F443524

General Info

Members Datasets Scaffolds Average Seq Length
436 262 872 158

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10330902|Ga0105244_103309022
Length 185
Sequence VTATLLQLTRNNTIVQQHRPDDEEQTAVAERLTTGDTAPDFTLPDDQGGEVSLSDLRGRKVIVYFYPAAMTPGCTTQACDFSDNINTLRGEGYEVLGISPDKPEKLAKFREKDGLTIRLLSDADKAVMNAYGAFGEKKLYGKTVEGVLRSTVVVDEDGKVSNAWYNVKATGHVAKLRKDLGLDAA

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
109 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
128 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
248 2643221561 Nocardioides sp. Root151 Isolate Unclassified
249 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
250 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
251 2643221696 Nocardioides sp. Root140 Isolate Unclassified
252 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
253 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
254 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
255 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
256 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
257 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
258 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
259 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
260 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
261 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
262 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 1.38
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 9.86
Nodule 0
Rhizoplane 9.86
Rhizosphere 75.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10330902 3300009036 Bacteria 703
2 JGI24735J21928_10010681 3300002067 Bacteria 2922
3 JGI24744J21845_10036387 3300002077 Bacteria 929
4 JGI25160J50197_1042665 3300003354 Bacteria 1030
5 Ga0070658_10176051 3300005327 Bacteria 1799
6 Ga0070683_100026776 3300005329 Bacteria 5195
7 Ga0070683_100213000 3300005329 Bacteria 1835
8 Ga0070683_101806077 3300005329 Bacteria 588
9 Ga0070680_100806137 3300005336 Bacteria 809
10 Ga0070682_100103961 3300005337 Bacteria 1880
11 Ga0068868_100068354 3300005338 Bacteria 2829
12 Ga0068868_101167900 3300005338 Bacteria 711
13 Ga0070687_100161600 3300005343 Bacteria 1325
14 Ga0070661_100667447 3300005344 Bacteria 845
15 Ga0070668_100213902 3300005347 Bacteria 1587
16 Ga0070675_100139034 3300005354 Bacteria 2075
17 Ga0070674_100011740 3300005356 Bacteria 5345
18 Ga0070659_100650399 3300005366 Bacteria 909
19 Ga0070667_100073609 3300005367 Bacteria 2913
20 Ga0070714_100013593 3300005435 Bacteria 6525
21 Ga0070701_10069693 3300005438 Bacteria 1876
22 Ga0070701_10860990 3300005438 Bacteria 623
23 Ga0070700_100021824 3300005441 Bacteria 3725
24 Ga0070663_100097857 3300005455 Bacteria 2185
25 Ga0070662_101602310 3300005457 Bacteria 562
26 Ga0068867_100028504 3300005459 Bacteria 4021
27 Ga0070685_10121700 3300005466 Bacteria 1621
28 Ga0070679_100010157 3300005530 Bacteria 8924
29 Ga0070684_100066877 3300005535 Bacteria 3155
30 Ga0070684_100372023 3300005535 Bacteria 1316
31 Ga0070684_100621884 3300005535 Bacteria 1005
32 Ga0070672_100026879 3300005543 Bacteria 4288
33 Ga0070672_100055485 3300005543 Bacteria 3104
34 Ga0070686_100371784 3300005544 Bacteria 1080
35 Ga0070693_100172706 3300005547 Bacteria 1386
36 Ga0070704_100386322 3300005549 Bacteria 1191
37 Ga0070664_100503957 3300005564 Bacteria 1116
38 Ga0068854_100054946 3300005578 Bacteria 2866
39 Ga0068856_100177368 3300005614 Bacteria 2143
40 Ga0068856_100474996 3300005614 Bacteria 1271
41 Ga0070702_100019313 3300005615 Bacteria 3552
42 Ga0068852_100227042 3300005616 Bacteria 1778
43 Ga0068861_100033263 3300005719 Bacteria 3802
44 Ga0068858_100528826 3300005842 Bacteria 1141
45 Ga0068860_100000467 3300005843 Bacteria 50515
46 Ga0081538_10031250 3300005981 Bacteria 3596
47 Ga0075365_10049283 3300006038 Bacteria 2775
48 Ga0075365_10123679 3300006038 Bacteria 1786
49 Ga0075365_10205728 3300006038 Bacteria 1379
50 Ga0075365_10289097 3300006038 Bacteria 1153
51 Ga0075365_10371898 3300006038 Bacteria 1008
52 Ga0075368_10116422 3300006042 Bacteria 1105
53 Ga0075363_100015048 3300006048 Bacteria 3794
54 Ga0075363_100032153 3300006048 Bacteria 2724
55 Ga0075364_10004217 3300006051 Bacteria 8255
