F443418

General Info

Members Datasets Scaffolds Average Seq Length
435 226 435 234

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0361712|Ga0501072_0361712_13_789
Length 258
Sequence MWQGQRVVVVFPAYNEEAGIGAAIADFRDASEGAVDEVIAVDNNSRDGTAGLIRDAGATYVLERRQGYGYALQRGMAEAVAGGAGLIVLAEPDGTFAGKDVLKLLAFADDFDLVLGTRTTPELIWQEANMGRFLRWGNWVVAKLLQVLFGGPSLSDCGCTLRLLRRDAYLAIRDRLTVGGSHFLPEMVCLSLQRGLRVVEVPVNYRGRIGESKITGSPLTAVRVGLRMIGLILRYRLRSGPLWRPRPLAATPRESLRY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 2.07
Rhizosphere 92.18
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2711636 2162886007 Bacteria 1218
2 Ga0065704_10003954 3300005289 Bacteria 7123
3 Ga0065712_10095763 3300005290 Bacteria 2190
4 Ga0065715_10116607 3300005293 Bacteria 2373
5 Ga0065715_10160639 3300005293 Unclassified 1633
6 Ga0065707_10004875 3300005295 Unclassified 4275
7 Ga0065707_10006638 3300005295 Bacteria 3740
8 Ga0065707_10209933 3300005295 Bacteria 1270
9 Ga0070676_10099511 3300005328 Unclassified 1794
10 Ga0070683_100000027 3300005329 Bacteria 172200
11 Ga0070683_100030672 3300005329 Bacteria 4883
12 Ga0070690_100304941 3300005330 Unclassified 1143
13 Ga0070690_100761825 3300005330 Unclassified 748
14 Ga0070670_100010745 3300005331 Bacteria 7820
15 Ga0070670_100015718 3300005331 Bacteria 6497
16 Ga0070670_100146731 3300005331 Unclassified 2041
17 Ga0068869_100469223 3300005334 Unclassified 1046
18 Ga0070682_100406364 3300005337 Bacteria 1031
19 Ga0068868_100066648 3300005338 Bacteria 2863
20 Ga0070689_100042562 3300005340 Bacteria 3487
21 Ga0070689_100529698 3300005340 Unclassified 1013
22 Ga0070687_100173291 3300005343 Bacteria 1286
23 Ga0070692_10041396 3300005345 Unclassified 2360
24 Ga0070668_100419075 3300005347 Bacteria 1146
25 Ga0070669_100004052 3300005353 Bacteria 10598
26 Ga0070675_100007304 3300005354 Bacteria 8529
27 Ga0070675_100053914 3300005354 Bacteria 3307
28 Ga0070675_100074800 3300005354 Unclassified 2815
29 Ga0070675_100091338 3300005354 Bacteria 2551
30 Ga0070671_100032449 3300005355 Bacteria 4317
31 Ga0070671_100461678 3300005355 Unclassified 1090
32 Ga0070674_100013797 3300005356 Bacteria 5003
33 Ga0070674_100034615 3300005356 Bacteria 3375
34 Ga0070673_100038263 3300005364 Bacteria 3662
35 Ga0070673_100121438 3300005364 Bacteria 2180
36 Ga0070673_100272529 3300005364 Unclassified 1482
37 Ga0070688_100025371 3300005365 Bacteria 3509
38 Ga0070688_100036121 3300005365 Bacteria 3004
39 Ga0070688_100498642 3300005365 Bacteria 918
40 Ga0070659_100148650 3300005366 Unclassified 1910
41 Ga0070703_10009130 3300005406 Unclassified 2797
42 Ga0070701_10064546 3300005438 Bacteria 1941
43 Ga0070701_10105428 3300005438 Unclassified 1568
44 Ga0070705_100148011 3300005440 Bacteria 1554
45 Ga0070700_100265463 3300005441 Bacteria 1238
46 Ga0070694_100001238 3300005444 Bacteria 14777
47 Ga0070694_100009433 3300005444 Bacteria 5986
48 Ga0070678_100192424 3300005456 Bacteria 1678
49 Ga0070681_10099576 3300005458 Unclassified 2852
50 Ga0070681_10262499 3300005458 Bacteria 1639
51 Ga0068867_100003118 3300005459 Bacteria 11692
52 Ga0070706_100086644 3300005467 Bacteria 2902
53 Ga0070706_100147164 3300005467 Bacteria 2200
54 Ga0070706_100182486 3300005467 Bacteria 1960
55 Ga0070706_100221028 3300005467 Bacteria 1768
56 Ga0070707_100065317 3300005468 Unclassified 3495
57 Ga0070707_100191529 3300005468 Unclassified 1994
58 Ga0070698_100000770 3300005471 Bacteria 34710
59 Ga0070699_100002967 3300005518 Bacteria 15083
60 Ga0070684_100000293 3300005535 Bacteria 34699
61 Ga0070684_100297774 3300005535 Bacteria 1480
62 Ga0070697_100144930 3300005536 Bacteria 1999
63 Ga0070697_100295129 3300005536 Bacteria 1393
64 Ga0068853_100842934 3300005539 Bacteria 879
65 Ga0070672_100030669 3300005543 Bacteria 4042
66 Ga0070672_100248800 3300005543 Bacteria 1497
67 Ga0070686_100270735 3300005544 Unclassified 1249
68 Ga0070695_100000417 3300005545 Bacteria 22026
69 Ga0070696_100000783 3300005546 Bacteria 20460
70 Ga0070696_100019436 3300005546 Bacteria 4600
71 Ga0070696_100137916 3300005546 Unclassified 1780
72 Ga0070665_100091324 3300005548 Bacteria 3050
73 Ga0070704_100001511 3300005549 Bacteria 12543
74 Ga0070704_100236361 3300005549 Bacteria 1493
75 Ga0070704_100305897 3300005549 Bacteria 1326
76 Ga0070704_100474373 3300005549 Unclassified 1081
77 Ga0070664_100181481 3300005564 Bacteria 1871
78 Ga0070664_100208186 3300005564 Bacteria 1747
79 Ga0068857_100692556 3300005577 Bacteria 968
80 Ga0068854_100071817 3300005578 Unclassified 2533
81 Ga0070702_100177790 3300005615 Unclassified 1390
82 Ga0068859_100026831 3300005617 Bacteria 5778
83 Ga0068859_100051562 3300005617 Bacteria 4136
84 Ga0068864_100000035 3300005618 Bacteria 195218
85 Ga0068864_100053793 3300005618 Unclassified 3474
86 Ga0068861_100002659 3300005719 Bacteria 11698
87 Ga0068861_100437683 3300005719 Unclassified 1169
88 Ga0068870_10001008 3300005840 Bacteria 11127
89 Ga0068863_100101160 3300005841 Unclassified 2740
90 Ga0068863_100352434 3300005841 Unclassified 1433
91 Ga0068858_100054490 3300005842 Bacteria 3698
92 Ga0068860_100003012 3300005843 Bacteria 17406
93 Ga0068862_100000965 3300005844 Bacteria 27670
94 Ga0068862_100620430 3300005844 Bacteria 1040
95 Ga0075368_10005342 3300006042 Unclassified 4416
96 Ga0075367_10011813 3300006178 Bacteria 4637
97 Ga0075367_10127230 3300006178 Bacteria 1573
98 Ga0075366_10019271 3300006195 Bacteria 3945
99 Ga0075366_10149204 3300006195 Bacteria 1415
100 Ga0097621_100028503 3300006237 Bacteria 4400
101 Ga0097621_100312471 3300006237 Bacteria 1390
102 Ga0097621_100422691 3300006237 Unclassified 1196
103 Ga0068871_100745716 3300006358 Bacteria 900
104 Ga0075428_100008458 3300006844 Bacteria 11414
105 Ga0075428_100016908 3300006844 Bacteria 8056
106 Ga0075428_100025232 3300006844 Bacteria 6578
107 Ga0075428_100167706 3300006844 Bacteria 2381
108 Ga0075428_100448605 3300006844 Unclassified 1382
109 Ga0075428_100961672 3300006844 Unclassified 905
110 Ga0075430_100007258 3300006846 Bacteria 9358
111 Ga0075430_100009455 3300006846 Bacteria 8237
112 Ga0075430_100023335 3300006846 Bacteria 5264
113 Ga0075430_100026505 3300006846 Bacteria 4930
114 Ga0075430_100341014 3300006846 Bacteria 1238
115 Ga0075430_100394579 3300006846 Unclassified 1142
116 Ga0075431_100008515 3300006847 Bacteria 10272
117 Ga0075431_100012074 3300006847 Bacteria 8717
