F443418
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 226 | 435 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0361712|Ga0501072_0361712_13_789 |
| Length | 258 |
| Sequence | MWQGQRVVVVFPAYNEEAGIGAAIADFRDASEGAVDEVIAVDNNSRDGTAGLIRDAGATYVLERRQGYGYALQRGMAEAVAGGAGLIVLAEPDGTFAGKDVLKLLAFADDFDLVLGTRTTPELIWQEANMGRFLRWGNWVVAKLLQVLFGGPSLSDCGCTLRLLRRDAYLAIRDRLTVGGSHFLPEMVCLSLQRGLRVVEVPVNYRGRIGESKITGSPLTAVRVGLRMIGLILRYRLRSGPLWRPRPLAATPRESLRY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 140 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 147 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 148 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 149 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 150 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 186 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 187 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 209 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 210 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 211 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 219 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 220 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 222 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 223 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 224 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 225 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.76 |
| Nodule | 0 |
| Rhizoplane | 2.07 |
| Rhizosphere | 92.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2711636 | 2162886007 | Bacteria | 1218 |
| 2 | Ga0065704_10003954 | 3300005289 | Bacteria | 7123 |
| 3 | Ga0065712_10095763 | 3300005290 | Bacteria | 2190 |
| 4 | Ga0065715_10116607 | 3300005293 | Bacteria | 2373 |
| 5 | Ga0065715_10160639 | 3300005293 | Unclassified | 1633 |
| 6 | Ga0065707_10004875 | 3300005295 | Unclassified | 4275 |
| 7 | Ga0065707_10006638 | 3300005295 | Bacteria | 3740 |
| 8 | Ga0065707_10209933 | 3300005295 | Bacteria | 1270 |
| 9 | Ga0070676_10099511 | 3300005328 | Unclassified | 1794 |
| 10 | Ga0070683_100000027 | 3300005329 | Bacteria | 172200 |
| 11 | Ga0070683_100030672 | 3300005329 | Bacteria | 4883 |
| 12 | Ga0070690_100304941 | 3300005330 | Unclassified | 1143 |
| 13 | Ga0070690_100761825 | 3300005330 | Unclassified | 748 |
| 14 | Ga0070670_100010745 | 3300005331 | Bacteria | 7820 |
| 15 | Ga0070670_100015718 | 3300005331 | Bacteria | 6497 |
| 16 | Ga0070670_100146731 | 3300005331 | Unclassified | 2041 |
| 17 | Ga0068869_100469223 | 3300005334 | Unclassified | 1046 |
| 18 | Ga0070682_100406364 | 3300005337 | Bacteria | 1031 |
| 19 | Ga0068868_100066648 | 3300005338 | Bacteria | 2863 |
| 20 | Ga0070689_100042562 | 3300005340 | Bacteria | 3487 |
| 21 | Ga0070689_100529698 | 3300005340 | Unclassified | 1013 |
| 22 | Ga0070687_100173291 | 3300005343 | Bacteria | 1286 |
| 23 | Ga0070692_10041396 | 3300005345 | Unclassified | 2360 |
| 24 | Ga0070668_100419075 | 3300005347 | Bacteria | 1146 |
| 25 | Ga0070669_100004052 | 3300005353 | Bacteria | 10598 |
| 26 | Ga0070675_100007304 | 3300005354 | Bacteria | 8529 |
| 27 | Ga0070675_100053914 | 3300005354 | Bacteria | 3307 |