56 Ga0075364_10072696 3300006051 Bacteria 2266
57 Ga0075364_10083036 3300006051 Bacteria 2120
58 Ga0075364_10404446 3300006051 Bacteria 932
59 Ga0075362_10143650 3300006177 Bacteria 1141
60 Ga0075362_10207934 3300006177 Bacteria 954
61 Ga0075367_10269827 3300006178 Bacteria 1069
62 Ga0075367_10274761 3300006178 Bacteria 1059
63 Ga0075370_10012450 3300006353 Bacteria 4495
64 Ga0075370_10040896 3300006353 Bacteria 2616
65 Ga0075370_10059783 3300006353 Bacteria 2170
66 Ga0075428_101098449 3300006844 Bacteria 840
67 Ga0068865_100057488 3300006881 Bacteria 2713
68 Ga0105251_10003022 3300009011 Bacteria 12546
69 Ga0105250_10030223 3300009092 Bacteria 2178
70 Ga0111539_10059999 3300009094 Bacteria 4509
71 Ga0111539_10463220 3300009094 Bacteria 1476
72 Ga0105245_10013621 3300009098 Bacteria 7083
73 Ga0105245_10284460 3300009098 Bacteria 1617
74 Ga0105247_10731711 3300009101 Bacteria 748
75 Ga0105248_10049717 3300009177 Bacteria 4702
76 Ga0105248_10211808 3300009177 Bacteria 2183
77 Ga0105248_10475416 3300009177 Bacteria 1409
78 Ga0105237_11418502 3300009545 Bacteria 701
79 Ga0105238_10567695 3300009551 Bacteria 1140
80 Ga0105249_10486249 3300009553 Bacteria 1278
81 Ga0105239_10892719 3300010375 Bacteria 1020
82 Ga0105246_10049302 3300011119 Bacteria 2883
83 Ga0157369_11230771 3300013105 Bacteria 764
84 Ga0157374_10787532 3300013296 Bacteria 966
85 Ga0157372_10066313 3300013307 Bacteria 4055
86 Ga0157372_10282187 3300013307 Bacteria 1931
87 Ga0157375_12235654 3300013308 Bacteria 652
88 Ga0163163_10069428 3300014325 Bacteria 3508
89 Ga0157380_10159014 3300014326 Bacteria 1962
90 Ga0157380_12688223 3300014326 Bacteria 564
91 Ga0157377_11123007 3300014745 Bacteria 604
92 Ga0163161_10317414 3300017792 Bacteria 1231
93 Ga0163161_10361469 3300017792 Bacteria 1156
94 Ga0206356_11168271 3300020070 Bacteria 1976
95 Ga0206354_10717165 3300020081 Bacteria 1090
96 Ga0206353_11265299 3300020082 Bacteria 1340
97 Ga0206353_11611142 3300020082 Bacteria 1038
98 Ga0206353_11616660 3300020082 Bacteria 739
99 Ga0206353_11672172 3300020082 Bacteria 2407
100 Ga0207697_10119611 3300025315 Bacteria 1132
101 Ga0207696_1083017 3300025711 Bacteria 883
102 Ga0207713_1008837 3300025735 Bacteria 5742
103 Ga0207642_10017659 3300025899 Bacteria 2720
104 Ga0207647_10058012 3300025904 Bacteria 2372
105 Ga0207705_10006094 3300025909 Bacteria 8973
106 Ga0207705_10013449 3300025909 Bacteria 5903
107 Ga0207662_10597156 3300025918 Bacteria 768
108 Ga0207657_10651424 3300025919 Bacteria 820
109 Ga0207694_10140439 3300025924 Bacteria 1942
110 Ga0207659_10259865 3300025926 Bacteria 1412
111 Ga0207664_10140332 3300025929 Bacteria 2043
112 Ga0207644_11398943 3300025931 Bacteria 588
113 Ga0207690_10158667 3300025932 Bacteria 1684
114 Ga0207709_10107641 3300025935 Bacteria 1857
115 Ga0207709_10191052 3300025935 Bacteria 1454
116 Ga0207669_10081251 3300025937 Bacteria 2076
117 Ga0207704_10249730 3300025938 Bacteria 1331
118 Ga0207704_10655386 3300025938 Bacteria 865
119 Ga0207691_10032667 3300025940 Bacteria 4851
120 Ga0207691_10195697 3300025940 Bacteria 1761
121 Ga0207711_10452100 3300025941 Bacteria 1196
122 Ga0207711_10456681 3300025941 Bacteria 1189
123 Ga0207689_10496422 3300025942 Bacteria 1022
124 Ga0207661_10045310 3300025944 Bacteria 3481
125 Ga0207661_10117050 3300025944 Bacteria 2263
126 Ga0207661_10501781 3300025944 Bacteria 1109
127 Ga0207679_10211999 3300025945 Bacteria 1625
128 Ga0207667_10445014 3300025949 Bacteria 1317
129 Ga0207651_10940564 3300025960 Bacteria 771
130 Ga0207712_10616934 3300025961 Bacteria 940
131 Ga0207668_10251712 3300025972 Bacteria 1435
132 Ga0207640_10795997 3300025981 Bacteria 819
133 Ga0207658_11223981 3300025986 Bacteria 686
134 Ga0207677_10030465 3300026023 Bacteria 3444
135 Ga0207678_10000142 3300026067 Bacteria 58921
136 Ga0207678_10071556 3300026067 Bacteria 2974
137 Ga0207678_11323733 3300026067 Bacteria 637
138 Ga0207708_10014578 3300026075 Bacteria 5880
139 Ga0207702_10548674 3300026078 Bacteria 1130
140 Ga0207648_10013220 3300026089 Bacteria 7690
141 Ga0207648_11209870 3300026089 Bacteria 710
142 Ga0207676_10799812 3300026095 Bacteria 920
143 Ga0207675_100040791 3300026118 Bacteria 4335