118 Ga0075431_100016233 3300006847 Bacteria 7555
119 Ga0075431_100027874 3300006847 Bacteria 5796
120 Ga0075431_100036925 3300006847 Bacteria 5033
121 Ga0075431_100095439 3300006847 Bacteria 3070
122 Ga0075431_100143641 3300006847 Bacteria 2459
123 Ga0075433_10052535 3300006852 Bacteria 3551
124 Ga0075433_10073927 3300006852 Bacteria 2999
125 Ga0075433_10123302 3300006852 Bacteria 2302
126 Ga0075433_10251758 3300006852 Unclassified 1567
127 Ga0075434_100022164 3300006871 Bacteria 6186
128 Ga0075434_100056160 3300006871 Unclassified 3913
129 Ga0075434_100113777 3300006871 Bacteria 2718
130 Ga0075434_100124080 3300006871 Unclassified 2599
131 Ga0075429_100006733 3300006880 Bacteria 9965
132 Ga0075429_100030787 3300006880 Bacteria 4663
133 Ga0075429_100037706 3300006880 Bacteria 4208
134 Ga0075429_100595398 3300006880 Bacteria 969
135 Ga0068865_100113221 3300006881 Bacteria 2005
136 Ga0068865_100118559 3300006881 Unclassified 1964
137 Ga0068865_100514754 3300006881 Unclassified 1000
138 Ga0075436_100303187 3300006914 Bacteria 1145
139 Ga0097620_100026831 3300006931 Bacteria 5778
140 Ga0097620_100051563 3300006931 Bacteria 4136
141 Ga0075435_100009548 3300007076 Bacteria 7034
142 Ga0075435_100155518 3300007076 Unclassified 1924
143 Ga0075435_100233173 3300007076 Unclassified 1564
144 Ga0111539_10021249 3300009094 Bacteria 7991
145 Ga0111539_10961141 3300009094 Bacteria 993
146 Ga0105245_10739029 3300009098 Bacteria 1019
147 Ga0105247_10226778 3300009101 Bacteria 1267
148 Ga0114129_10000560 3300009147 Bacteria 45696
149 Ga0114129_10008161 3300009147 Bacteria 14918
150 Ga0114129_10019720 3300009147 Bacteria 9597
151 Ga0114129_10041432 3300009147 Bacteria 6488
152 Ga0114129_10103801 3300009147 Bacteria 3929
153 Ga0114129_10186272 3300009147 Unclassified 2821
154 Ga0114129_10327353 3300009147 Unclassified 2035
155 Ga0114129_10344828 3300009147 Unclassified 1974
156 Ga0114129_10509195 3300009147 Bacteria 1571
157 Ga0114129_10542023 3300009147 Bacteria 1514
158 Ga0114129_11314661 3300009147 Unclassified 895
159 Ga0105243_10193350 3300009148 Bacteria 1779
160 Ga0105248_10337528 3300009177 Bacteria 1697
161 Ga0105249_10017989 3300009553 Bacteria 6282
162 Ga0105239_10678709 3300010375 Bacteria 1177
163 Ga0157369_10000363 3300013105 Bacteria 60464
164 Ga0157378_10261213 3300013297 Unclassified 1661
165 Ga0157378_10265995 3300013297 Unclassified 1647
166 Ga0163162_10457478 3300013306 Bacteria 1408
167 Ga0157375_10004712 3300013308 Bacteria 11863
168 Ga0157375_10183885 3300013308 Unclassified 2243
169 Ga0157380_10185716 3300014326 Bacteria 1831
170 Ga0157380_10195099 3300014326 Unclassified 1791
171 Ga0157380_10492113 3300014326 Bacteria 1189
172 Ga0157377_10025164 3300014745 Bacteria 3172
173 Ga0157376_10199727 3300014969 Unclassified 1839
174 Ga0157376_11247075 3300014969 Bacteria 772
175 Ga0213876_10022844 3300021384 Bacteria 3304
176 Ga0213875_10066872 3300021388 Unclassified 1679
177 Ga0207697_10000977 3300025315 Bacteria 16038
178 Ga0207653_10007614 3300025885 Bacteria 3377
179 Ga0207653_10034966 3300025885 Bacteria 1633
180 Ga0207688_10034210 3300025901 Bacteria 2813
181 Ga0207643_10000836 3300025908 Bacteria 18714
182 Ga0207684_10410851 3300025910 Bacteria 1163
183 Ga0207707_10010138 3300025912 Bacteria 8176
184 Ga0207662_10137365 3300025918 Bacteria 1546
185 Ga0207646_10158212 3300025922 Unclassified 2044
186 Ga0207646_10301762 3300025922 Bacteria 1447
187 Ga0207646_10555662 3300025922 Unclassified 1032
188 Ga0207681_10005277 3300025923 Bacteria 7936
189 Ga0207681_10029416 3300025923 Bacteria 3568
190 Ga0207650_10447138 3300025925 Bacteria 1075
191 Ga0207659_10000972 3300025926 Bacteria 17095
192 Ga0207659_10068949 3300025926 Unclassified 2574
193 Ga0207690_10316209 3300025932 Unclassified 1226
194 Ga0207706_10031618 3300025933 Bacteria 4715
195 Ga0207706_10401603 3300025933 Bacteria 1188
196 Ga0207709_10076420 3300025935 Bacteria 2144
197 Ga0207670_10025838 3300025936 Bacteria 3692
198 Ga0207670_10313713 3300025936 Bacteria 1232
199 Ga0207669_10015650 3300025937 Bacteria 3831
200 Ga0207669_10044318 3300025937 Bacteria 2613
201 Ga0207704_10033681 3300025938 Unclassified 2916
202 Ga0207704_10149349 3300025938 Bacteria 1647
203 Ga0207691_10029954 3300025940 Bacteria 5089
204 Ga0207691_10221692 3300025940 Bacteria 1639
205 Ga0207689_10151976 3300025942 Unclassified 1908
206 Ga0207689_10510440 3300025942 Unclassified 1008
207 Ga0207661_10000015 3300025944 Bacteria 318960
208 Ga0207661_10333998 3300025944 Bacteria 1365
209 Ga0207661_10335183 3300025944 Bacteria 1362
210 Ga0207679_10013659 3300025945 Bacteria 5325
211 Ga0207679_10021682 3300025945 Bacteria 4360
212 Ga0207679_10083381 3300025945 Bacteria 2450
213 Ga0207651_10025703 3300025960 Bacteria 3665
214 Ga0207651_10214785 3300025960 Unclassified 1551
215 Ga0207651_10230039 3300025960 Unclassified 1504
216 Ga0207651_10470802 3300025960 Bacteria 1081
217 Ga0207712_10009112 3300025961 Bacteria 6278
218 Ga0207668_10219029 3300025972 Bacteria 1527
219 Ga0207677_10078087 3300026023 Bacteria 2363
220 Ga0207703_10169388 3300026035 Bacteria 1920
221 Ga0207639_10815497 3300026041 Bacteria 870
222 Ga0207708_10003080 3300026075 Bacteria 12275
223 Ga0207708_10116976 3300026075 Unclassified 2074
224 Ga0207641_10484597 3300026088 Bacteria 1199
225 Ga0207648_10006372 3300026089 Bacteria 11737
226 Ga0207676_10000026 3300026095 Bacteria 248593
227 Ga0207676_10039500 3300026095 Unclassified 3610
228 Ga0207676_10153660 3300026095 Unclassified 1985
229 Ga0207674_10036111 3300026116 Bacteria 5154
230 Ga0207674_10485375 3300026116 Bacteria 1194
231 Ga0207674_10699252 3300026116 Bacteria 979
232 Ga0207675_100002702 3300026118 Bacteria 17472
233 Ga0207675_100125482 3300026118 Bacteria 2431
234 Ga0207683_10032368 3300026121 Bacteria 4542
235 Ga0207683_10578006 3300026121 Bacteria 1039
236 Ga0209971_1054683 3300027682 Unclassified 965
237 Ga0209971_1054949 3300027682 Bacteria 963
238 Ga0207428_10001903 3300027907 Bacteria 21136
239 Ga0268265_10000887 3300028380 Bacteria 27910
240 Ga0268264_10001791 3300028381 Bacteria 19636
241 Ga0265319_1031939 3300028563 Bacteria 1829
242 Ga0265318_10058774 3300028577 Bacteria 1434
243 Ga0265338_10034296 3300028800 Bacteria 4908
244 Ga0307413_10034991 3300031824 Bacteria 2877
245 Ga0307413_10127585 3300031824 Bacteria 1735