| 28 | Ga0070675_100074800 | 3300005354 | Unclassified | 2815 |
| 29 | Ga0070675_100091338 | 3300005354 | Bacteria | 2551 |
| 30 | Ga0070671_100032449 | 3300005355 | Bacteria | 4317 |
| 31 | Ga0070671_100461678 | 3300005355 | Unclassified | 1090 |
| 32 | Ga0070674_100013797 | 3300005356 | Bacteria | 5003 |
| 33 | Ga0070674_100034615 | 3300005356 | Bacteria | 3375 |
| 34 | Ga0070673_100038263 | 3300005364 | Bacteria | 3662 |
| 35 | Ga0070673_100121438 | 3300005364 | Bacteria | 2180 |
| 36 | Ga0070673_100272529 | 3300005364 | Unclassified | 1482 |
| 37 | Ga0070688_100025371 | 3300005365 | Bacteria | 3509 |
| 38 | Ga0070688_100036121 | 3300005365 | Bacteria | 3004 |
| 39 | Ga0070688_100498642 | 3300005365 | Bacteria | 918 |
| 40 | Ga0070659_100148650 | 3300005366 | Unclassified | 1910 |
| 41 | Ga0070703_10009130 | 3300005406 | Unclassified | 2797 |
| 42 | Ga0070701_10064546 | 3300005438 | Bacteria | 1941 |
| 43 | Ga0070701_10105428 | 3300005438 | Unclassified | 1568 |
| 44 | Ga0070705_100148011 | 3300005440 | Bacteria | 1554 |
| 45 | Ga0070700_100265463 | 3300005441 | Bacteria | 1238 |
| 46 | Ga0070694_100001238 | 3300005444 | Bacteria | 14777 |
| 47 | Ga0070694_100009433 | 3300005444 | Bacteria | 5986 |
| 48 | Ga0070678_100192424 | 3300005456 | Bacteria | 1678 |
| 49 | Ga0070681_10099576 | 3300005458 | Unclassified | 2852 |
| 50 | Ga0070681_10262499 | 3300005458 | Bacteria | 1639 |
| 51 | Ga0068867_100003118 | 3300005459 | Bacteria | 11692 |
| 52 | Ga0070706_100086644 | 3300005467 | Bacteria | 2902 |
| 53 | Ga0070706_100147164 | 3300005467 | Bacteria | 2200 |
| 54 | Ga0070706_100182486 | 3300005467 | Bacteria | 1960 |
| 55 | Ga0070706_100221028 | 3300005467 | Bacteria | 1768 |
| 56 | Ga0070707_100065317 | 3300005468 | Unclassified | 3495 |
| 57 | Ga0070707_100191529 | 3300005468 | Unclassified | 1994 |
| 58 | Ga0070698_100000770 | 3300005471 | Bacteria | 34710 |
| 59 | Ga0070699_100002967 | 3300005518 | Bacteria | 15083 |
| 60 | Ga0070684_100000293 | 3300005535 | Bacteria | 34699 |
| 61 | Ga0070684_100297774 | 3300005535 | Bacteria | 1480 |
| 62 | Ga0070697_100144930 | 3300005536 | Bacteria | 1999 |
| 63 | Ga0070697_100295129 | 3300005536 | Bacteria | 1393 |
| 64 | Ga0068853_100842934 | 3300005539 | Bacteria | 879 |
| 65 | Ga0070672_100030669 | 3300005543 | Bacteria | 4042 |
| 66 | Ga0070672_100248800 | 3300005543 | Bacteria | 1497 |
| 67 | Ga0070686_100270735 | 3300005544 | Unclassified | 1249 |
| 68 | Ga0070695_100000417 | 3300005545 | Bacteria | 22026 |
| 69 | Ga0070696_100000783 | 3300005546 | Bacteria | 20460 |
| 70 | Ga0070696_100019436 | 3300005546 | Bacteria | 4600 |
| 71 | Ga0070696_100137916 | 3300005546 | Unclassified | 1780 |
| 72 | Ga0070665_100091324 | 3300005548 | Bacteria | 3050 |
| 73 | Ga0070704_100001511 | 3300005549 | Bacteria | 12543 |
| 74 | Ga0070704_100236361 | 3300005549 | Bacteria | 1493 |
| 75 | Ga0070704_100305897 | 3300005549 | Bacteria | 1326 |
| 76 | Ga0070704_100474373 | 3300005549 | Unclassified | 1081 |
| 77 | Ga0070664_100181481 | 3300005564 | Bacteria | 1871 |
| 78 | Ga0070664_100208186 | 3300005564 | Bacteria | 1747 |
| 79 | Ga0068857_100692556 | 3300005577 | Bacteria | 968 |