144 Ga0207698_11040338 3300026142 Bacteria 830
145 Ga0207698_11065891 3300026142 Bacteria 820
146 Ga0207698_11388099 3300026142 Bacteria 717
147 Ga0209813_10215099 3300027866 Bacteria 717
148 Ga0268266_11113140 3300028379 Bacteria 764
149 Ga0268264_10001967 3300028381 Bacteria 18458
150 Ga0316181_1149033 3300030744 Bacteria 1626
151 Ga0316182_1326917 3300030745 Bacteria 4429
152 Ga0265327_10000067 3300031251 Bacteria 221289
153 Ga0307508_10047185 3300031616 Bacteria 3843
154 Ga0316578_10251298 3300031728 Bacteria 1061
155 Ga0307405_10826591 3300031731 Bacteria 778
156 Ga0307411_10174039 3300032005 Bacteria 1627
157 Ga0307507_10000024 3300033179 Bacteria 212340
158 Ga0307510_10090012 3300033180 Bacteria 2918
159 Ga0316214_1049938 3300033545 Bacteria 606
160 Ga0373952_0232698 3300035092 Bacteria 552
161 Ga0373941_0167146 3300035115 Bacteria 818
162 Ga0373960_0141830 3300035121 Bacteria 814
163 Ga0316574_0278395 3300035398 Bacteria 1066
164 Ga0395900_0061074 3300037418 Bacteria 3876
165 Ga0395900_0869042 3300037418 Bacteria 826
166 Ga0395898_0001822 3300037466 Bacteria 27492
167 Ga0395898_0018565 3300037466 Bacteria 7090
168 Ga0395898_0306118 3300037466 Bacteria 1516
169 Ga0395898_0473296 3300037466 Bacteria 1192
170 Ga0395905_0021190 3300037471 Bacteria 6151
171 Ga0395901_0179050 3300038443 Bacteria 2223
172 Ga0395901_1587625 3300038443 Bacteria 608
173 Ga0439465_0034597 3300041413 Bacteria 1618
174 Ga0451787_583455 3300041441 Bacteria 542
175 Ga0451835_0344990 3300041492 Bacteria 796
176 Ga0451837_0073445 3300041494 Bacteria 727
177 Ga0451851_1122084 3300041507 Bacteria 1229
178 Ga0451843_0965377 3300041509 Bacteria 1954
179 Ga0439458_0105225 3300042157 Bacteria 735
180 Ga0439434_0094524 3300042435 Bacteria 959
181 Ga0466969_0001786 3300044656 Bacteria 11460
182 Ga0466972_0168914 3300044658 Bacteria 1027
183 Ga0466965_0030303 3300044683 Bacteria 2636
184 Ga0466965_0109979 3300044683 Bacteria 1415
185 Ga0466965_0263303 3300044683 Bacteria 927
186 Ga0466965_0443986 3300044683 Bacteria 722
187 Ga0466965_0554394 3300044683 Bacteria 649
188 Ga0466966_0126883 3300044684 Bacteria 1564
189 Ga0466966_0212037 3300044684 Bacteria 1170
190 Ga0466966_0336350 3300044684 Bacteria 907
191 Ga0466966_0908248 3300044684 Bacteria 531
192 Ga0466961_0007005 3300044693 Bacteria 7172
193 Ga0466961_0019879 3300044693 Bacteria 4322
194 Ga0466961_0035792 3300044693 Bacteria 3188
195 Ga0466961_0076538 3300044693 Bacteria 2121
196 Ga0466961_0149080 3300044693 Bacteria 1461
197 Ga0466963_0001141 3300044694 Bacteria 13887
198 Ga0466963_0001645 3300044694 Bacteria 12172
199 Ga0466963_0069566 3300044694 Bacteria 2366
200 Ga0466964_0061126 3300044706 Bacteria 1568
201 Ga0466964_0756961 3300044706 Bacteria 546
202 Ga0466971_0000483 3300044719 Bacteria 15651
203 Ga0466971_0093457 3300044719 Bacteria 1378
204 Ga0466971_0244472 3300044719 Bacteria 854
205 Ga0466970_0025267 3300044765 Bacteria 3109
206 Ga0466970_0133927 3300044765 Bacteria 1362
207 Ga0466970_0259393 3300044765 Bacteria 975
208 Ga0466970_0291960 3300044765 Bacteria 918
209 Ga0466970_0631144 3300044765 Bacteria 623
210 Ga0466970_0634973 3300044765 Bacteria 621
211 Ga0466970_0735601 3300044765 Bacteria 576
212 Ga0466957_0261515 3300044842 Bacteria 1153
213 Ga0466960_0105842 3300044901 Bacteria 1455
214 Ga0466960_0111755 3300044901 Bacteria 1420
215 Ga0466960_0147422 3300044901 Bacteria 1254
216 Ga0466960_0217505 3300044901 Bacteria 1050
217 Ga0466960_0329173 3300044901 Bacteria 867
218 Ga0466960_0550730 3300044901 Bacteria 680
219 Ga0466959_0217906 3300045049 Bacteria 1324
220 Ga0466959_0847906 3300045049 Bacteria 610
221 Ga0466958_0007029 3300045836 Bacteria 6158
222 Ga0466958_0106476 3300045836 Bacteria 1748
223 Ga0466967_0000698 3300045976 Bacteria 17093
224 Ga0466967_0015684 3300045976 Bacteria 5949
225 Ga0466967_0032135 3300045976 Bacteria 4428
226 Ga0466967_0062588 3300045976 Bacteria 3304
227 Ga0466967_0105236 3300045976 Bacteria 2585
228 Ga0466967_0177519 3300045976 Bacteria 2007
229 Ga0466967_0187884 3300045976 Bacteria 1951
230 Ga0466967_0278517 3300045976 Bacteria 1604
231 Ga0495592_0026996 3300046454 Bacteria 4353
232 Ga0495629_0187971 3300046459 Bacteria 1430