246 Ga0307410_10007408 3300031852 Bacteria 6004
247 Ga0307410_10156296 3300031852 Bacteria 1703
248 Ga0307406_10012061 3300031901 Bacteria 4917
249 Ga0307407_10000821 3300031903 Bacteria 10305
250 Ga0307407_10266484 3300031903 Unclassified 1180
251 Ga0307412_10029797 3300031911 Unclassified 3428
252 Ga0307412_10491357 3300031911 Unclassified 1020
253 Ga0307409_100012234 3300031995 Bacteria 5458
254 Ga0307409_100367500 3300031995 Unclassified 1363
255 Ga0307409_100492667 3300031995 Bacteria 1192
256 Ga0307416_100055057 3300032002 Unclassified 3201
257 Ga0307416_100274902 3300032002 Bacteria 1657
258 Ga0307416_100878169 3300032002 Bacteria 996
259 Ga0307414_10011345 3300032004 Bacteria 5221
260 Ga0307411_10008912 3300032005 Bacteria 5234
261 Ga0307411_10020136 3300032005 Bacteria 3872
262 Ga0307415_100142752 3300032126 Bacteria 1831
263 Ga0373932_0122933 3300035112 Unclassified 867
264 Ga0373945_0243051 3300035116 Bacteria 758
265 Ga0373962_0009357 3300035242 Bacteria 2427
266 Ga0373937_0001515 3300036401 Bacteria 19517
267 Ga0436364_0197126 3300037853 Bacteria 2040
268 Ga0436364_0334514 3300037853 Bacteria 6855
269 Ga0436364_0515695 3300037853 Bacteria 2930
270 Ga0436364_1509325 3300037853 Bacteria 1104
271 Ga0436365_0133092 3300039437 Bacteria 26573
272 Ga0436365_0872509 3300039437 Bacteria 2211
273 Ga0436365_0986342 3300039437 Bacteria 1815
274 Ga0436365_1186907 3300039437 Bacteria 1878
275 Ga0436365_1216125 3300039437 Bacteria 5830
276 Ga0436365_1281712 3300039437 Bacteria 80367
277 Ga0436363_1044428 3300039450 Unclassified 2866
278 Ga0436362_0025424 3300039453 Unclassified 1131
279 Ga0439435_0000660 3300042436 Bacteria 5691
280 Ga0439435_0004062 3300042436 Bacteria 3117
281 Ga0451577_0112336 3300042876 Bacteria 2438
282 Ga0451577_0215901 3300042876 Bacteria 1733
283 Ga0439440_0034385 3300042993 Unclassified 1212
284 Ga0453684_0011209 3300044712 Bacteria 15091
285 Ga0453684_0046010 3300044712 Bacteria 5812
286 Ga0453684_0182838 3300044712 Bacteria 2460
287 Ga0451576_0006349 3300045051 Bacteria 14518
288 Ga0451576_0009970 3300045051 Bacteria 10955
289 Ga0451576_0040455 3300045051 Bacteria 4933
290 Ga0451576_0132350 3300045051 Unclassified 2600
291 Ga0451576_0361958 3300045051 Bacteria 1519
292 Ga0451576_0434345 3300045051 Bacteria 1378
293 Ga0466967_0516191 3300045976 Bacteria 1174
294 Ga0495603_0016873 3300046455 Bacteria 4419
295 Ga0495629_0044289 3300046459 Bacteria 3123
296 Ga0495629_0409209 3300046459 Bacteria 921
297 Ga0495638_0022044 3300046460 Bacteria 4186
298 Ga0495651_0326883 3300046462 Bacteria 1020
299 Ga0495580_0374070 3300046472 Unclassified 963
300 Ga0495584_0049314 3300046491 Bacteria 2121
301 Ga0495594_0094450 3300046499 Bacteria 1678
302 Ga0495594_0319940 3300046499 Unclassified 884
303 Ga0495643_0004818 3300046522 Bacteria 9296
304 Ga0495663_0014584 3300046525 Bacteria 2204
305 Ga0495642_0004304 3300046528 Bacteria 5530
306 Ga0495598_0091958 3300046537 Bacteria 991
307 Ga0495598_0114691 3300046537 Unclassified 907
308 Ga0495609_0098033 3300046538 Bacteria 1271
309 Ga0495621_0005672 3300046539 Bacteria 3603
310 Ga0495621_0022640 3300046539 Bacteria 2085
311 Ga0495633_0224498 3300046558 Unclassified 859
312 Ga0495656_0051830 3300046615 Bacteria 1758
313 Ga0495668_0182143 3300046616 Bacteria 1151
314 Ga0495659_0003742 3300046664 Bacteria 4837
315 Ga0495659_0027220 3300046664 Bacteria 1971
316 Ga0495588_0108377 3300046674 Bacteria 1462
317 Ga0495669_0051805 3300046684 Unclassified 1843
318 Ga0495669_0064403 3300046684 Bacteria 1663
319 Ga0495589_0273159 3300046794 Unclassified 787
320 Ga0495636_0021377 3300047318 Bacteria 2612
321 Ga0495672_0063418 3300047320 Unclassified 2121
322 Ga0495676_0037587 3300047321 Bacteria 4028
323 Ga0495675_0142965 3300047444 Bacteria 1482
324 Ga0495677_0079007 3300047445 Bacteria 1232
325 Ga0495677_0125524 3300047445 Bacteria 980
326 Ga0495685_004318 3300047447 Bacteria 4584
327 Ga0496101_0237779 3300048904 Bacteria 1417
328 Ga0496103_0049977 3300048906 Bacteria 2586
329 Ga0496108_0000114 3300048911 Bacteria 81031
330 Ga0496108_0408090 3300048911 Bacteria 1186
331 Ga0496109_0077757 3300048912 Unclassified 3054
332 Ga0496110_0028710 3300048913 Bacteria 4781
333 Ga0496110_0729561 3300048913 Unclassified 893
334 Ga0496111_0135348 3300048914 Bacteria 1825
335 Ga0496112_0034459 3300048915 Bacteria 4927
336 Ga0501033_0095706 3300049570 Bacteria 2170
337 Ga0501036_0078031 3300049572 Bacteria 2802
338 Ga0501036_0095993 3300049572 Bacteria 2506
339 Ga0501039_0065527 3300049575 Bacteria 2818
340 Ga0501039_0072377 3300049575 Bacteria 2678
341 Ga0501040_0014732 3300049576 Bacteria 5158
342 Ga0501041_0000881 3300049577 Bacteria 16230
343 Ga0501041_0146887 3300049577 Bacteria 1471
344 Ga0501042_0002368 3300049578 Bacteria 11557
345 Ga0501042_0306743 3300049578 Bacteria 1147
346 Ga0501046_0029483 3300049580 Bacteria 4460
347 Ga0501046_0098149 3300049580 Unclassified 2250
348 Ga0501048_0129697 3300049582 Unclassified 1783
349 Ga0501048_0411040 3300049582 Unclassified 968
350 Ga0501068_0117732 3300049584 Bacteria 1655
351 Ga0501068_0167390 3300049584 Bacteria 1386
352 Ga0501068_0189516 3300049584 Bacteria 1302
353 Ga0501070_0625193 3300049586 Unclassified 857
354 Ga0501071_0123613 3300049587 Bacteria 1919
355 Ga0501071_0452276 3300049587 Unclassified 983
356 Ga0501072_0002447 3300049588 Bacteria 13910
357 Ga0501072_0006817 3300049588 Bacteria 8672
358 Ga0501072_0118970 3300049588 Archaea 2105
359 Ga0501072_0361712 3300049588 Bacteria 1152
360 Ga0501073_0012194 3300049589 Bacteria 6276
361 Ga0501074_0126137 3300049590 Bacteria 1831
362 Ga0501074_0378523 3300049590 Unclassified 1004
363 Ga0501075_0000722 3300049591 Bacteria 20491
364 Ga0501075_0001143 3300049591 Bacteria 17114
365 Ga0501075_0058430 3300049591 Bacteria 2905
366 Ga0501076_0007665 3300049592 Bacteria 7861
367 Ga0501076_0053451 3300049592 Bacteria 3201
368 Ga0501076_0096406 3300049592 Unclassified 2382
369 Ga0501077_0000368 3300049593 Bacteria 26895
370 Ga0501077_0389658 3300049593 Bacteria 890
371 Ga0501079_0007802 3300049741 Bacteria 8104
372 Ga0501079_0055189 3300049741 Bacteria 3066
373 Ga0501080_0003587 3300049742 Bacteria 13665
374 Ga0501080_0430344 3300049742 Unclassified 1185
375 Ga0501080_0459904 3300049742 Bacteria 1140
376 Ga0501081_0004261 3300049743 Bacteria 9169
