ga0500651_0246261 3300053093 Bacteria 1041
396 Ga0500566_0085618 3300053094 Bacteria 1748
397 Ga0500641_0002029 3300053096 Bacteria 7190
398 Ga0500650_0102190 3300053098 Bacteria 1341
399 Ga0500650_0260127 3300053098 Bacteria 776
400 Ga0500555_003056 3300053103 Bacteria 4785
401 Ga0500556_0042726 3300053104 Bacteria 1605
402 Ga0500594_0054388 3300053118 Bacteria 1137
403 Ga0500595_014120 3300053119 Bacteria 3038
404 Ga0500621_238771 3300053126 Bacteria 618
405 Ga0500642_0000735 3300053130 Bacteria 9651
406 Ga0500642_0159084 3300053130 Bacteria 1059
407 Ga0500658_0014456 3300053134 Bacteria 2922
408 Ga0500658_0119273 3300053134 Bacteria 1168
409 Ga0500658_0168704 3300053134 Bacteria 993
410 Ga0500577_0107370 3300053142 Bacteria 1148
411 Ga0500577_0369255 3300053142 Bacteria 628
412 Ga0500588_0000231 3300053146 Bacteria 7973
413 Ga0500588_0339209 3300053146 Bacteria 570
414 Ga0500589_116790 3300053147 Bacteria 1136
415 Ga0500604_0000673 3300053151 Bacteria 9355
416 Ga0500604_0092518 3300053151 Bacteria 989
417 Ga0500604_0097363 3300053151 Bacteria 967
418 Ga0500616_0000388 3300053153 Bacteria 61251
419 Ga0500622_0066760 3300053156 Bacteria 1826
420 Ga0500627_0164478 3300053158 Bacteria 1001
421 Ga0500611_027240 3300053727 Bacteria 1149
422 Ga0500645_007456 3300053730 Bacteria 3807
423 Ga0500609_001603 3300053731 Bacteria 3299
424 Ga0500587_025534 3300053739 Bacteria 788
425 Ga0501084_0118284 3300054114 Bacteria 2228
426 Ga0501084_0130533 3300054114 Bacteria 2115
427 Ga0501084_0219693 3300054114 Bacteria 1603
428 Ga0501082_0023038 3300060353 Bacteria 5368
429 Ga0501082_0031005 3300060353 Bacteria 4608
430 Ga0501082_0279058 3300060353 Bacteria 1454
431 Ga0530510_0387475 3300061734 Bacteria 1052
432 Ga0530510_0408070 3300061734 Bacteria 1025

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_0090657 Ga0451791_0090657_102_440 107
2 iso_pu_bacteria 2883291878 2883294587 110
3 iso_pu_bacteria 2883354860 2883356910 110
4 3300005518 Ga0070699_100423688 Ga0070699_1004236882 111
5 3300005536 Ga0070697_100050209 Ga0070697_1000502092 111
6 3300007788 Ga0099795_10250451 Ga0099795_102504512 111
7 3300025910 Ga0207684_10241378 Ga0207684_102413783 111
8 3300029957 Ga0265324_10019659 Ga0265324_100196594 111
9 3300031344 Ga0265316_10027414 Ga0265316_100274144 111
10 3300049571 Ga0501034_0167039 Ga0501034_0167039_102_443 111
11 3300003794 Ga0055531_10013026 Ga0055531_100130264 112
12 3300005336 Ga0070680_100181490 Ga0070680_1001814902 112
13 3300005347 Ga0070668_100535991 Ga0070668_1005359912 112
14 3300005353 Ga0070669_100012775 Ga0070669_1000127756 112
15 3300005434 Ga0070709_10097951 Ga0070709_100979512 112
16 3300005441 Ga0070700_100618199 Ga0070700_1006181992 112
17 3300005445 Ga0070708_100220155 Ga0070708_1002201552 112
18 3300005458 Ga0070681_10008045 Ga0070681_100080454 112
19 3300005468 Ga0070707_101888488 Ga0070707_1018884881 112
20 3300005530 Ga0070679_100261879 Ga0070679_1002618791 112
21 3300005563 Ga0068855_100559784 Ga0068855_1005597843 112
22 3300005578 Ga0068854_101496359 Ga0068854_1014963591 112
23 3300005719 Ga0068861_100118207 Ga0068861_1001182073 112
24 3300005843 Ga0068860_100766682 Ga0068860_1007666822 112
25 3300005844 Ga0068862_100008974 Ga0068862_1000089745 112
26 3300005844 Ga0068862_100013738 Ga0068862_1000137385 112
27 3300005981 Ga0081538_10000854 Ga0081538_1000085432 112
28 3300005985 Ga0081539_10096023 Ga0081539_100960232 112
29 3300006173 Ga0070716_101607742 Ga0070716_1016077422 112
30 3300006195 Ga0075366_10420853 Ga0075366_104208532 112
31 3300006195 Ga0075366_10430971 Ga0075366_104309712 112
32 3300006844 Ga0075428_100066813 Ga0075428_1000668133 112
33 3300006847 Ga0075431_100501640 Ga0075431_1005016402 112