233 Ga0495651_0000538 3300046462 Bacteria 29264
234 Ga0495662_0009566 3300046476 Bacteria 4752
235 Ga0495662_0010601 3300046476 Bacteria 4507
236 Ga0495662_0174977 3300046476 Bacteria 1058
237 Ga0495662_0267129 3300046476 Bacteria 842
238 Ga0495594_0072143 3300046499 Bacteria 1920
239 Ga0495596_0430636 3300046500 Bacteria 514
240 Ga0495608_0280663 3300046511 Bacteria 1034
241 Ga0495616_0312797 3300046513 Bacteria 661
242 Ga0495618_0024075 3300046514 Bacteria 3768
243 Ga0495620_0428052 3300046515 Bacteria 501
244 Ga0495628_0151028 3300046516 Bacteria 1769
245 Ga0495628_0255674 3300046516 Bacteria 1306
246 Ga0495630_0067005 3300046517 Bacteria 2699
247 Ga0495652_0009795 3300046529 Bacteria 8689
248 Ga0495640_0155169 3300046533 Bacteria 1469
249 Ga0495645_0079048 3300046543 Bacteria 2363
250 Ga0495645_0104307 3300046543 Bacteria 2014
251 Ga0495634_0520480 3300046642 Bacteria 696
252 Ga0495611_0034980 3300046648 Bacteria 2223
253 Ga0495657_0007690 3300046675 Bacteria 8297
254 Ga0495657_0030481 3300046675 Bacteria 3778
255 Ga0495623_0008916 3300046679 Bacteria 6512
256 Ga0495646_0008999 3300046680 Bacteria 6337
257 Ga0495613_0029523 3300046689 Bacteria 4076
258 Ga0495613_0253196 3300046689 Bacteria 1228
259 Ga0495613_0968945 3300046689 Bacteria 547
260 Ga0495670_0125654 3300046691 Bacteria 1335
261 Ga0495600_0296083 3300046809 Bacteria 1021
262 Ga0495581_0091688 3300047315 Bacteria 1763
263 Ga0495676_0388372 3300047321 Bacteria 928
264 Ga0495680_0095573 3300047322 Bacteria 2221
265 Ga0495683_0096938 3300047323 Bacteria 1422
266 Ga0495675_0055962 3300047444 Bacteria 2501
267 Ga0495593_0039158 3300047673 Bacteria 2557
268 Ga0495593_0283144 3300047673 Bacteria 829
269 Ga0495602_0106099 3300048088 Bacteria 2294
270 Ga0495614_0080053 3300048089 Bacteria 1415
271 Ga0496100_0115177 3300048903 Bacteria 1874
272 Ga0496100_1088377 3300048903 Bacteria 630
273 Ga0496101_0023635 3300048904 Bacteria 4248
274 Ga0496101_0399066 3300048904 Bacteria 1083
275 Ga0496102_0003445 3300048905 Bacteria 13408
276 Ga0496102_0006253 3300048905 Bacteria 10155
277 Ga0496102_0046027 3300048905 Bacteria 3962
278 Ga0496102_0086343 3300048905 Bacteria 2898
279 Ga0496103_0029565 3300048906 Bacteria 3331
280 Ga0496103_0405514 3300048906 Bacteria 876
281 Ga0496104_0001209 3300048907 Bacteria 22205
282 Ga0496104_0429669 3300048907 Bacteria 1233
283 Ga0496105_0013839 3300048908 Bacteria 6408
284 Ga0496105_0211631 3300048908 Bacteria 1580
285 Ga0496106_0116361 3300048909 Bacteria 2085
286 Ga0496106_0558904 3300048909 Bacteria 918
287 Ga0496106_1184812 3300048909 Bacteria 596
288 Ga0496106_1332955 3300048909 Bacteria 556
289 Ga0496107_0076722 3300048910 Bacteria 2434
290 Ga0496108_0012819 3300048911 Bacteria 6827
291 Ga0496108_0187959 3300048911 Bacteria 1790
292 Ga0496108_0282281 3300048911 Bacteria 1445
293 Ga0496108_0311884 3300048911 Bacteria 1371
294 Ga0496108_0567682 3300048911 Bacteria 989
295 Ga0496109_0000648 3300048912 Bacteria 28867
296 Ga0496109_0062906 3300048912 Bacteria 3394
297 Ga0496109_0259131 3300048912 Bacteria 1638
298 Ga0496109_0414019 3300048912 Bacteria 1273
299 Ga0496109_0880497 3300048912 Bacteria 833
300 Ga0496110_0000643 3300048913 Bacteria 23948
301 Ga0496111_0012348 3300048914 Bacteria 5779
302 Ga0496111_0450595 3300048914 Bacteria 949
303 Ga0496111_0472782 3300048914 Bacteria 924
304 Ga0496113_0029251 3300048916 Bacteria 3976
305 Ga0496113_0040670 3300048916 Bacteria 3427
306 Ga0496113_0251586 3300048916 Bacteria 1411
307 Ga0496114_0022751 3300048917 Bacteria 5109
308 Ga0496114_0039279 3300048917 Bacteria 3916
309 Ga0496114_0058786 3300048917 Bacteria 3211
310 Ga0496114_0242969 3300048917 Bacteria 1584
311 Ga0496114_0441982 3300048917 Bacteria 1152
312 Ga0496114_0450838 3300048917 Bacteria 1139
313 Ga0496117_0370955 3300048920 Bacteria 732
314 Ga0496119_0000055 3300048922 Bacteria 180121
315 Ga0496120_0004029 3300048923 Bacteria 12739
316 Ga0501031_0003034 3300049568 Bacteria 10734
317 Ga0501031_0176614 3300049568 Bacteria 1395
318 Ga0501033_0010528 3300049570 Bacteria 7092
319 Ga0501034_0156374 3300049571 Bacteria 2253
320 Ga0501036_0015788 3300049572 Bacteria 6309
321 Ga0501036_0063535 3300049572 Bacteria 3126