377 Ga0501081_0035755 3300049743 Bacteria 3383
378 Ga0501081_0416746 3300049743 Unclassified 995
379 Ga0501045_0013310 3300049824 Bacteria 5808
380 Ga0501045_0018250 3300049824 Bacteria 4989
381 nmdc:mga0k408_22051_c1 3300050493 Bacteria 3583
382 nmdc:mga0k408_230268_c1 3300050493 Unclassified 1106
383 nmdc:mga06z11_50181_c1 3300050494 Bacteria 2132
384 nmdc:mga06z11_62931_c1 3300050494 Bacteria 1940
385 nmdc:mga04h51_146304_c1 3300050495 Bacteria 900
386 nmdc:mga05p37_1831_c1 3300050507 Bacteria 24798
387 nmdc:mga05p37_282354_c1 3300050507 Bacteria 1979
388 nmdc:mga05p37_302701_c1 3300050507 Bacteria 1899
389 nmdc:mga05p37_315066_c1 3300050507 Unclassified 1853
390 nmdc:mga05p37_321362_c1 3300050507 Bacteria 1832
391 nmdc:mga05p37_4082_c1 3300050507 Bacteria 17066
392 nmdc:mga05p37_414118_c1 3300050507 Bacteria 1570
393 nmdc:mga05p37_5428_c1 3300050507 Bacteria 14983
394 nmdc:mga09592_2301_c1 3300050508 Bacteria 15405
395 nmdc:mga09592_27305_c1 3300050508 Bacteria 4736
396 nmdc:mga09592_389821_c1 3300050508 Unclassified 1204
397 nmdc:mga09592_478586_c1 3300050508 Bacteria 1073
398 nmdc:mga09592_647170_c1 3300050508 Unclassified 903
399 nmdc:mga09592_94838_c1 3300050508 Bacteria 2552
400 nmdc:mga0qj67_1114_c1 3300050509 Bacteria 18629
401 nmdc:mga0qj67_12929_c1 3300050509 Bacteria 6299
402 nmdc:mga0qj67_135459_c1 3300050509 Bacteria 1996
403 nmdc:mga0qj67_158119_c1 3300050509 Unclassified 1840
404 nmdc:mga0qj67_379414_c1 3300050509 Unclassified 1142
405 nmdc:mga0qj67_41622_c1 3300050509 Bacteria 3614
406 nmdc:mga06r32_151810_c1 3300050510 Bacteria 2295
407 nmdc:mga06r32_1895_c1 3300050510 Bacteria 18630
408 nmdc:mga06r32_33325_c1 3300050510 Bacteria 4851
409 nmdc:mga06r32_59862_c1 3300050510 Bacteria 3664
410 nmdc:mga06r32_70070_c1 3300050510 Bacteria 3390
411 nmdc:mga06r32_83109_c1 3300050510 Bacteria 3120
412 nmdc:mga06r32_83717_c1 3300050510 Bacteria 3109
413 nmdc:mga08y16_20452_c1 3300050511 Bacteria 6987
414 nmdc:mga0n895_114774_c1 3300050512 Unclassified 2711
415 nmdc:mga0n895_311640_c1 3300050512 Bacteria 1595
416 nmdc:mga0n895_5842_c1 3300050512 Bacteria 10343
417 nmdc:mga0a205_162635_c1 3300050515 Bacteria 2128
418 nmdc:mga0a205_36013_c1 3300050515 Bacteria 4754
419 nmdc:mga0a205_71041_c1 3300050515 Bacteria 3362
420 nmdc:mga0a205_769215_c1 3300050515 Bacteria 811
421 Ga0500641_0003543 3300053096 Bacteria 5516
422 Ga0500568_0001762 3300053139 Bacteria 13363
423 Ga0501084_0013954 3300054114 Bacteria 6650
424 Ga0501084_0171263 3300054114 Unclassified 1832
425 Ga0501084_0374301 3300054114 Bacteria 1204
426 Ga0590071_000146 3300059421 Bacteria 20114
427 Ga0590074_008145 3300059423 Bacteria 1746
428 Ga0590075_036147 3300059424 Unclassified 1259
429 Ga0590077_000060 3300059426 Bacteria 26907
430 Ga0590077_003853 3300059426 Bacteria 3092
431 Ga0501082_0000015 3300060353 Bacteria 116737
432 Ga0501082_0001055 3300060353 Bacteria 24399
433 Ga0501082_0069189 3300060353 Bacteria 3039
434 Ga0530510_0048983 3300061734 Bacteria 3053
435 Ga0530510_0169374 3300061734 Unclassified 1617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100026505 Ga0075430_1000265052 218
2 3300006847 Ga0075431_100095439 Ga0075431_1000954391 218
3 3300050509 nmdc:mga0qj67_41622_c1 nmdc:mga0qj67_41622_c1_194_928 218
4 3300050510 nmdc:mga06r32_70070_c1 nmdc:mga06r32_70070_c1_403_1137 218
5 3300006844 Ga0075428_100008458 Ga0075428_1000084585 219
6 3300006846 Ga0075430_100009455 Ga0075430_1000094554 219
7 3300006847 Ga0075431_100008515 Ga0075431_1000085158 219
8 3300006880 Ga0075429_100006733 Ga0075429_1000067331 219
9 3300009147 Ga0114129_10019720 Ga0114129_100197204 219
10 3300050507 nmdc:mga05p37_5428_c1 nmdc:mga05p37_5428_c1_5099_5863 219
11 3300050508 nmdc:mga09592_2301_c1 nmdc:mga09592_2301_c1_9119_9883 219
12 3300050509 nmdc:mga0qj67_1114_c1 nmdc:mga0qj67_1114_c1_9132_9896 219
13 3300050510 nmdc:mga06r32_1895_c1 nmdc:mga06r32_1895_c1_8735_9499 219
14 3300005295 Ga0065707_10004875 Ga0065707_100048752 221
15 3300006847 Ga0075431_100036925 Ga0075431_1000369253 221
16 3300009147 Ga0114129_10327353 Ga0114129_103273532 221
17 3300032002 Ga0307416_100878169 Ga0307416_1008781691 221
18 3300050507 nmdc:mga05p37_282354_c1 nmdc:mga05p37_282354_c1_48_749 221
19 3300050508 nmdc:mga09592_478586_c1 nmdc:mga09592_478586_c1_133_834 221
20 3300050510 nmdc:mga06r32_33325_c1 nmdc:mga06r32_33325_c1_2934_3635 221
21 3300026121 Ga0207683_10578006 Ga0207683_105780062 224
22 3300035112 Ga0373932_0122933 Ga0373932_0122933_172_846 224
23 3300025910 Ga0207684_10410851 Ga0207684_104108512 227
24 3300039437 Ga0436365_1186907 Ga0436365_1186907_52_777 227
25 3300026095 Ga0207676_10039500 Ga0207676_100395003 229
26 3300037853 Ga0436364_0334514 Ga0436364_0334514_4612_5313 231
27 3300039437 Ga0436365_1281712 Ga0436365_1281712_10827_11528 231
28 3300039450 Ga0436363_1044428 Ga0436363_1044428_546_1247 231
29 3300044712 Ga0453684_0011209 Ga0453684_0011209_262_990 231
30 2162886007 SwRhRL2b_contig_2711636 SwRhRL2b_0662.00004350 233
31 3300005289 Ga0065704_10003954 Ga0065704_100039542 233
32 3300005290 Ga0065712_10095763 Ga0065712_100957632 233
33 3300005293 Ga0065715_10116607 Ga0065715_101166072 233
34 3300005293 Ga0065715_10160639 Ga0065715_101606392 233
35 3300005295 Ga0065707_10006638 Ga0065707_100066384 233
36 3300005295 Ga0065707_10209933 Ga0065707_102099332 233
37 3300005328 Ga0070676_10099511 Ga0070676_100995112 233
38 3300005329 Ga0070683_100000027 Ga0070683_10000002720 233
39 3300005329 Ga0070683_100030672 Ga0070683_1000306724 233
40 3300005330 Ga0070690_100304941 Ga0070690_1003049412 233
41 3300005330 Ga0070690_100761825 Ga0070690_1007618251 233
42 3300005331 Ga0070670_100010745 Ga0070670_1000107454 233
43 3300005331 Ga0070670_100015718 Ga0070670_1000157184 233
44 3300005331 Ga0070670_100146731 Ga0070670_1001467312 233
45 3300005334 Ga0068869_100469223 Ga0068869_1004692232 233
46 3300005337 Ga0070682_100406364 Ga0070682_1004063642 233
47 3300005338 Ga0068868_100066648 Ga0068868_1000666483 233
48 3300005340 Ga0070689_100042562 Ga0070689_1000425623 233
49 3300005340 Ga0070689_100529698 Ga0070689_1005296982 233
50 3300005343 Ga0070687_100173291 Ga0070687_1001732912 233
51 3300005345 Ga0070692_10041396 Ga0070692_100413963 233
52 3300005347 Ga0070668_100419075 Ga0070668_1004190752 233
53 3300005353 Ga0070669_100004052 Ga0070669_10000405211 233