34 3300006852 Ga0075433_10353669 Ga0075433_103536692 112
35 3300006880 Ga0075429_101098320 Ga0075429_1010983201 112
36 3300006881 Ga0068865_100300197 Ga0068865_1003001972 112
37 3300007265 Ga0099794_10497631 Ga0099794_104976311 112
38 3300009093 Ga0105240_10154081 Ga0105240_101540812 112
39 3300009093 Ga0105240_10752537 Ga0105240_107525371 112
40 3300009094 Ga0111539_10005924 Ga0111539_100059244 112
41 3300009094 Ga0111539_10797054 Ga0111539_107970542 112
42 3300009147 Ga0114129_10079481 Ga0114129_100794815 112
43 3300009147 Ga0114129_10359110 Ga0114129_103591103 112
44 3300009148 Ga0105243_10666069 Ga0105243_106660692 112
45 3300009176 Ga0105242_11128770 Ga0105242_111287701 112
46 3300009553 Ga0105249_10178437 Ga0105249_101784373 112
47 3300013307 Ga0157372_12150478 Ga0157372_121504781 112
48 3300014326 Ga0157380_10120686 Ga0157380_101206862 112
49 3300025298 Ga0209050_1033760 Ga0209050_10337602 112
50 3300025303 Ga0209051_1104534 Ga0209051_11045342 112
51 3300025304 Ga0209257_1012625 Ga0209257_10126253 112
52 3300025304 Ga0209257_1020460 Ga0209257_10204603 112
53 3300025304 Ga0209257_1056770 Ga0209257_10567702 112
54 3300025912 Ga0207707_10006299 Ga0207707_1000629911 112
55 3300025913 Ga0207695_10115059 Ga0207695_101150592 112
56 3300025917 Ga0207660_10159273 Ga0207660_101592733 112
57 3300025917 Ga0207660_10179572 Ga0207660_101795721 112
58 3300025921 Ga0207652_10007091 Ga0207652_100070912 112
59 3300025921 Ga0207652_10058112 Ga0207652_100581123 112
60 3300025923 Ga0207681_10041953 Ga0207681_100419533 112
61 3300025961 Ga0207712_10132674 Ga0207712_101326742 112
62 3300025972 Ga0207668_10529566 Ga0207668_105295662 112
63 3300025981 Ga0207640_11815291 Ga0207640_118152911 112
64 3300026075 Ga0207708_10610925 Ga0207708_106109251 112
65 3300026118 Ga0207675_100027997 Ga0207675_1000279976 112
66 3300026118 Ga0207675_100209025 Ga0207675_1002090252 112
67 3300026118 Ga0207675_101316978 Ga0207675_1013169781 112
68 3300028380 Ga0268265_10020054 Ga0268265_100200545 112
69 3300028380 Ga0268265_10030070 Ga0268265_100300705 112
70 3300030522 Ga0307512_10221534 Ga0307512_102215342 112
71 3300031251 Ga0265327_10000422 Ga0265327_1000042216 112
72 3300031456 Ga0307513_10382758 Ga0307513_103827582 112
73 3300031456 Ga0307513_10595610 Ga0307513_105956102 112
74 3300031616 Ga0307508_10103755 Ga0307508_101037552 112
75 3300031616 Ga0307508_10174292 Ga0307508_101742922 112
76 3300035695 Ga0373927_0373427 Ga0373927_0373427_168_524 112
77 3300037418 Ga0395900_1476820 Ga0395900_1476820_153_509 112
78 3300037466 Ga0395898_1099746 Ga0395898_1099746_225_581 112
79 3300039438 Ga0436360_0934270 Ga0436360_0934270_14_367 112
80 3300039438 Ga0436360_1280115 Ga0436360_1280115_150_503 112
81 3300041458 Ga0451798_0562738 Ga0451798_0562738_155_511 112
82 3300041463 Ga0451804_0224854 Ga0451804_0224854_181_537 112
83 3300041486 Ga0451807_0090560 Ga0451807_0090560_90_446 112
84 3300042144 Ga0450889_009342 Ga0450889_009342_167_523 112
85 3300042157 Ga0439458_0225121 Ga0439458_0225121_86_442 112
86 3300046460 Ga0495638_0191888 Ga0495638_0191888_661_1017 112
87 3300046648 Ga0495611_0323928 Ga0495611_0323928_116_469 112
88 3300046660 Ga0495625_0135115 Ga0495625_0135115_446_802 112
89 3300046660 Ga0495625_0463459 Ga0495625_0463459_266_622 112
90 3300046694 Ga0495649_0344245 Ga0495649_0344245_29_385 112
91 3300047472 Ga0495686_0344942 Ga0495686_0344942_122_478 112
92 3300049570 Ga0501033_0022203 Ga0501033_0022203_442_831 112
93 3300049571 Ga0501034_0024199 Ga0501034_0024199_1907_2296 112
94 3300049571 Ga0501034_0080607 Ga0501034_0080607_2431_2787 112
95 3300049572 Ga0501036_0019145 Ga0501036_0019145_1059_1448 112
96 3300049572 Ga0501036_0192485 Ga0501036_0192485_516_854 112
97 3300049573 Ga0501037_0003435 Ga0501037_0003435_7509_7898 112