| 80 | Ga0068854_100071817 | 3300005578 | Unclassified | 2533 |
| 81 | Ga0070702_100177790 | 3300005615 | Unclassified | 1390 |
| 82 | Ga0068859_100026831 | 3300005617 | Bacteria | 5778 |
| 83 | Ga0068859_100051562 | 3300005617 | Bacteria | 4136 |
| 84 | Ga0068864_100000035 | 3300005618 | Bacteria | 195218 |
| 85 | Ga0068864_100053793 | 3300005618 | Unclassified | 3474 |
| 86 | Ga0068861_100002659 | 3300005719 | Bacteria | 11698 |
| 87 | Ga0068861_100437683 | 3300005719 | Unclassified | 1169 |
| 88 | Ga0068870_10001008 | 3300005840 | Bacteria | 11127 |
| 89 | Ga0068863_100101160 | 3300005841 | Unclassified | 2740 |
| 90 | Ga0068863_100352434 | 3300005841 | Unclassified | 1433 |
| 91 | Ga0068858_100054490 | 3300005842 | Bacteria | 3698 |
| 92 | Ga0068860_100003012 | 3300005843 | Bacteria | 17406 |
| 93 | Ga0068862_100000965 | 3300005844 | Bacteria | 27670 |
| 94 | Ga0068862_100620430 | 3300005844 | Bacteria | 1040 |
| 95 | Ga0075368_10005342 | 3300006042 | Unclassified | 4416 |
| 96 | Ga0075367_10011813 | 3300006178 | Bacteria | 4637 |
| 97 | Ga0075367_10127230 | 3300006178 | Bacteria | 1573 |
| 98 | Ga0075366_10019271 | 3300006195 | Bacteria | 3945 |
| 99 | Ga0075366_10149204 | 3300006195 | Bacteria | 1415 |
| 100 | Ga0097621_100028503 | 3300006237 | Bacteria | 4400 |
| 101 | Ga0097621_100312471 | 3300006237 | Bacteria | 1390 |
| 102 | Ga0097621_100422691 | 3300006237 | Unclassified | 1196 |
| 103 | Ga0068871_100745716 | 3300006358 | Bacteria | 900 |
| 104 | Ga0075428_100008458 | 3300006844 | Bacteria | 11414 |
| 105 | Ga0075428_100016908 | 3300006844 | Bacteria | 8056 |
| 106 | Ga0075428_100025232 | 3300006844 | Bacteria | 6578 |
| 107 | Ga0075428_100167706 | 3300006844 | Bacteria | 2381 |
| 108 | Ga0075428_100448605 | 3300006844 | Unclassified | 1382 |
| 109 | Ga0075428_100961672 | 3300006844 | Unclassified | 905 |
| 110 | Ga0075430_100007258 | 3300006846 | Bacteria | 9358 |
| 111 | Ga0075430_100009455 | 3300006846 | Bacteria | 8237 |
| 112 | Ga0075430_100023335 | 3300006846 | Bacteria | 5264 |
| 113 | Ga0075430_100026505 | 3300006846 | Bacteria | 4930 |
| 114 | Ga0075430_100341014 | 3300006846 | Bacteria | 1238 |
| 115 | Ga0075430_100394579 | 3300006846 | Unclassified | 1142 |
| 116 | Ga0075431_100008515 | 3300006847 | Bacteria | 10272 |
| 117 | Ga0075431_100012074 | 3300006847 | Bacteria | 8717 |
| 118 | Ga0075431_100016233 | 3300006847 | Bacteria | 7555 |
| 119 | Ga0075431_100027874 | 3300006847 | Bacteria | 5796 |
| 120 | Ga0075431_100036925 | 3300006847 | Bacteria | 5033 |
| 121 | Ga0075431_100095439 | 3300006847 | Bacteria | 3070 |
| 122 | Ga0075431_100143641 | 3300006847 | Bacteria | 2459 |
| 123 | Ga0075433_10052535 | 3300006852 | Bacteria | 3551 |
| 124 | Ga0075433_10073927 | 3300006852 | Bacteria | 2999 |
| 125 | Ga0075433_10123302 | 3300006852 | Bacteria | 2302 |
| 126 | Ga0075433_10251758 | 3300006852 | Unclassified | 1567 |
| 127 | Ga0075434_100022164 | 3300006871 | Bacteria | 6186 |
| 128 | Ga0075434_100056160 | 3300006871 | Unclassified | 3913 |
| 129 | Ga0075434_100113777 | 3300006871 | Bacteria | 2718 |
| 130 | Ga0075434_100124080 | 3300006871 | Unclassified | 2599 |