54 3300005354 Ga0070675_100007304 Ga0070675_1000073044 233
55 3300005354 Ga0070675_100053914 Ga0070675_1000539142 233
56 3300005354 Ga0070675_100074800 Ga0070675_1000748003 233
57 3300005354 Ga0070675_100091338 Ga0070675_1000913383 233
58 3300005355 Ga0070671_100032449 Ga0070671_1000324492 233
59 3300005355 Ga0070671_100461678 Ga0070671_1004616782 233
60 3300005356 Ga0070674_100013797 Ga0070674_1000137973 233
61 3300005356 Ga0070674_100034615 Ga0070674_1000346153 233
62 3300005364 Ga0070673_100038263 Ga0070673_1000382634 233
63 3300005364 Ga0070673_100121438 Ga0070673_1001214383 233
64 3300005364 Ga0070673_100272529 Ga0070673_1002725291 233
65 3300005365 Ga0070688_100025371 Ga0070688_1000253713 233
66 3300005365 Ga0070688_100036121 Ga0070688_1000361212 233
67 3300005365 Ga0070688_100498642 Ga0070688_1004986421 233
68 3300005366 Ga0070659_100148650 Ga0070659_1001486502 233
69 3300005406 Ga0070703_10009130 Ga0070703_100091303 233
70 3300005438 Ga0070701_10064546 Ga0070701_100645462 233
71 3300005438 Ga0070701_10105428 Ga0070701_101054282 233
72 3300005440 Ga0070705_100148011 Ga0070705_1001480112 233
73 3300005441 Ga0070700_100265463 Ga0070700_1002654632 233
74 3300005444 Ga0070694_100001238 Ga0070694_10000123815 233
75 3300005444 Ga0070694_100009433 Ga0070694_1000094334 233
76 3300005456 Ga0070678_100192424 Ga0070678_1001924242 233
77 3300005458 Ga0070681_10099576 Ga0070681_100995763 233
78 3300005458 Ga0070681_10262499 Ga0070681_102624992 233
79 3300005459 Ga0068867_100003118 Ga0068867_1000031187 233
80 3300005467 Ga0070706_100086644 Ga0070706_1000866443 233
81 3300005467 Ga0070706_100147164 Ga0070706_1001471642 233
82 3300005467 Ga0070706_100182486 Ga0070706_1001824862 233
83 3300005467 Ga0070706_100221028 Ga0070706_1002210282 233
84 3300005468 Ga0070707_100065317 Ga0070707_1000653172 233
85 3300005468 Ga0070707_100191529 Ga0070707_1001915292 233
86 3300005471 Ga0070698_100000770 Ga0070698_10000077019 233
87 3300005518 Ga0070699_100002967 Ga0070699_10000296711 233
88 3300005535 Ga0070684_100000293 Ga0070684_10000029316 233
89 3300005535 Ga0070684_100297774 Ga0070684_1002977742 233
90 3300005536 Ga0070697_100144930 Ga0070697_1001449302 233
91 3300005536 Ga0070697_100295129 Ga0070697_1002951292 233
92 3300005539 Ga0068853_100842934 Ga0068853_1008429341 233
93 3300005543 Ga0070672_100030669 Ga0070672_1000306693 233
94 3300005543 Ga0070672_100248800 Ga0070672_1002488002 233
95 3300005544 Ga0070686_100270735 Ga0070686_1002707352 233
96 3300005545 Ga0070695_100000417 Ga0070695_10000041717 233
97 3300005546 Ga0070696_100000783 Ga0070696_1000007838 233
98 3300005546 Ga0070696_100019436 Ga0070696_1000194362 233
99 3300005546 Ga0070696_100137916 Ga0070696_1001379163 233
100 3300005548 Ga0070665_100091324 Ga0070665_1000913242 233
101 3300005549 Ga0070704_100001511 Ga0070704_1000015114 233
102 3300005549 Ga0070704_100236361 Ga0070704_1002363612 233
103 3300005549 Ga0070704_100305897 Ga0070704_1003058972 233
104 3300005549 Ga0070704_100474373 Ga0070704_1004743732 233
105 3300005564 Ga0070664_100181481 Ga0070664_1001814812 233
106 3300005564 Ga0070664_100208186 Ga0070664_1002081862 233
107 3300005577 Ga0068857_100692556 Ga0068857_1006925561 233
108 3300005578 Ga0068854_100071817 Ga0068854_1000718171 233
109 3300005615 Ga0070702_100177790 Ga0070702_1001777902 233
110 3300005617 Ga0068859_100026831 Ga0068859_1000268314 233
111 3300005617 Ga0068859_100051562 Ga0068859_1000515623 233
112 3300005618 Ga0068864_100000035 Ga0068864_10000003543 233
113 3300005618 Ga0068864_100053793 Ga0068864_1000537933 233
114 3300005719 Ga0068861_100002659 Ga0068861_10000265910 233
115 3300005719 Ga0068861_100437683 Ga0068861_1004376832 233
116 3300005840 Ga0068870_10001008 Ga0068870_100010085 233
117 3300005841 Ga0068863_100101160 Ga0068863_1001011602 233
118 3300005841 Ga0068863_100352434 Ga0068863_1003524342 233
119 3300005842 Ga0068858_100054490 Ga0068858_1000544902 233
120 3300005843 Ga0068860_100003012 Ga0068860_10000301212 233
121 3300005844 Ga0068862_100000965 Ga0068862_1000009659 233
122 3300005844 Ga0068862_100620430 Ga0068862_1006204301 233
123 3300006042 Ga0075368_10005342 Ga0075368_100053422 233
124 3300006178 Ga0075367_10011813 Ga0075367_100118134 233
125 3300006178 Ga0075367_10127230 Ga0075367_101272302 233
126 3300006195 Ga0075366_10019271 Ga0075366_100192713 233
127 3300006195 Ga0075366_10149204 Ga0075366_101492042 233
128 3300006237 Ga0097621_100028503 Ga0097621_1000285034 233
129 3300006237 Ga0097621_100312471 Ga0097621_1003124712 233
130 3300006237 Ga0097621_100422691 Ga0097621_1004226911 233
131 3300006358 Ga0068871_100745716 Ga0068871_1007457162 233
132 3300006844 Ga0075428_100016908 Ga0075428_1000169086 233
133 3300006844 Ga0075428_100025232 Ga0075428_1000252324 233
134 3300006844 Ga0075428_100167706 Ga0075428_1001677062 233
135 3300006844 Ga0075428_100448605 Ga0075428_1004486052 233
136 3300006844 Ga0075428_100961672 Ga0075428_1009616721 233
137 3300006846 Ga0075430_100007258 Ga0075430_1000072582 233
138 3300006846 Ga0075430_100023335 Ga0075430_1000233352 233
139 3300006846 Ga0075430_100341014 Ga0075430_1003410142 233
140 3300006846 Ga0075430_100394579 Ga0075430_1003945791 233
141 3300006847 Ga0075431_100012074 Ga0075431_1000120745 233
142 3300006847 Ga0075431_100016233 Ga0075431_1000162332 233
143 3300006847 Ga0075431_100027874 Ga0075431_1000278746 233
144 3300006847 Ga0075431_100143641 Ga0075431_1001436411 233
145 3300006852 Ga0075433_10052535 Ga0075433_100525352 233
146 3300006852 Ga0075433_10073927 Ga0075433_100739272 233
147 3300006852 Ga0075433_10123302 Ga0075433_101233022 233
148 3300006852 Ga0075433_10251758 Ga0075433_102517582 233
149 3300006871 Ga0075434_100022164 Ga0075434_1000221644 233
150 3300006871 Ga0075434_100056160 Ga0075434_1000561602 233
151 3300006871 Ga0075434_100113777 Ga0075434_1001137773 233
152 3300006871 Ga0075434_100124080 Ga0075434_1001240802 233
153 3300006880 Ga0075429_100030787 Ga0075429_1000307873 233
154 3300006880 Ga0075429_100037706 Ga0075429_1000377063 233
155 3300006880 Ga0075429_100595398 Ga0075429_1005953982 233
156 3300006881 Ga0068865_100113221 Ga0068865_1001132212 233
157 3300006881 Ga0068865_100118559 Ga0068865_1001185592 233
158 3300006881 Ga0068865_100514754 Ga0068865_1005147542 233
159 3300006914 Ga0075436_100303187 Ga0075436_1003031872 233