322 Ga0501036_0142350 3300049572 Bacteria 2023
323 Ga0501036_0933504 3300049572 Bacteria 712
324 Ga0501037_0032097 3300049573 Bacteria 3877
325 Ga0501037_0053435 3300049573 Bacteria 2955
326 Ga0501037_0248651 3300049573 Bacteria 1245
327 Ga0501038_0002881 3300049574 Bacteria 16046
328 Ga0501038_0013338 3300049574 Bacteria 7495
329 Ga0501039_0035278 3300049575 Bacteria 3860
330 Ga0501039_0042261 3300049575 Bacteria 3521
331 Ga0501040_0009363 3300049576 Bacteria 6382
332 Ga0501040_0018439 3300049576 Bacteria 4633
333 Ga0501041_0003349 3300049577 Bacteria 9224
334 Ga0501042_0017702 3300049578 Bacteria 4918
335 Ga0501043_0276873 3300049579 Bacteria 1287
336 Ga0501046_0087276 3300049580 Bacteria 2404
337 Ga0501046_0098948 3300049580 Bacteria 2239
338 Ga0501046_0176506 3300049580 Bacteria 1600
339 Ga0501047_0039336 3300049581 Bacteria 4575
340 Ga0501047_0285127 3300049581 Bacteria 1495
341 Ga0501048_0028452 3300049582 Bacteria 4056
342 Ga0501048_0245245 3300049582 Bacteria 1271
343 Ga0501048_0661007 3300049582 Bacteria 750
344 Ga0501067_0227615 3300049583 Bacteria 1038
345 Ga0501068_0036917 3300049584 Bacteria 2924
346 Ga0501068_0500526 3300049584 Bacteria 788
347 Ga0501069_0485095 3300049585 Bacteria 737
348 Ga0501071_0075721 3300049587 Bacteria 2457
349 Ga0501071_0076867 3300049587 Bacteria 2438
350 Ga0501071_0217940 3300049587 Bacteria 1436
351 Ga0501071_0403256 3300049587 Bacteria 1044
352 Ga0501072_0069434 3300049588 Bacteria 2782
353 Ga0501072_0357519 3300049588 Bacteria 1159
354 Ga0501073_0023604 3300049589 Bacteria 4414
355 Ga0501073_0405845 3300049589 Bacteria 941
356 Ga0501073_0925168 3300049589 Bacteria 600
357 Ga0501074_0225985 3300049590 Bacteria 1332
358 Ga0501074_0370029 3300049590 Bacteria 1017
359 Ga0501074_0595429 3300049590 Bacteria 782
360 Ga0501075_0006482 3300049591 Bacteria 8056
361 Ga0501076_0004481 3300049592 Bacteria 9946
362 Ga0501076_0035134 3300049592 Bacteria 3921
363 Ga0501076_0556462 3300049592 Bacteria 946
364 Ga0501077_0018243 3300049593 Bacteria 4440
365 Ga0501079_0008786 3300049741 Bacteria 7656
366 Ga0501079_0110737 3300049741 Bacteria 2133
367 Ga0501080_0062977 3300049742 Bacteria 3452
368 Ga0501080_0064991 3300049742 Bacteria 3394
369 Ga0501081_0451555 3300049743 Bacteria 955
370 Ga0501083_0079099 3300049744 Bacteria 2181
371 Ga0501241_072486 3300049758 Bacteria 706
372 Ga0501035_0015452 3300049822 Bacteria 7041
373 Ga0501035_0080793 3300049822 Bacteria 2870
374 Ga0501035_0325671 3300049822 Bacteria 1290
375 Ga0501044_0031744 3300049823 Bacteria 5556
376 Ga0501044_0298178 3300049823 Bacteria 1541
377 Ga0501045_0021138 3300049824 Bacteria 4653
378 Ga0501045_0079009 3300049824 Bacteria 2425
379 Ga0501045_0120850 3300049824 Bacteria 1945
380 Ga0501045_0271784 3300049824 Bacteria 1262
381 nmdc:mga03683_264011_c1 3300050489 Bacteria 802
382 nmdc:mga03n38_2207_c1 3300050490 Bacteria 5945
383 nmdc:mga03n38_7801_c1 3300050490 Bacteria 3801
384 nmdc:mga00v17_113959_c1 3300050491 Bacteria 1366
385 nmdc:mga00v17_186276_c1 3300050491 Bacteria 1340
386 nmdc:mga00v17_247173_c1 3300050491 Bacteria 1157
387 nmdc:mga00v17_83342_c1 3300050491 Bacteria 2000
388 nmdc:mga00v17_8843_c1 3300050491 Bacteria 5429
389 nmdc:mga00v17_928676_c1 3300050491 Bacteria 550
390 nmdc:mga0yw44_130938_c1 3300050492 Bacteria 1624
391 nmdc:mga0yw44_37247_c1 3300050492 Bacteria 2871
392 nmdc:mga0yw44_38987_c1 3300050492 Bacteria 2814
393 nmdc:mga0yw44_429062_c1 3300050492 Bacteria 895
394 nmdc:mga0yw44_496919_c1 3300050492 Bacteria 828
395 nmdc:mga06z11_221499_c1 3300050494 Bacteria 1106
396 nmdc:mga06z11_361710_c1 3300050494 Bacteria 870
397 nmdc:mga06z11_49149_c1 3300050494 Bacteria 2150
398 nmdc:mga04h51_45584_c1 3300050495 Bacteria 1450
399 nmdc:mga07m45_13363_c1 3300050496 Bacteria 4357
400 nmdc:mga07m45_9413_c1 3300050496 Bacteria 5068
401 nmdc:mga08y16_146145_c1 3300050511 Bacteria 2458
402 nmdc:mga08y16_427374_c1 3300050511 Bacteria 1353
403 nmdc:mga0sz30_428478_c1 3300050516 Bacteria 593
404 Ga0495601_0159163 3300053077 Bacteria 1475
405 Ga0495612_0000355 3300053078 Bacteria 18574
406 Ga0495655_0100504 3300053083 Bacteria 856
407 Ga0495595_0302169 3300053084 Bacteria 805
408 Ga0495619_0033281 3300053085 Bacteria 3348