98 3300049574 Ga0501038_0247116 Ga0501038_0247116_851_1240 112
99 3300049575 Ga0501039_0008345 Ga0501039_0008345_2193_2582 112
100 3300049576 Ga0501040_0140026 Ga0501040_0140026_1039_1377 112
101 3300049577 Ga0501041_0046176 Ga0501041_0046176_1461_1799 112
102 3300049579 Ga0501043_0033039 Ga0501043_0033039_2830_3219 112
103 3300049579 Ga0501043_0038510 Ga0501043_0038510_1588_1944 112
104 3300049580 Ga0501046_0027145 Ga0501046_0027145_327_716 112
105 3300049580 Ga0501046_0070959 Ga0501046_0070959_1199_1555 112
106 3300049581 Ga0501047_0001112 Ga0501047_0001112_23200_23556 112
107 3300049581 Ga0501047_0008381 Ga0501047_0008381_4057_4446 112
108 3300049582 Ga0501048_0034429 Ga0501048_0034429_2041_2430 112
109 3300049582 Ga0501048_0596352 Ga0501048_0596352_48_404 112
110 3300049583 Ga0501067_0051781 Ga0501067_0051781_229_585 112
111 3300049584 Ga0501068_0025888 Ga0501068_0025888_174_563 112
112 3300049584 Ga0501068_0217618 Ga0501068_0217618_463_819 112
113 3300049585 Ga0501069_0013375 Ga0501069_0013375_3821_4210 112
114 3300049585 Ga0501069_0387382 Ga0501069_0387382_382_738 112
115 3300049586 Ga0501070_0005919 Ga0501070_0005919_4809_5198 112
116 3300049586 Ga0501070_0176967 Ga0501070_0176967_471_827 112
117 3300049586 Ga0501070_0180146 Ga0501070_0180146_399_761 112
118 3300049586 Ga0501070_0437252 Ga0501070_0437252_292_648 112
119 3300049587 Ga0501071_0469790 Ga0501071_0469790_401_739 112
120 3300049589 Ga0501073_0014042 Ga0501073_0014042_3350_3706 112
121 3300049589 Ga0501073_0046829 Ga0501073_0046829_1589_1945 112
122 3300049589 Ga0501073_1094958 Ga0501073_1094958_157_513 112
123 3300049590 Ga0501074_0005241 Ga0501074_0005241_3778_4167 112
124 3300049593 Ga0501077_0101115 Ga0501077_0101115_1128_1466 112
125 3300049741 Ga0501079_0162054 Ga0501079_0162054_547_885 112
126 3300049742 Ga0501080_0038348 Ga0501080_0038348_2956_3345 112
127 3300049742 Ga0501080_0326762 Ga0501080_0326762_1039_1377 112
128 3300049744 Ga0501083_0018486 Ga0501083_0018486_1640_2029 112
129 3300049744 Ga0501083_0069743 Ga0501083_0069743_1276_1632 112
130 3300049822 Ga0501035_0006444 Ga0501035_0006444_1659_2048 112
131 3300049822 Ga0501035_0600267 Ga0501035_0600267_440_796 112
132 3300049823 Ga0501044_0010863 Ga0501044_0010863_2638_2994 112
133 3300049823 Ga0501044_0042413 Ga0501044_0042413_1243_1632 112
134 3300049823 Ga0501044_0972768 Ga0501044_0972768_253_609 112
135 3300049824 Ga0501045_0235468 Ga0501045_0235468_89_427 112
136 3300050493 nmdc:mga0k408_170197_c1 nmdc:mga0k408_170197_c1_627_983 112
137 3300050507 nmdc:mga05p37_62323_c1 nmdc:mga05p37_62323_c1_3473_3829 112
138 3300050510 nmdc:mga06r32_268500_c1 nmdc:mga06r32_268500_c1_461_817 112
139 3300050511 nmdc:mga08y16_317144_c1 nmdc:mga08y16_317144_c1_794_1150 112
140 3300050511 nmdc:mga08y16_35_c1 nmdc:mga08y16_35_c1_726_1082 112
141 3300050511 nmdc:mga08y16_728879_c1 nmdc:mga08y16_728879_c1_243_599 112
142 3300050515 nmdc:mga0a205_355686_c1 nmdc:mga0a205_355686_c1_488_844 112
143 3300053087 Ga0500643_017308 Ga0500643_017308_1389_1745 112
144 3300053088 Ga0500644_0022239 Ga0500644_0022239_537_893 112
145 3300053090 Ga0500646_0007669 Ga0500646_0007669_1484_1840 112
146 3300053092 Ga0500583_0111105 Ga0500583_0111105_827_1183 112
147 3300053092 Ga0500583_0133479 Ga0500583_0133479_799_1155 112
148 3300053093 Ga0500651_0004182 Ga0500651_0004182_5125_5481 112
149 3300053093 Ga0500651_0246261 Ga0500651_0246261_518_874 112
150 3300053094 Ga0500566_0085618 Ga0500566_0085618_721_1077 112
151 3300053096 Ga0500641_0002029 Ga0500641_0002029_5880_6236 112
152 3300053098 Ga0500650_0102190 Ga0500650_0102190_613_969 112
153 3300053098 Ga0500650_0260127 Ga0500650_0260127_321_677 112
154 3300053103 Ga0500555_003056 Ga0500555_003056_1192_1548 112