160 3300006931 Ga0097620_100026831 Ga0097620_1000268314 233
161 3300006931 Ga0097620_100051563 Ga0097620_1000515633 233
162 3300007076 Ga0075435_100009548 Ga0075435_1000095484 233
163 3300007076 Ga0075435_100155518 Ga0075435_1001555182 233
164 3300007076 Ga0075435_100233173 Ga0075435_1002331732 233
165 3300009094 Ga0111539_10021249 Ga0111539_100212493 233
166 3300009094 Ga0111539_10961141 Ga0111539_109611412 233
167 3300009098 Ga0105245_10739029 Ga0105245_107390292 233
168 3300009101 Ga0105247_10226778 Ga0105247_102267782 233
169 3300009147 Ga0114129_10000560 Ga0114129_1000056026 233
170 3300009147 Ga0114129_10008161 Ga0114129_100081616 233
171 3300009147 Ga0114129_10041432 Ga0114129_100414325 233
172 3300009147 Ga0114129_10103801 Ga0114129_101038013 233
173 3300009147 Ga0114129_10186272 Ga0114129_101862722 233
174 3300009147 Ga0114129_10344828 Ga0114129_103448282 233
175 3300009147 Ga0114129_10509195 Ga0114129_105091952 233
176 3300009147 Ga0114129_10542023 Ga0114129_105420232 233
177 3300009147 Ga0114129_11314661 Ga0114129_113146611 233
178 3300009148 Ga0105243_10193350 Ga0105243_101933502 233
179 3300009177 Ga0105248_10337528 Ga0105248_103375281 233
180 3300009553 Ga0105249_10017989 Ga0105249_100179894 233
181 3300010375 Ga0105239_10678709 Ga0105239_106787092 233
182 3300013105 Ga0157369_10000363 Ga0157369_1000036360 233
183 3300013297 Ga0157378_10261213 Ga0157378_102612132 233
184 3300013297 Ga0157378_10265995 Ga0157378_102659952 233
185 3300013306 Ga0163162_10457478 Ga0163162_104574782 233
186 3300013308 Ga0157375_10004712 Ga0157375_100047125 233
187 3300013308 Ga0157375_10183885 Ga0157375_101838852 233
188 3300014326 Ga0157380_10185716 Ga0157380_101857162 233
189 3300014326 Ga0157380_10195099 Ga0157380_101950992 233
190 3300014326 Ga0157380_10492113 Ga0157380_104921132 233
191 3300014745 Ga0157377_10025164 Ga0157377_100251642 233
192 3300014969 Ga0157376_10199727 Ga0157376_101997273 233
193 3300014969 Ga0157376_11247075 Ga0157376_112470751 233
194 3300021384 Ga0213876_10022844 Ga0213876_100228443 233
195 3300021388 Ga0213875_10066872 Ga0213875_100668722 233
196 3300025315 Ga0207697_10000977 Ga0207697_100009778 233
197 3300025885 Ga0207653_10007614 Ga0207653_100076144 233
198 3300025885 Ga0207653_10034966 Ga0207653_100349662 233
199 3300025901 Ga0207688_10034210 Ga0207688_100342104 233
200 3300025908 Ga0207643_10000836 Ga0207643_1000083614 233
201 3300025912 Ga0207707_10010138 Ga0207707_100101381 233
202 3300025918 Ga0207662_10137365 Ga0207662_101373652 233
203 3300025922 Ga0207646_10158212 Ga0207646_101582122 233
204 3300025922 Ga0207646_10301762 Ga0207646_103017622 233
205 3300025922 Ga0207646_10555662 Ga0207646_105556622 233
206 3300025923 Ga0207681_10005277 Ga0207681_100052774 233
207 3300025923 Ga0207681_10029416 Ga0207681_100294162 233
208 3300025925 Ga0207650_10447138 Ga0207650_104471382 233
209 3300025926 Ga0207659_10000972 Ga0207659_1000097215 233
210 3300025926 Ga0207659_10068949 Ga0207659_100689493 233
211 3300025932 Ga0207690_10316209 Ga0207690_103162092 233
212 3300025933 Ga0207706_10031618 Ga0207706_100316182 233
213 3300025933 Ga0207706_10401603 Ga0207706_104016032 233
214 3300025935 Ga0207709_10076420 Ga0207709_100764202 233
215 3300025936 Ga0207670_10025838 Ga0207670_100258382 233
216 3300025936 Ga0207670_10313713 Ga0207670_103137132 233
217 3300025937 Ga0207669_10015650 Ga0207669_100156502 233
218 3300025937 Ga0207669_10044318 Ga0207669_100443182 233
219 3300025938 Ga0207704_10033681 Ga0207704_100336813 233
220 3300025938 Ga0207704_10149349 Ga0207704_101493492 233
221 3300025940 Ga0207691_10029954 Ga0207691_100299544 233
222 3300025940 Ga0207691_10221692 Ga0207691_102216921 233
223 3300025942 Ga0207689_10151976 Ga0207689_101519762 233
224 3300025942 Ga0207689_10510440 Ga0207689_105104402 233
225 3300025944 Ga0207661_10000015 Ga0207661_10000015165 233
226 3300025944 Ga0207661_10333998 Ga0207661_103339982 233
227 3300025944 Ga0207661_10335183 Ga0207661_103351832 233
228 3300025945 Ga0207679_10013659 Ga0207679_100136592 233
229 3300025945 Ga0207679_10021682 Ga0207679_100216824 233
230 3300025945 Ga0207679_10083381 Ga0207679_100833812 233
231 3300025960 Ga0207651_10025703 Ga0207651_100257032 233
232 3300025960 Ga0207651_10214785 Ga0207651_102147852 233
233 3300025960 Ga0207651_10230039 Ga0207651_102300392 233
234 3300025960 Ga0207651_10470802 Ga0207651_104708022 233
235 3300025961 Ga0207712_10009112 Ga0207712_100091124 233
236 3300025972 Ga0207668_10219029 Ga0207668_102190292 233
237 3300026023 Ga0207677_10078087 Ga0207677_100780872 233
238 3300026035 Ga0207703_10169388 Ga0207703_101693882 233
239 3300026041 Ga0207639_10815497 Ga0207639_108154972 233
240 3300026075 Ga0207708_10003080 Ga0207708_100030807 233
241 3300026075 Ga0207708_10116976 Ga0207708_101169762 233
242 3300026088 Ga0207641_10484597 Ga0207641_104845972 233
243 3300026089 Ga0207648_10006372 Ga0207648_100063727 233
244 3300026095 Ga0207676_10000026 Ga0207676_10000026137 233
245 3300026095 Ga0207676_10153660 Ga0207676_101536602 233
246 3300026116 Ga0207674_10036111 Ga0207674_100361112 233
247 3300026116 Ga0207674_10485375 Ga0207674_104853752 233
248 3300026116 Ga0207674_10699252 Ga0207674_106992522 233
249 3300026118 Ga0207675_100002702 Ga0207675_10000270211 233
250 3300026118 Ga0207675_100125482 Ga0207675_1001254822 233
251 3300026121 Ga0207683_10032368 Ga0207683_100323683 233
252 3300027682 Ga0209971_1054683 Ga0209971_10546832 233
253 3300027682 Ga0209971_1054949 Ga0209971_10549492 233
254 3300027907 Ga0207428_10001903 Ga0207428_1000190316 233
255 3300028380 Ga0268265_10000887 Ga0268265_1000088712 233
256 3300028381 Ga0268264_10001791 Ga0268264_1000179112 233
257 3300028563 Ga0265319_1031939 Ga0265319_10319392 233
258 3300028577 Ga0265318_10058774 Ga0265318_100587741 233
259 3300028800 Ga0265338_10034296 Ga0265338_100342965 233
260 3300031824 Ga0307413_10034991 Ga0307413_100349912 233
261 3300031824 Ga0307413_10127585 Ga0307413_101275852 233
262 3300031852 Ga0307410_10007408 Ga0307410_100074082 233
263 3300031852 Ga0307410_10156296 Ga0307410_101562962 233
264 3300031901 Ga0307406_10012061 Ga0307406_100120614 233
265 3300031903 Ga0307407_10000821 Ga0307407_100008213 233
266 3300031903 Ga0307407_10266484 Ga0307407_102664842 233
267 3300031911 Ga0307412_10029797 Ga0307412_100297972 233