| 131 | Ga0075429_100006733 | 3300006880 | Bacteria | 9965 |
| 132 | Ga0075429_100030787 | 3300006880 | Bacteria | 4663 |
| 133 | Ga0075429_100037706 | 3300006880 | Bacteria | 4208 |
| 134 | Ga0075429_100595398 | 3300006880 | Bacteria | 969 |
| 135 | Ga0068865_100113221 | 3300006881 | Bacteria | 2005 |
| 136 | Ga0068865_100118559 | 3300006881 | Unclassified | 1964 |
| 137 | Ga0068865_100514754 | 3300006881 | Unclassified | 1000 |
| 138 | Ga0075436_100303187 | 3300006914 | Bacteria | 1145 |
| 139 | Ga0097620_100026831 | 3300006931 | Bacteria | 5778 |
| 140 | Ga0097620_100051563 | 3300006931 | Bacteria | 4136 |
| 141 | Ga0075435_100009548 | 3300007076 | Bacteria | 7034 |
| 142 | Ga0075435_100155518 | 3300007076 | Unclassified | 1924 |
| 143 | Ga0075435_100233173 | 3300007076 | Unclassified | 1564 |
| 144 | Ga0111539_10021249 | 3300009094 | Bacteria | 7991 |
| 145 | Ga0111539_10961141 | 3300009094 | Bacteria | 993 |
| 146 | Ga0105245_10739029 | 3300009098 | Bacteria | 1019 |
| 147 | Ga0105247_10226778 | 3300009101 | Bacteria | 1267 |
| 148 | Ga0114129_10000560 | 3300009147 | Bacteria | 45696 |
| 149 | Ga0114129_10008161 | 3300009147 | Bacteria | 14918 |
| 150 | Ga0114129_10019720 | 3300009147 | Bacteria | 9597 |
| 151 | Ga0114129_10041432 | 3300009147 | Bacteria | 6488 |
| 152 | Ga0114129_10103801 | 3300009147 | Bacteria | 3929 |
| 153 | Ga0114129_10186272 | 3300009147 | Unclassified | 2821 |
| 154 | Ga0114129_10327353 | 3300009147 | Unclassified | 2035 |
| 155 | Ga0114129_10344828 | 3300009147 | Unclassified | 1974 |
| 156 | Ga0114129_10509195 | 3300009147 | Bacteria | 1571 |
| 157 | Ga0114129_10542023 | 3300009147 | Bacteria | 1514 |
| 158 | Ga0114129_11314661 | 3300009147 | Unclassified | 895 |
| 159 | Ga0105243_10193350 | 3300009148 | Bacteria | 1779 |
| 160 | Ga0105248_10337528 | 3300009177 | Bacteria | 1697 |
| 161 | Ga0105249_10017989 | 3300009553 | Bacteria | 6282 |
| 162 | Ga0105239_10678709 | 3300010375 | Bacteria | 1177 |
| 163 | Ga0157369_10000363 | 3300013105 | Bacteria | 60464 |
| 164 | Ga0157378_10261213 | 3300013297 | Unclassified | 1661 |
| 165 | Ga0157378_10265995 | 3300013297 | Unclassified | 1647 |
| 166 | Ga0163162_10457478 | 3300013306 | Bacteria | 1408 |
| 167 | Ga0157375_10004712 | 3300013308 | Bacteria | 11863 |
| 168 | Ga0157375_10183885 | 3300013308 | Unclassified | 2243 |
| 169 | Ga0157380_10185716 | 3300014326 | Bacteria | 1831 |
| 170 | Ga0157380_10195099 | 3300014326 | Unclassified | 1791 |
| 171 | Ga0157380_10492113 | 3300014326 | Bacteria | 1189 |
| 172 | Ga0157377_10025164 | 3300014745 | Bacteria | 3172 |
| 173 | Ga0157376_10199727 | 3300014969 | Unclassified | 1839 |
| 174 | Ga0157376_11247075 | 3300014969 | Bacteria | 772 |
| 175 | Ga0213876_10022844 | 3300021384 | Bacteria | 3304 |
| 176 | Ga0213875_10066872 | 3300021388 | Unclassified | 1679 |
| 177 | Ga0207697_10000977 | 3300025315 | Bacteria | 16038 |
| 178 | Ga0207653_10007614 | 3300025885 | Bacteria | 3377 |
| 179 | Ga0207653_10034966 | 3300025885 | Bacteria | 1633 |
| 180 | Ga0207688_10034210 | 3300025901 | Bacteria | 2813 |
| 181 | Ga0207643_10000836 | 3300025908 | Bacteria | 18714 |