155 3300053104 Ga0500556_0042726 Ga0500556_0042726_1227_1583 112
156 3300053118 Ga0500594_0054388 Ga0500594_0054388_343_699 112
157 3300053119 Ga0500595_014120 Ga0500595_014120_669_1025 112
158 3300053126 Ga0500621_238771 Ga0500621_238771_11_367 112
159 3300053130 Ga0500642_0000735 Ga0500642_0000735_2415_2771 112
160 3300053130 Ga0500642_0159084 Ga0500642_0159084_121_477 112
161 3300053134 Ga0500658_0014456 Ga0500658_0014456_1871_2227 112
162 3300053134 Ga0500658_0119273 Ga0500658_0119273_390_746 112
163 3300053134 Ga0500658_0168704 Ga0500658_0168704_582_938 112
164 3300053142 Ga0500577_0107370 Ga0500577_0107370_234_590 112
165 3300053146 Ga0500588_0339209 Ga0500588_0339209_92_448 112
166 3300053147 Ga0500589_116790 Ga0500589_116790_574_930 112
167 3300053151 Ga0500604_0000673 Ga0500604_0000673_2386_2742 112
168 3300053151 Ga0500604_0092518 Ga0500604_0092518_136_492 112
169 3300053153 Ga0500616_0000388 Ga0500616_0000388_4334_4690 112
170 3300053156 Ga0500622_0066760 Ga0500622_0066760_1343_1699 112
171 3300053158 Ga0500627_0164478 Ga0500627_0164478_151_507 112
172 3300053727 Ga0500611_027240 Ga0500611_027240_498_854 112
173 3300053730 Ga0500645_007456 Ga0500645_007456_1188_1535 112
174 3300053731 Ga0500609_001603 Ga0500609_001603_1334_1690 112
175 3300053739 Ga0500587_025534 Ga0500587_025534_93_449 112
176 3300054114 Ga0501084_0130533 Ga0501084_0130533_414_803 112
177 3300054114 Ga0501084_0219693 Ga0501084_0219693_457_795 112
178 3300060353 Ga0501082_0023038 Ga0501082_0023038_3490_3879 112
179 3300060353 Ga0501082_0031005 Ga0501082_0031005_1694_2050 112
180 3300061734 Ga0530510_0387475 Ga0530510_0387475_279_617 112
181 3300003187 JGI25151J46595_10000938 JGI25151J46595_1000093817 113
182 3300003354 JGI25160J50197_1006381 JGI25160J50197_10063814 113
183 3300005262 Ga0065165_1086731 Ga0065165_10867312 113
184 3300005327 Ga0070658_10648758 Ga0070658_106487582 113
185 3300005329 Ga0070683_100716054 Ga0070683_1007160541 113
186 3300005330 Ga0070690_101085792 Ga0070690_1010857922 113
187 3300005338 Ga0068868_100155612 Ga0068868_1001556122 113
188 3300005338 Ga0068868_101563951 Ga0068868_1015639511 113
189 3300005345 Ga0070692_10859013 Ga0070692_108590132 113
190 3300005355 Ga0070671_100017490 Ga0070671_1000174904 113
191 3300005364 Ga0070673_100299655 Ga0070673_1002996552 113
192 3300005434 Ga0070709_10042623 Ga0070709_100426233 113
193 3300005434 Ga0070709_10518973 Ga0070709_105189731 113
194 3300005435 Ga0070714_100052684 Ga0070714_1000526844 113
195 3300005435 Ga0070714_100521676 Ga0070714_1005216762 113
196 3300005435 Ga0070714_100682735 Ga0070714_1006827352 113
197 3300005435 Ga0070714_100847151 Ga0070714_1008471511 113
198 3300005435 Ga0070714_102416186 Ga0070714_1024161861 113
199 3300005436 Ga0070713_100147249 Ga0070713_1001472492 113
200 3300005436 Ga0070713_100168870 Ga0070713_1001688701 113
201 3300005436 Ga0070713_100841861 Ga0070713_1008418612 113
202 3300005436 Ga0070713_101704353 Ga0070713_1017043531 113
203 3300005436 Ga0070713_102050708 Ga0070713_1020507081 113
204 3300005437 Ga0070710_10828955 Ga0070710_108289552 113
205 3300005439 Ga0070711_100048649 Ga0070711_1000486491 113
206 3300005439 Ga0070711_100158936 Ga0070711_1001589363 113
207 3300005439 Ga0070711_100277408 Ga0070711_1002774082 113
208 3300005456 Ga0070678_100306599 Ga0070678_1003065992 113
209 3300005458 Ga0070681_10064639 Ga0070681_100646395 113
210 3300005458 Ga0070681_10088517 Ga0070681_100885173 113
211 3300005458 Ga0070681_10242483 Ga0070681_102424832 113
212 3300005458 Ga0070681_10664733 Ga0070681_106647332 113
213 3300005458 Ga0070681_11010505 Ga0070681_110105052 113
214 3300005468 Ga0070707_100004277 Ga0070707_1000042779 113