268 3300031911 Ga0307412_10491357 Ga0307412_104913571 233
269 3300031995 Ga0307409_100012234 Ga0307409_1000122345 233
270 3300031995 Ga0307409_100367500 Ga0307409_1003675002 233
271 3300031995 Ga0307409_100492667 Ga0307409_1004926672 233
272 3300032002 Ga0307416_100055057 Ga0307416_1000550572 233
273 3300032002 Ga0307416_100274902 Ga0307416_1002749022 233
274 3300032004 Ga0307414_10011345 Ga0307414_100113453 233
275 3300032005 Ga0307411_10008912 Ga0307411_100089123 233
276 3300032005 Ga0307411_10020136 Ga0307411_100201363 233
277 3300032126 Ga0307415_100142752 Ga0307415_1001427522 233
278 3300035116 Ga0373945_0243051 Ga0373945_0243051_13_714 233
279 3300035242 Ga0373962_0009357 Ga0373962_0009357_1513_2214 233
280 3300036401 Ga0373937_0001515 Ga0373937_0001515_17225_17926 233
281 3300037853 Ga0436364_0197126 Ga0436364_0197126_447_1163 233
282 3300037853 Ga0436364_0515695 Ga0436364_0515695_2150_2857 233
283 3300037853 Ga0436364_1509325 Ga0436364_1509325_249_956 233
284 3300039437 Ga0436365_0133092 Ga0436365_0133092_3528_4235 233
285 3300039437 Ga0436365_0872509 Ga0436365_0872509_1110_1826 233
286 3300039437 Ga0436365_0986342 Ga0436365_0986342_191_898 233
287 3300039437 Ga0436365_1216125 Ga0436365_1216125_2088_2804 233
288 3300039453 Ga0436362_0025424 Ga0436362_0025424_391_1098 233
289 3300042436 Ga0439435_0000660 Ga0439435_0000660_2810_3562 233
290 3300042436 Ga0439435_0004062 Ga0439435_0004062_200_901 233
291 3300042876 Ga0451577_0112336 Ga0451577_0112336_55_759 233
292 3300042876 Ga0451577_0215901 Ga0451577_0215901_1003_1704 233
293 3300042993 Ga0439440_0034385 Ga0439440_0034385_458_1159 233
294 3300044712 Ga0453684_0046010 Ga0453684_0046010_2979_3680 233
295 3300044712 Ga0453684_0182838 Ga0453684_0182838_892_1593 233
296 3300045051 Ga0451576_0006349 Ga0451576_0006349_1636_2337 233
297 3300045051 Ga0451576_0009970 Ga0451576_0009970_135_836 233
298 3300045051 Ga0451576_0040455 Ga0451576_0040455_2843_3544 233
299 3300045051 Ga0451576_0132350 Ga0451576_0132350_1185_1889 233
300 3300045051 Ga0451576_0361958 Ga0451576_0361958_510_1211 233
301 3300045051 Ga0451576_0434345 Ga0451576_0434345_618_1319 233
302 3300045976 Ga0466967_0516191 Ga0466967_0516191_215_922 233
303 3300046455 Ga0495603_0016873 Ga0495603_0016873_212_913 233
304 3300046459 Ga0495629_0044289 Ga0495629_0044289_298_999 233
305 3300046459 Ga0495629_0409209 Ga0495629_0409209_14_715 233
306 3300046460 Ga0495638_0022044 Ga0495638_0022044_2504_3205 233
307 3300046462 Ga0495651_0326883 Ga0495651_0326883_88_789 233
308 3300046472 Ga0495580_0374070 Ga0495580_0374070_213_914 233
309 3300046491 Ga0495584_0049314 Ga0495584_0049314_286_987 233
310 3300046499 Ga0495594_0094450 Ga0495594_0094450_867_1568 233
311 3300046499 Ga0495594_0319940 Ga0495594_0319940_96_797 233
312 3300046522 Ga0495643_0004818 Ga0495643_0004818_2066_2767 233
313 3300046525 Ga0495663_0014584 Ga0495663_0014584_801_1502 233
314 3300046528 Ga0495642_0004304 Ga0495642_0004304_1118_1819 233
315 3300046537 Ga0495598_0091958 Ga0495598_0091958_236_937 233
316 3300046537 Ga0495598_0114691 Ga0495598_0114691_113_814 233
317 3300046538 Ga0495609_0098033 Ga0495609_0098033_346_1047 233
318 3300046539 Ga0495621_0005672 Ga0495621_0005672_900_1601 233
319 3300046539 Ga0495621_0022640 Ga0495621_0022640_534_1235 233
320 3300046558 Ga0495633_0224498 Ga0495633_0224498_46_747 233
321 3300046615 Ga0495656_0051830 Ga0495656_0051830_659_1360 233
322 3300046616 Ga0495668_0182143 Ga0495668_0182143_423_1124 233
323 3300046664 Ga0495659_0003742 Ga0495659_0003742_720_1421 233
324 3300046664 Ga0495659_0027220 Ga0495659_0027220_962_1663 233
325 3300046674 Ga0495588_0108377 Ga0495588_0108377_643_1344 233
326 3300046684 Ga0495669_0051805 Ga0495669_0051805_211_912 233
327 3300046684 Ga0495669_0064403 Ga0495669_0064403_881_1582 233
328 3300046794 Ga0495589_0273159 Ga0495589_0273159_44_745 233
329 3300047318 Ga0495636_0021377 Ga0495636_0021377_1380_2081 233
330 3300047320 Ga0495672_0063418 Ga0495672_0063418_709_1410 233
331 3300047321 Ga0495676_0037587 Ga0495676_0037587_1099_1800 233
332 3300047444 Ga0495675_0142965 Ga0495675_0142965_647_1348 233
333 3300047445 Ga0495677_0079007 Ga0495677_0079007_95_796 233
334 3300047445 Ga0495677_0125524 Ga0495677_0125524_55_756 233
335 3300047447 Ga0495685_004318 Ga0495685_004318_773_1474 233
336 3300048904 Ga0496101_0237779 Ga0496101_0237779_615_1316 233
337 3300048906 Ga0496103_0049977 Ga0496103_0049977_1026_1727 233
338 3300048911 Ga0496108_0000114 Ga0496108_0000114_52376_53128 233
339 3300048911 Ga0496108_0408090 Ga0496108_0408090_124_825 233
340 3300048912 Ga0496109_0077757 Ga0496109_0077757_1503_2204 233
341 3300048913 Ga0496110_0028710 Ga0496110_0028710_1425_2126 233
342 3300048913 Ga0496110_0729561 Ga0496110_0729561_19_720 233
343 3300048914 Ga0496111_0135348 Ga0496111_0135348_1107_1808 233
344 3300048915 Ga0496112_0034459 Ga0496112_0034459_1313_2014 233
345 3300049570 Ga0501033_0095706 Ga0501033_0095706_1413_2114 233
346 3300049572 Ga0501036_0078031 Ga0501036_0078031_540_1250 233
347 3300049572 Ga0501036_0095993 Ga0501036_0095993_1716_2417 233
348 3300049575 Ga0501039_0065527 Ga0501039_0065527_1061_1762 233
349 3300049575 Ga0501039_0072377 Ga0501039_0072377_1710_2411 233
350 3300049576 Ga0501040_0014732 Ga0501040_0014732_3840_4541 233
351 3300049577 Ga0501041_0000881 Ga0501041_0000881_1547_2248 233
352 3300049577 Ga0501041_0146887 Ga0501041_0146887_218_919 233
353 3300049578 Ga0501042_0002368 Ga0501042_0002368_7802_8503 233
354 3300049578 Ga0501042_0306743 Ga0501042_0306743_123_824 233
355 3300049580 Ga0501046_0029483 Ga0501046_0029483_1200_1901 233
356 3300049580 Ga0501046_0098149 Ga0501046_0098149_841_1542 233
357 3300049582 Ga0501048_0129697 Ga0501048_0129697_687_1388 233
358 3300049582 Ga0501048_0411040 Ga0501048_0411040_31_732 233
359 3300049584 Ga0501068_0117732 Ga0501068_0117732_163_864 233
360 3300049584 Ga0501068_0167390 Ga0501068_0167390_35_745 233
361 3300049584 Ga0501068_0189516 Ga0501068_0189516_590_1291 233
362 3300049586 Ga0501070_0625193 Ga0501070_0625193_48_749 233
363 3300049587 Ga0501071_0123613 Ga0501071_0123613_1190_1891 233
364 3300049587 Ga0501071_0452276 Ga0501071_0452276_221_922 233
365 3300049588 Ga0501072_0002447 Ga0501072_0002447_6799_7500 233
366 3300049588 Ga0501072_0006817 Ga0501072_0006817_3481_4182 233