409 Ga0500641_0099436 3300053096 Bacteria 1247
410 Ga0501084_0027041 3300054114 Bacteria 4793
411 Ga0501084_0888270 3300054114 Bacteria 750
412 Ga0501082_0156414 3300060353 Bacteria 1980
413 Ga0501082_1345731 3300060353 Bacteria 624
414 Ga0466962_0004207 3300061719 Bacteria 6892
415 Ga0466962_0069221 3300061719 Bacteria 1686
416 Ga0466962_0133483 3300061719 Bacteria 1201
417 Ga0466962_0300293 3300061719 Bacteria 794
418 Ga0530510_0005897 3300061734 Bacteria 8492
419 Ga0530510_0173008 3300061734 Bacteria 1600
420 Ga0530510_0507041 3300061734 Bacteria 915
421 2616697505 2616644814 Bacteria 11555299
422 2643827993 2643221561 Bacteria 4984412
423 2643853542 2643221567 Bacteria 4163945
424 2644137510 2643221624 Bacteria 4384879
425 2644531082 2643221696 Bacteria 5431823
426 2808874955 2808606365 Bacteria 4301966
427 2808920129 2808606375 Bacteria 9466072
428 2857483225 2857481737 Bacteria 4761446
429 2869063727 2869061728 Bacteria 7112407
430 2984577213 2984576629 Bacteria 4248407
431 2990260888 2990256926 Bacteria 4252839
432 2997456796 2997451912 Bacteria 8492419
433 3006426051 3006425503 Bacteria 6491253
434 8025486235 8025478263 Bacteria 8209203
435 8056668072 8056667051 Bacteria 6953971
436 8057575311 8057568493 Bacteria 7221719
437 Ga0105244_10330902
438 JGI24735J21928_10010681
439 JGI24744J21845_10036387
440 JGI25160J50197_1042665
441 Ga0070658_10176051
442 Ga0070683_100026776
443 Ga0070683_100213000
444 Ga0070683_101806077
445 Ga0070680_100806137
446 Ga0070682_100103961
447 Ga0068868_100068354
448 Ga0068868_101167900
449 Ga0070687_100161600
450 Ga0070661_100667447
451 Ga0070668_100213902
452 Ga0070675_100139034
453 Ga0070674_100011740
454 Ga0070659_100650399
455 Ga0070667_100073609
456 Ga0070714_100013593
457 Ga0070701_10069693
458 Ga0070701_10860990
459 Ga0070700_100021824
460 Ga0070663_100097857
461 Ga0070662_101602310
462 Ga0068867_100028504
463 Ga0070685_10121700
464 Ga0070679_100010157
465 Ga0070684_100066877
466 Ga0070684_100372023
467 Ga0070684_100621884
468 Ga0070672_100026879
469 Ga0070672_100055485
470 Ga0070686_100371784
471 Ga0070693_100172706
472 Ga0070704_100386322
473 Ga0070664_100503957
474 Ga0068854_100054946
475 Ga0068856_100177368
476 Ga0068856_100474996
477 Ga0070702_100019313
478 Ga0068852_100227042
479 Ga0068861_100033263
480 Ga0068858_100528826
481 Ga0068860_100000467
482 Ga0081538_10031250
483 Ga0075365_10049283
484 Ga0075365_10123679
485 Ga0075365_10205728
486 Ga0075365_10289097
487 Ga0075365_10371898
488 Ga0075368_10116422
489 Ga0075363_100015048
490 Ga0075363_100032153
491 Ga0075364_10004217
492 Ga0075364_10072696
493 Ga0075364_10083036
494 Ga0075364_10404446
495 Ga0075362_10143650
496 Ga0075362_10207934
497 Ga0075367_10269827
498 Ga0075367_10274761
499 Ga0075370_10012450
500 Ga0075370_10040896
501 Ga0075370_10059783
502 Ga0075428_101098449
503 Ga0068865_100057488
504 Ga0105251_10003022
505 Ga0105250_10030223
506 Ga0111539_10059999
507 Ga0111539_10463220
508 Ga0105245_10013621
509 Ga0105245_10284460
510 Ga0105247_10731711
511 Ga0105248_10049717
512 Ga0105248_10211808
513 Ga0105248_10475416
514 Ga0105237_11418502
515 Ga0105238_10567695
516 Ga0105249_10486249
517 Ga0105239_10892719
518 Ga0105246_10049302
519 Ga0157369_11230771
520 Ga0157374_10787532
521 Ga0157372_10066313
522 Ga0157372_10282187
523 Ga0157375_12235654
524 Ga0163163_10069428
525 Ga0157380_10159014
526 Ga0157380_12688223
527 Ga0157377_11123007
528 Ga0163161_10317414
529 Ga0163161_10361469
530 Ga0206356_11168271
531 Ga0206354_10717165
532 Ga0206353_11265299
533 Ga0206353_11611142
534 Ga0206353_11616660
535 Ga0206353_11672172
536 Ga0207697_10119611
537 Ga0207696_1083017
538 Ga0207713_1008837
539 Ga0207642_10017659
540 Ga0207647_10058012
541 Ga0207705_10006094
542 Ga0207705_10013449
543 Ga0207662_10597156
544 Ga0207657_10651424
545 Ga0207694_10140439
546 Ga0207659_10259865
547 Ga0207664_10140332
548 Ga0207644_11398943
549 Ga0207690_10158667
550 Ga0207709_10107641
551 Ga0207709_10191052
552 Ga0207669_10081251
553 Ga0207704_10249730
554 Ga0207704_10655386
555 Ga0207691_10032667
556 Ga0207691_10195697
557 Ga0207711_10452100
558 Ga0207711_10456681
559 Ga0207689_10496422
560 Ga0207661_10045310