215 3300005468 Ga0070707_100622150 Ga0070707_1006221502 113
216 3300005471 Ga0070698_100043988 Ga0070698_1000439882 113
217 3300005518 Ga0070699_100405313 Ga0070699_1004053132 113
218 3300005518 Ga0070699_100631527 Ga0070699_1006315271 113
219 3300005518 Ga0070699_100655318 Ga0070699_1006553182 113
220 3300005535 Ga0070684_100936689 Ga0070684_1009366892 113
221 3300005536 Ga0070697_100174206 Ga0070697_1001742062 113
222 3300005539 Ga0068853_100014295 Ga0068853_1000142957 113
223 3300005543 Ga0070672_101039124 Ga0070672_1010391242 113
224 3300005544 Ga0070686_100845953 Ga0070686_1008459532 113
225 3300005545 Ga0070695_100480992 Ga0070695_1004809921 113
226 3300005547 Ga0070693_100680530 Ga0070693_1006805302 113
227 3300005547 Ga0070693_100884663 Ga0070693_1008846631 113
228 3300005563 Ga0068855_100661730 Ga0068855_1006617302 113
229 3300005564 Ga0070664_101345162 Ga0070664_1013451622 113
230 3300005614 Ga0068856_100080249 Ga0068856_1000802493 113
231 3300005614 Ga0068856_101163768 Ga0068856_1011637681 113
232 3300005616 Ga0068852_100667094 Ga0068852_1006670942 113
233 3300005617 Ga0068859_102258560 Ga0068859_1022585601 113
234 3300005618 Ga0068864_100907585 Ga0068864_1009075853 113
235 3300005841 Ga0068863_100338710 Ga0068863_1003387102 113
236 3300005841 Ga0068863_101472778 Ga0068863_1014727781 113
237 3300005843 Ga0068860_100696168 Ga0068860_1006961682 113
238 3300005983 Ga0081540_1007828 Ga0081540_10078286 113
239 3300006028 Ga0070717_10124166 Ga0070717_101241663 113
240 3300006163 Ga0070715_10251032 Ga0070715_102510322 113
241 3300006173 Ga0070716_100642247 Ga0070716_1006422472 113
242 3300006175 Ga0070712_100165307 Ga0070712_1001653071 113
243 3300006175 Ga0070712_100311448 Ga0070712_1003114482 113
244 3300006175 Ga0070712_100461705 Ga0070712_1004617052 113
245 3300006175 Ga0070712_100495779 Ga0070712_1004957792 113
246 3300006175 Ga0070712_100530763 Ga0070712_1005307631 113
247 3300006175 Ga0070712_100630448 Ga0070712_1006304482 113
248 3300006237 Ga0097621_100729661 Ga0097621_1007296612 113
249 3300006871 Ga0075434_101462116 Ga0075434_1014621161 113
250 3300006871 Ga0075434_101849478 Ga0075434_1018494781 113
251 3300006931 Ga0097620_102259280 Ga0097620_1022592801 113
252 3300007076 Ga0075435_100273003 Ga0075435_1002730031 113
253 3300007788 Ga0099795_10012526 Ga0099795_100125262 113
254 3300007788 Ga0099795_10021156 Ga0099795_100211562 113
255 3300009093 Ga0105240_10371051 Ga0105240_103710512 113
256 3300009093 Ga0105240_10881467 Ga0105240_108814672 113
257 3300009093 Ga0105240_11179249 Ga0105240_111792492 113
258 3300009094 Ga0111539_11298481 Ga0111539_112984811 113
259 3300009174 Ga0105241_11677899 Ga0105241_116778992 113
260 3300009174 Ga0105241_11809087 Ga0105241_118090871 113
261 3300009176 Ga0105242_11163360 Ga0105242_111633602 113
262 3300009177 Ga0105248_10677770 Ga0105248_106777702 113
263 3300009177 Ga0105248_11127551 Ga0105248_111275511 113
264 3300009551 Ga0105238_10021538 Ga0105238_100215386 113
265 3300009551 Ga0105238_12572987 Ga0105238_125729871 113
266 3300010375 Ga0105239_10976858 Ga0105239_109768582 113
267 3300010375 Ga0105239_11146595 Ga0105239_111465951 113
268 3300013104 Ga0157370_10080195 Ga0157370_100801954 113
269 3300013104 Ga0157370_10313079 Ga0157370_103130792 113
270 3300013105 Ga0157369_10114950 Ga0157369_101149504 113
271 3300013105 Ga0157369_10212046 Ga0157369_102120462 113
272 3300013296 Ga0157374_10091060 Ga0157374_100910602 113
273 3300013306 Ga0163162_10745890 Ga0163162_107458902 113
274 3300013306 Ga0163162_10781969 Ga0163162_107819692 113
275 3300013307 Ga0157372_11298034 Ga0157372_112980342 113
276 3300013308 Ga0157375_10277248 Ga0157375_102772483 113
277 3300014325 Ga0163163_10091845 Ga0163163_100918452 113