367 3300049588 Ga0501072_0118970 Ga0501072_0118970_1110_1811 233
368 3300049588 Ga0501072_0361712 Ga0501072_0361712_13_789 233
369 3300049589 Ga0501073_0012194 Ga0501073_0012194_2290_3006 233
370 3300049590 Ga0501074_0126137 Ga0501074_0126137_854_1555 233
371 3300049590 Ga0501074_0378523 Ga0501074_0378523_79_939 233
372 3300049591 Ga0501075_0000722 Ga0501075_0000722_12383_13084 233
373 3300049591 Ga0501075_0001143 Ga0501075_0001143_7927_8628 233
374 3300049591 Ga0501075_0058430 Ga0501075_0058430_372_1073 233
375 3300049592 Ga0501076_0007665 Ga0501076_0007665_1615_2316 233
376 3300049592 Ga0501076_0053451 Ga0501076_0053451_1652_2353 233
377 3300049592 Ga0501076_0096406 Ga0501076_0096406_1199_1900 233
378 3300049593 Ga0501077_0000368 Ga0501077_0000368_15608_16309 233
379 3300049593 Ga0501077_0389658 Ga0501077_0389658_37_738 233
380 3300049741 Ga0501079_0007802 Ga0501079_0007802_1724_2425 233
381 3300049741 Ga0501079_0055189 Ga0501079_0055189_1969_2670 233
382 3300049742 Ga0501080_0003587 Ga0501080_0003587_11693_12394 233
383 3300049742 Ga0501080_0430344 Ga0501080_0430344_30_731 233
384 3300049742 Ga0501080_0459904 Ga0501080_0459904_152_853 233
385 3300049743 Ga0501081_0004261 Ga0501081_0004261_3048_3749 233
386 3300049743 Ga0501081_0035755 Ga0501081_0035755_1490_2191 233
387 3300049743 Ga0501081_0416746 Ga0501081_0416746_158_859 233
388 3300049824 Ga0501045_0013310 Ga0501045_0013310_3370_4071 233
389 3300049824 Ga0501045_0018250 Ga0501045_0018250_136_837 233
390 3300050493 nmdc:mga0k408_22051_c1 nmdc:mga0k408_22051_c1_672_1397 233
391 3300050493 nmdc:mga0k408_230268_c1 nmdc:mga0k408_230268_c1_300_1001 233
392 3300050494 nmdc:mga06z11_50181_c1 nmdc:mga06z11_50181_c1_37_738 233
393 3300050494 nmdc:mga06z11_62931_c1 nmdc:mga06z11_62931_c1_759_1484 233
394 3300050495 nmdc:mga04h51_146304_c1 nmdc:mga04h51_146304_c1_129_830 233
395 3300050507 nmdc:mga05p37_1831_c1 nmdc:mga05p37_1831_c1_18993_19694 233
396 3300050507 nmdc:mga05p37_302701_c1 nmdc:mga05p37_302701_c1_662_1363 233
397 3300050507 nmdc:mga05p37_315066_c1 nmdc:mga05p37_315066_c1_254_961 233
398 3300050507 nmdc:mga05p37_321362_c1 nmdc:mga05p37_321362_c1_209_910 233
399 3300050507 nmdc:mga05p37_4082_c1 nmdc:mga05p37_4082_c1_11965_12666 233
400 3300050507 nmdc:mga05p37_414118_c1 nmdc:mga05p37_414118_c1_327_1028 233
401 3300050508 nmdc:mga09592_27305_c1 nmdc:mga09592_27305_c1_1924_2625 233
402 3300050508 nmdc:mga09592_389821_c1 nmdc:mga09592_389821_c1_89_790 233
403 3300050508 nmdc:mga09592_647170_c1 nmdc:mga09592_647170_c1_109_810 233
404 3300050508 nmdc:mga09592_94838_c1 nmdc:mga09592_94838_c1_1183_1884 233
405 3300050509 nmdc:mga0qj67_12929_c1 nmdc:mga0qj67_12929_c1_451_1152 233
406 3300050509 nmdc:mga0qj67_135459_c1 nmdc:mga0qj67_135459_c1_915_1616 233
407 3300050509 nmdc:mga0qj67_158119_c1 nmdc:mga0qj67_158119_c1_60_761 233
408 3300050509 nmdc:mga0qj67_379414_c1 nmdc:mga0qj67_379414_c1_48_749 233
409 3300050510 nmdc:mga06r32_151810_c1 nmdc:mga06r32_151810_c1_1045_1746 233
410 3300050510 nmdc:mga06r32_59862_c1 nmdc:mga06r32_59862_c1_827_1528 233
411 3300050510 nmdc:mga06r32_83109_c1 nmdc:mga06r32_83109_c1_1722_2423 233
412 3300050510 nmdc:mga06r32_83717_c1 nmdc:mga06r32_83717_c1_395_1096 233
413 3300050511 nmdc:mga08y16_20452_c1 nmdc:mga08y16_20452_c1_6183_6884 233
414 3300050512 nmdc:mga0n895_114774_c1 nmdc:mga0n895_114774_c1_690_1391 233
415 3300050512 nmdc:mga0n895_311640_c1 nmdc:mga0n895_311640_c1_426_1127 233
416 3300050512 nmdc:mga0n895_5842_c1 nmdc:mga0n895_5842_c1_5914_6615 233
417 3300050515 nmdc:mga0a205_162635_c1 nmdc:mga0a205_162635_c1_1278_1979 233
418 3300050515 nmdc:mga0a205_36013_c1 nmdc:mga0a205_36013_c1_593_1294 233
419 3300050515 nmdc:mga0a205_71041_c1 nmdc:mga0a205_71041_c1_1117_1818 233
420 3300050515 nmdc:mga0a205_769215_c1 nmdc:mga0a205_769215_c1_80_781 233
421 3300053096 Ga0500641_0003543 Ga0500641_0003543_1628_2365 233
422 3300053139 Ga0500568_0001762 Ga0500568_0001762_113_814 233
423 3300054114 Ga0501084_0013954 Ga0501084_0013954_5761_6462 233
424 3300054114 Ga0501084_0171263 Ga0501084_0171263_977_1678 233
425 3300054114 Ga0501084_0374301 Ga0501084_0374301_63_779 233
426 3300059421 Ga0590071_000146 Ga0590071_000146_13479_14180 233
427 3300059423 Ga0590074_008145 Ga0590074_008145_256_957 233
428 3300059424 Ga0590075_036147 Ga0590075_036147_100_801 233
429 3300059426 Ga0590077_000060 Ga0590077_000060_5279_5980 233
430 3300059426 Ga0590077_003853 Ga0590077_003853_467_1168 233
431 3300060353 Ga0501082_0000015 Ga0501082_0000015_15535_16245 233
432 3300060353 Ga0501082_0001055 Ga0501082_0001055_8706_9407 233
433 3300060353 Ga0501082_0069189 Ga0501082_0069189_1445_2146 233
434 3300061734 Ga0530510_0048983 Ga0530510_0048983_1781_2482 233
435 3300061734 Ga0530510_0169374 Ga0530510_0169374_570_1271 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

8

173

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nqa-assembly2.cif.gz_B crystal structure of galnac-t4 in complex with the monoglycopeptide 3 0.8376 5 111
5nqa-assembly1.cif.gz_A crystal structure of galnac-t4 in complex with the monoglycopeptide 3 0.8331 5 112
6h0b-assembly2.cif.gz_B crystal structure of the human galnac-t4 in complex with udp, manganese and the diglycopeptide 6. 0.8065 5 111
1xhb-assembly1.cif.gz_A the crystal structure of udp-galnac: polypeptide alpha-n-acetylgalactosaminyltransferase-t1 0.7979 3 111
7p5l-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 - apo form 0.7738 3 233
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9161 6 223 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8958 6 223 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8725 7 230 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8432 1 232 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8366 1 232 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3N5GRG0-F1-model_v4 Glycosyltransferase family 2 protein 0.9605 1 233 GO:0016757
AF-A0A3N5GRG0-F1-model_v4 Glycosyltransferase family 2 protein 0.9565 1 233 GO:0016757
AF-A0A535Y9A2-F1-model_v4 Glycosyltransferase family 2 protein 0.9553 1 232 GO:0016757
AF-K1X9F1-F1-model_v4 Glycosyl transferase family protein 0.9547 1 232 GO:0016757
AF-A0A842NWJ9-F1-model_v4 Glycosyltransferase family 2 protein 0.9516 1 231 GO:0016757

Feature Viewer

pLDDT pTM Quality
83.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map