561 Ga0207661_10117050
562 Ga0207661_10501781
563 Ga0207679_10211999
564 Ga0207667_10445014
565 Ga0207651_10940564
566 Ga0207712_10616934
567 Ga0207668_10251712
568 Ga0207640_10795997
569 Ga0207658_11223981
570 Ga0207677_10030465
571 Ga0207678_10000142
572 Ga0207678_10071556
573 Ga0207678_11323733
574 Ga0207708_10014578
575 Ga0207702_10548674
576 Ga0207648_10013220
577 Ga0207648_11209870
578 Ga0207676_10799812
579 Ga0207675_100040791
580 Ga0207698_11040338
581 Ga0207698_11065891
582 Ga0207698_11388099
583 Ga0209813_10215099
584 Ga0268266_11113140
585 Ga0268264_10001967
586 Ga0316181_1149033
587 Ga0316182_1326917
588 Ga0265327_10000067
589 Ga0307508_10047185
590 Ga0316578_10251298
591 Ga0307405_10826591
592 Ga0307411_10174039
593 Ga0307507_10000024
594 Ga0307510_10090012
595 Ga0316214_1049938
596 Ga0373952_0232698
597 Ga0373941_0167146
598 Ga0373960_0141830
599 Ga0316574_0278395
600 Ga0395900_0061074
601 Ga0395900_0869042
602 Ga0395898_0001822
603 Ga0395898_0018565
604 Ga0395898_0306118
605 Ga0395898_0473296
606 Ga0395905_0021190
607 Ga0395901_0179050
608 Ga0395901_1587625
609 Ga0439465_0034597
610 Ga0451787_583455
611 Ga0451835_0344990
612 Ga0451837_0073445
613 Ga0451851_1122084
614 Ga0451843_0965377
615 Ga0439458_0105225
616 Ga0439434_0094524
617 Ga0466969_0001786
618 Ga0466972_0168914
619 Ga0466965_0030303
620 Ga0466965_0109979
621 Ga0466965_0263303
622 Ga0466965_0443986
623 Ga0466965_0554394
624 Ga0466966_0126883
625 Ga0466966_0212037
626 Ga0466966_0336350
627 Ga0466966_0908248
628 Ga0466961_0007005
629 Ga0466961_0019879
630 Ga0466961_0035792
631 Ga0466961_0076538
632 Ga0466961_0149080
633 Ga0466963_0001141
634 Ga0466963_0001645
635 Ga0466963_0069566
636 Ga0466964_0061126
637 Ga0466964_0756961
638 Ga0466971_0000483
639 Ga0466971_0093457
640 Ga0466971_0244472
641 Ga0466970_0025267
642 Ga0466970_0133927
643 Ga0466970_0259393
644 Ga0466970_0291960
645 Ga0466970_0631144
646 Ga0466970_0634973
647 Ga0466970_0735601
648 Ga0466957_0261515
649 Ga0466960_0105842
650 Ga0466960_0111755
651 Ga0466960_0147422
652 Ga0466960_0217505
653 Ga0466960_0329173
654 Ga0466960_0550730
655 Ga0466959_0217906
656 Ga0466959_0847906
657 Ga0466958_0007029
658 Ga0466958_0106476
659 Ga0466967_0000698
660 Ga0466967_0015684
661 Ga0466967_0032135
662 Ga0466967_0062588
663 Ga0466967_0105236
664 Ga0466967_0177519
665 Ga0466967_0187884
666 Ga0466967_0278517
667 Ga0495592_0026996
668 Ga0495629_0187971
669 Ga0495651_0000538
670 Ga0495662_0009566
671 Ga0495662_0010601
672 Ga0495662_0174977
673 Ga0495662_0267129
674 Ga0495594_0072143
675 Ga0495596_0430636
676 Ga0495608_0280663
677 Ga0495616_0312797
678 Ga0495618_0024075
679 Ga0495620_0428052
680 Ga0495628_0151028
681 Ga0495628_0255674
682 Ga0495630_0067005
683 Ga0495652_0009795
684 Ga0495640_0155169
685 Ga0495645_0079048
686 Ga0495645_0104307
687 Ga0495634_0520480
688 Ga0495611_0034980
689 Ga0495657_0007690
690 Ga0495657_0030481
691 Ga0495623_0008916
692 Ga0495646_0008999
693 Ga0495613_0029523
694 Ga0495613_0253196
695 Ga0495613_0968945
696 Ga0495670_0125654
697 Ga0495600_0296083
698 Ga0495581_0091688
699 Ga0495676_0388372
700 Ga0495680_0095573
701 Ga0495683_0096938
702 Ga0495675_0055962
703 Ga0495593_0039158
704 Ga0495593_0283144
705 Ga0495602_0106099
706 Ga0495614_0080053
707 Ga0496100_0115177
708 Ga0496100_1088377
709 Ga0496101_0023635
710 Ga0496101_0399066
711 Ga0496102_0003445
712 Ga0496102_0006253
713 Ga0496102_0046027
714 Ga0496102_0086343
715 Ga0496103_0029565
716 Ga0496103_0405514
717 Ga0496104_0001209
718 Ga0496104_0429669
719 Ga0496105_0013839
720 Ga0496105_0211631
721 Ga0496106_0116361
722 Ga0496106_0558904
723 Ga0496106_1184812
724 Ga0496106_1332955
725 Ga0496107_0076722
726 Ga0496108_0012819
727 Ga0496108_0187959
728 Ga0496108_0282281
729 Ga0496108_0311884
730 Ga0496108_0567682
731 Ga0496109_0000648
732 Ga0496109_0062906
733 Ga0496109_0259131
734 Ga0496109_0414019
735 Ga0496109_0880497
736 Ga0496110_0000643
737 Ga0496111_0012348
738 Ga0496111_0450595
739 Ga0496111_0472782
740 Ga0496113_0029251
741 Ga0496113_0040670
742 Ga0496113_0251586
743 Ga0496114_0022751
744 Ga0496114_0039279
745 Ga0496114_0058786
746 Ga0496114_0242969
747 Ga0496114_0441982
748 Ga0496114_0450838