278 3300014497 Ga0182008_10070360 Ga0182008_100703601 113
279 3300014968 Ga0157379_10219870 Ga0157379_102198702 113
280 3300014968 Ga0157379_10493526 Ga0157379_104935261 113
281 3300014969 Ga0157376_10856158 Ga0157376_108561582 113
282 3300014969 Ga0157376_12920305 Ga0157376_129203051 113
283 3300015262 Ga0182007_10051026 Ga0182007_100510262 113
284 3300019176 Ga0184596_123955 Ga0184596_1239552 113
285 3300019182 Ga0184598_141472 Ga0184598_1414722 113
286 3300020082 Ga0206353_11192305 Ga0206353_111923052 113
287 3300020610 Ga0154015_1103175 Ga0154015_11031752 113
288 3300021377 Ga0213874_10109940 Ga0213874_101099401 113
289 3300021384 Ga0213876_10193398 Ga0213876_101933981 113
290 3300021384 Ga0213876_10214298 Ga0213876_102142982 113
291 3300021388 Ga0213875_10002178 Ga0213875_100021787 113
292 3300021388 Ga0213875_10059183 Ga0213875_100591832 113
293 3300021388 Ga0213875_10116725 Ga0213875_101167251 113
294 3300022467 Ga0224712_10047130 Ga0224712_100471302 113
295 3300022467 Ga0224712_10599332 Ga0224712_105993321 113
296 3300023547 Ga0247554_101114 Ga0247554_1011142 113
297 3300023660 Ga0247550_103277 Ga0247550_1032772 113
298 3300025284 Ga0209130_1000473 Ga0209130_100047331 113
299 3300025294 Ga0209025_1002075 Ga0209025_100207517 113
300 3300025297 Ga0209758_1000028 Ga0209758_1000028181 113
301 3300025297 Ga0209758_1034558 Ga0209758_10345582 113
302 3300025302 Ga0207426_1000548 Ga0207426_100054850 113
303 3300025898 Ga0207692_10155025 Ga0207692_101550252 113
304 3300025906 Ga0207699_10060560 Ga0207699_100605602 113
305 3300025909 Ga0207705_10527147 Ga0207705_105271472 113
306 3300025910 Ga0207684_10195820 Ga0207684_101958201 113
307 3300025912 Ga0207707_10104665 Ga0207707_101046652 113
308 3300025912 Ga0207707_10397337 Ga0207707_103973372 113
309 3300025913 Ga0207695_10269025 Ga0207695_102690252 113
310 3300025913 Ga0207695_10513376 Ga0207695_105133762 113
311 3300025915 Ga0207693_10003868 Ga0207693_100038685 113
312 3300025915 Ga0207693_10030583 Ga0207693_100305832 113
313 3300025915 Ga0207693_10115019 Ga0207693_101150192 113
314 3300025915 Ga0207693_10396360 Ga0207693_103963603 113
315 3300025915 Ga0207693_10880132 Ga0207693_108801321 113
316 3300025917 Ga0207660_10094319 Ga0207660_100943193 113
317 3300025919 Ga0207657_11001088 Ga0207657_110010882 113
318 3300025921 Ga0207652_10770982 Ga0207652_107709822 113
319 3300025922 Ga0207646_10015509 Ga0207646_100155092 113
320 3300025922 Ga0207646_10310651 Ga0207646_103106512 113
321 3300025924 Ga0207694_10263658 Ga0207694_102636582 113
322 3300025924 Ga0207694_11811951 Ga0207694_118119511 113
323 3300025926 Ga0207659_10535873 Ga0207659_105358731 113
324 3300025928 Ga0207700_10029958 Ga0207700_100299583 113
325 3300025928 Ga0207700_10359491 Ga0207700_103594912 113
326 3300025929 Ga0207664_10038320 Ga0207664_100383202 113
327 3300025929 Ga0207664_10207526 Ga0207664_102075262 113
328 3300025931 Ga0207644_10026331 Ga0207644_100263313 113
329 3300025939 Ga0207665_10071171 Ga0207665_100711712 113
330 3300025940 Ga0207691_10311355 Ga0207691_103113552 113
331 3300025940 Ga0207691_10793609 Ga0207691_107936092 113
332 3300025941 Ga0207711_10885690 Ga0207711_108856901 113
333 3300025945 Ga0207679_11297467 Ga0207679_112974672 113
334 3300025949 Ga0207667_10932003 Ga0207667_109320032 113
335 3300025949 Ga0207667_11411626 Ga0207667_114116261 113
336 3300025949 Ga0207667_11639922 Ga0207667_116399221 113
337 3300025960 Ga0207651_10326808 Ga0207651_103268082 113
338 3300026023 Ga0207677_10405589 Ga0207677_104055891 113
339 3300026035 Ga0207703_11547172 Ga0207703_115471721 113
340 3300026041 Ga0207639_10336120 Ga0207639_103361202 113
341 3300026078 Ga0207702_10045263 Ga0207702_100452632 113
342 3300026078 Ga0207702_10745430 Ga0207702_107454302 113
343 3300026078 Ga0207702_10753014 Ga0207702_107530142 113
344 3300026095 Ga0207676_10301955 Ga0207676_103019552 113
345 3300026142 Ga0207698_11949248 Ga0207698_119492481 113
346 3300028381 Ga0268264_10920870 Ga0268264_109208701 113
347 3300028786 Ga0307517_10229315 Ga0307517_102293152 113
348 3300031235 Ga0265330_10292712 Ga0265330_102927122 113
349 3300031250 Ga0265331_10041443 Ga0265331_100414434 113
350 3300031456 Ga0307513_10030576 Ga0307513_100305766 113
351 3300031595 Ga0265313_10000267 Ga0265313_1000026748 113
352 3300031712 Ga0265342_10053401 Ga0265342_100534012 113
353 3300032120 Ga0316053_121606 Ga0316053_1216061 113
354 3300034816 Ga0373930_0028914 Ga0373930_0028914_427_774 113
355 3300035083 Ga0373926_0076281 Ga0373926_0076281_624_971 113
356 3300035111 Ga0373923_0202046 Ga0373923_0202046_448_795 113
357 3300035113 Ga0373936_0158686 Ga0373936_0158686_583_933 113
358 3300035114 Ga0373939_0480864 Ga0373939_0480864_157_504 113
359 3300035118 Ga0373954_0349782 Ga0373954_0349782_104_451 113
360 3300035120 Ga0373957_0100472 Ga0373957_0100472_196_543 113
361 3300035121 Ga0373960_0041149 Ga0373960_0041149_273_620 113
362 3300035691 Ga0373931_0108949 Ga0373931_0108949_112_468 113
363 3300035692 Ga0373935_0595962 Ga0373935_0595962_377_733 113
364 3300035692 Ga0373935_0787022 Ga0373935_0787022_314_661 113
365 3300035695 Ga0373927_0467297 Ga0373927_0467297_17_364 113
366 3300035724 Ga0373933_0338377 Ga0373933_0338377_475_822 113
367 3300035724 Ga0373933_0616684 Ga0373933_0616684_31_378 113
368 3300035725 Ga0373947_0243524 Ga0373947_0243524_276_623 113
369 3300036401 Ga0373937_0301647 Ga0373937_0301647_835_1182 113
370 3300036401 Ga0373937_0888956 Ga0373937_0888956_43_390 113
371 3300037068 Ga0373925_0049214 Ga0373925_0049214_1678_2025 113
372 3300037068 Ga0373925_0341418 Ga0373925_0341418_704_1051 113
373 3300037068 Ga0373925_0400122 Ga0373925_0400122_356_703 113
374 3300037471 Ga0395905_0368151 Ga0395905_0368151_687_1046 113
375 3300037853 Ga0436364_0231405 Ga0436364_0231405_322_681 113
376 3300037853 Ga0436364_0514631 Ga0436364_0514631_70906_71265 113
377 3300037853 Ga0436364_0914454 Ga0436364_0914454_200_559 113
378 3300037853 Ga0436364_1373008 Ga0436364_1373008_1430_1789 113
379 3300039437 Ga0436365_0449880 Ga0436365_0449880_773_1129 113
380 3300039437 Ga0436365_1634803 Ga0436365_1634803_148_507 113
381 3300039437 Ga0436365_1788685 Ga0436365_1788685_1565_1915 113
382 3300039437 Ga0436365_1829761 Ga0436365_1829761_1433_1792 113
383 3300039438 Ga0436360_0751034 Ga0436360_0751034_1091_1450 113
384 3300039447 Ga0436361_0044958 Ga0436361_0044958_711_1070 113
385 3300039450 Ga0436363_0642921 Ga0436363_0642921_197_556 113
386 3300039450 Ga0436363_1324983 Ga0436363_1324983_12_362 113
387 3300039450 Ga0436363_1465113 Ga0436363_1465113_1002_1361 113
388 3300039453 Ga0436362_0583099 Ga0436362_0583099_148_507 113
389 3300039453 Ga0436362_0825019 Ga0436362_0825019_464_823 113
390 3300039453 Ga0436362_1124651 Ga0436362_1124651_766_1116 113
391 3300042438 Ga0439459_0033945 Ga0439459_0033945_172_519 113
392 3300044694 Ga0466963_0525947 Ga0466963_0525947_344_703 113
393 3300044842 Ga0466957_0695905 Ga0466957_0695905_296_655 113
394 3300045976 Ga0466967_0190672 Ga0466967_0190672_514_873 113
395 3300045976 Ga0466967_0214373 Ga0466967_0214373_894_1253 113
396 3300046472 Ga0495580_0867751 Ga0495580_0867751_16_363 113
397 3300046506 Ga0495583_0264251 Ga0495583_0264251_239_580 113
398 3300046512 Ga0495610_0038893 Ga0495610_0038893_1826_2167 113
399 3300046517 Ga0495630_0930501 Ga0495630_0930501_158_514 113
400 3300047317 Ga0495604_0560313 Ga0495604_0560313_18_365 113
401 3300047471 Ga0495684_0252445 Ga0495684_0252445_779_1135 113
402 3300048088 Ga0495602_1110135 Ga0495602_1110135_63_410 113