749 Ga0496117_0370955
750 Ga0496119_0000055
751 Ga0496120_0004029
752 Ga0501031_0003034
753 Ga0501031_0176614
754 Ga0501033_0010528
755 Ga0501034_0156374
756 Ga0501036_0015788
757 Ga0501036_0063535
758 Ga0501036_0142350
759 Ga0501036_0933504
760 Ga0501037_0032097
761 Ga0501037_0053435
762 Ga0501037_0248651
763 Ga0501038_0002881
764 Ga0501038_0013338
765 Ga0501039_0035278
766 Ga0501039_0042261
767 Ga0501040_0009363
768 Ga0501040_0018439
769 Ga0501041_0003349
770 Ga0501042_0017702
771 Ga0501043_0276873
772 Ga0501046_0087276
773 Ga0501046_0098948
774 Ga0501046_0176506
775 Ga0501047_0039336
776 Ga0501047_0285127
777 Ga0501048_0028452
778 Ga0501048_0245245
779 Ga0501048_0661007
780 Ga0501067_0227615
781 Ga0501068_0036917
782 Ga0501068_0500526
783 Ga0501069_0485095
784 Ga0501071_0075721
785 Ga0501071_0076867
786 Ga0501071_0217940
787 Ga0501071_0403256
788 Ga0501072_0069434
789 Ga0501072_0357519
790 Ga0501073_0023604
791 Ga0501073_0405845
792 Ga0501073_0925168
793 Ga0501074_0225985
794 Ga0501074_0370029
795 Ga0501074_0595429
796 Ga0501075_0006482
797 Ga0501076_0004481
798 Ga0501076_0035134
799 Ga0501076_0556462
800 Ga0501077_0018243
801 Ga0501079_0008786
802 Ga0501079_0110737
803 Ga0501080_0062977
804 Ga0501080_0064991
805 Ga0501081_0451555
806 Ga0501083_0079099
807 Ga0501241_072486
808 Ga0501035_0015452
809 Ga0501035_0080793
810 Ga0501035_0325671
811 Ga0501044_0031744
812 Ga0501044_0298178
813 Ga0501045_0021138
814 Ga0501045_0079009
815 Ga0501045_0120850
816 Ga0501045_0271784
817 nmdc:mga03683_264011_c1
818 nmdc:mga03n38_2207_c1
819 nmdc:mga03n38_7801_c1
820 nmdc:mga00v17_113959_c1
821 nmdc:mga00v17_186276_c1
822 nmdc:mga00v17_247173_c1
823 nmdc:mga00v17_83342_c1
824 nmdc:mga00v17_8843_c1
825 nmdc:mga00v17_928676_c1
826 nmdc:mga0yw44_130938_c1
827 nmdc:mga0yw44_37247_c1
828 nmdc:mga0yw44_38987_c1
829 nmdc:mga0yw44_429062_c1
830 nmdc:mga0yw44_496919_c1
831 nmdc:mga06z11_221499_c1
832 nmdc:mga06z11_361710_c1
833 nmdc:mga06z11_49149_c1
834 nmdc:mga04h51_45584_c1
835 nmdc:mga07m45_13363_c1
836 nmdc:mga07m45_9413_c1
837 nmdc:mga08y16_146145_c1
838 nmdc:mga08y16_427374_c1
839 nmdc:mga0sz30_428478_c1
840 Ga0495601_0159163
841 Ga0495612_0000355
842 Ga0495655_0100504
843 Ga0495595_0302169
844 Ga0495619_0033281
845 Ga0500641_0099436
846 Ga0501084_0027041
847 Ga0501084_0888270
848 Ga0501082_0156414
849 Ga0501082_1345731
850 Ga0466962_0004207
851 Ga0466962_0069221
852 Ga0466962_0133483
853 Ga0466962_0300293
854 Ga0530510_0005897
855 Ga0530510_0173008
856 Ga0530510_0507041
857 2616697505
858 2643827993
859 2643853542
860 2644137510
861 2644531082
862 2808874955
863 2808920129
864 2857483225
865 2869063727
866 2984577213
867 2990260888
868 2997456796
869 3006426051
870 8025486235
871 8056668072
872 8057575311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

34

163

0.98

PF08534

Redoxin

Redoxin

33

180

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9451 13 153
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9418 13 153
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.935 1 153
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.928 9 153
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9271 6 153
ID Description Score Start End Superfamily
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9872 4 154 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9808 4 154 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9712 4 153 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9583 5 153 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9521 5 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2M9L5J9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9931 2 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-K4MJT0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9921 2 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A6G7YK97-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9917 1 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A7X0GG14-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9913 1 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A4P8STB5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9912 1 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map