403 3300048907 Ga0496104_0054948 Ga0496104_0054948_2041_2388 113
404 3300048911 Ga0496108_0204850 Ga0496108_0204850_1313_1660 113
405 3300048912 Ga0496109_0597899 Ga0496109_0597899_127_474 113
406 3300048916 Ga0496113_0029775 Ga0496113_0029775_2281_2628 113
407 3300048918 Ga0496115_0131458 Ga0496115_0131458_1106_1465 113
408 3300049569 Ga0501032_0708824 Ga0501032_0708824_22_390 113
409 3300049571 Ga0501034_0443191 Ga0501034_0443191_594_962 113
410 3300049571 Ga0501034_0567320 Ga0501034_0567320_658_1008 113
411 3300049573 Ga0501037_0208185 Ga0501037_0208185_430_798 113
412 3300049575 Ga0501039_0637336 Ga0501039_0637336_310_678 113
413 3300049581 Ga0501047_0333554 Ga0501047_0333554_586_936 113
414 3300049588 Ga0501072_0467487 Ga0501072_0467487_404_754 113
415 3300049588 Ga0501072_0731623 Ga0501072_0731623_271_639 113
416 3300049589 Ga0501073_0046161 Ga0501073_0046161_1525_1875 113
417 3300049589 Ga0501073_0076174 Ga0501073_0076174_712_1080 113
418 3300049591 Ga0501075_0106785 Ga0501075_0106785_1665_2015 113
419 3300049592 Ga0501076_0051422 Ga0501076_0051422_2054_2404 113
420 3300049742 Ga0501080_0011900 Ga0501080_0011900_932_1282 113
421 3300049742 Ga0501080_0205184 Ga0501080_0205184_683_1051 113
422 3300049744 Ga0501083_0020754 Ga0501083_0020754_390_740 113
423 3300049822 Ga0501035_0994030 Ga0501035_0994030_255_623 113
424 3300049823 Ga0501044_0056947 Ga0501044_0056947_3143_3511 113
425 3300050513 nmdc:mga0rr50_653000_c1 nmdc:mga0rr50_653000_c1_338_685 113
426 3300050514 nmdc:mga08x19_601783_c1 nmdc:mga08x19_601783_c1_82_501 113
427 3300053086 Ga0500578_0507526 Ga0500578_0507526_38_409 113
428 3300053088 Ga0500644_0519985 Ga0500644_0519985_68_439 113
429 3300053142 Ga0500577_0369255 Ga0500577_0369255_143_514 113
430 3300053146 Ga0500588_0000231 Ga0500588_0000231_3051_3422 113
431 3300053151 Ga0500604_0097363 Ga0500604_0097363_146_487 113
432 3300054114 Ga0501084_0118284 Ga0501084_0118284_1238_1588 113
433 3300060353 Ga0501082_0279058 Ga0501082_0279058_38_388 113
434 3300061734 Ga0530510_0408070 Ga0530510_0408070_481_831 113
435 iso_pu_bacteria 2524023250 2524611787 113
436 iso_pu_bacteria 2848858292 2848861690 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

15

108

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8867 8 101
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.876 8 100
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8605 7 102
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8368 7 102
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8267 8 100
ID Description Score Start End Superfamily
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8872 7 101 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.878 7 101 2.60.300.12
af_O43045_97_205_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8767 7 107 2.60.300.12
af_Q2FZV8_4_111_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8661 9 111 2.60.300.12
af_P9WMN5_14_118_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8652 9 112 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A0R2Q3V8-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.9514 8 102 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A7K1F000-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9419 8 100 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A6N8UQF9-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.9375 1 102 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A2N6U6M5-F1-model_v4 deleted 0.9298 8 105
AF-A0A6N8UQF9-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.9286 1 102 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035

Feature Viewer

pLDDT pTM Quality
80.91 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map