| 182 | Ga0207684_10410851 | 3300025910 | Bacteria | 1163 |
| 183 | Ga0207707_10010138 | 3300025912 | Bacteria | 8176 |
| 184 | Ga0207662_10137365 | 3300025918 | Bacteria | 1546 |
| 185 | Ga0207646_10158212 | 3300025922 | Unclassified | 2044 |
| 186 | Ga0207646_10301762 | 3300025922 | Bacteria | 1447 |
| 187 | Ga0207646_10555662 | 3300025922 | Unclassified | 1032 |
| 188 | Ga0207681_10005277 | 3300025923 | Bacteria | 7936 |
| 189 | Ga0207681_10029416 | 3300025923 | Bacteria | 3568 |
| 190 | Ga0207650_10447138 | 3300025925 | Bacteria | 1075 |
| 191 | Ga0207659_10000972 | 3300025926 | Bacteria | 17095 |
| 192 | Ga0207659_10068949 | 3300025926 | Unclassified | 2574 |
| 193 | Ga0207690_10316209 | 3300025932 | Unclassified | 1226 |
| 194 | Ga0207706_10031618 | 3300025933 | Bacteria | 4715 |
| 195 | Ga0207706_10401603 | 3300025933 | Bacteria | 1188 |
| 196 | Ga0207709_10076420 | 3300025935 | Bacteria | 2144 |
| 197 | Ga0207670_10025838 | 3300025936 | Bacteria | 3692 |
| 198 | Ga0207670_10313713 | 3300025936 | Bacteria | 1232 |
| 199 | Ga0207669_10015650 | 3300025937 | Bacteria | 3831 |
| 200 | Ga0207669_10044318 | 3300025937 | Bacteria | 2613 |
| 201 | Ga0207704_10033681 | 3300025938 | Unclassified | 2916 |
| 202 | Ga0207704_10149349 | 3300025938 | Bacteria | 1647 |
| 203 | Ga0207691_10029954 | 3300025940 | Bacteria | 5089 |
| 204 | Ga0207691_10221692 | 3300025940 | Bacteria | 1639 |
| 205 | Ga0207689_10151976 | 3300025942 | Unclassified | 1908 |
| 206 | Ga0207689_10510440 | 3300025942 | Unclassified | 1008 |
| 207 | Ga0207661_10000015 | 3300025944 | Bacteria | 318960 |
| 208 | Ga0207661_10333998 | 3300025944 | Bacteria | 1365 |
| 209 | Ga0207661_10335183 | 3300025944 | Bacteria | 1362 |
| 210 | Ga0207679_10013659 | 3300025945 | Bacteria | 5325 |
| 211 | Ga0207679_10021682 | 3300025945 | Bacteria | 4360 |
| 212 | Ga0207679_10083381 | 3300025945 | Bacteria | 2450 |
| 213 | Ga0207651_10025703 | 3300025960 | Bacteria | 3665 |
| 214 | Ga0207651_10214785 | 3300025960 | Unclassified | 1551 |
| 215 | Ga0207651_10230039 | 3300025960 | Unclassified | 1504 |
| 216 | Ga0207651_10470802 | 3300025960 | Bacteria | 1081 |
| 217 | Ga0207712_10009112 | 3300025961 | Bacteria | 6278 |
| 218 | Ga0207668_10219029 | 3300025972 | Bacteria | 1527 |
| 219 | Ga0207677_10078087 | 3300026023 | Bacteria | 2363 |
| 220 | Ga0207703_10169388 | 3300026035 | Bacteria | 1920 |
| 221 | Ga0207639_10815497 | 3300026041 | Bacteria | 870 |
| 222 | Ga0207708_10003080 | 3300026075 | Bacteria | 12275 |
| 223 | Ga0207708_10116976 | 3300026075 | Unclassified | 2074 |
| 224 | Ga0207641_10484597 | 3300026088 | Bacteria | 1199 |
| 225 | Ga0207648_10006372 | 3300026089 | Bacteria | 11737 |
| 226 | Ga0207676_10000026 | 3300026095 | Bacteria | 248593 |
| 227 | Ga0207676_10039500 | 3300026095 | Unclassified | 3610 |
| 228 | Ga0207676_10153660 | 3300026095 | Unclassified | 1985 |
| 229 | Ga0207674_10036111 | 3300026116 | Bacteria | 5154 |
| 230 | Ga0207674_10485375 | 3300026116 | Bacteria | 1194 |
| 231 | Ga0207674_10699252 | 3300026116 | Bacteria | 979 |
| 232 | Ga0207675_100002702 | 3300026118 | Bacteria | 17472 |
| 233 | Ga0207675_100125482 | 3300026118 | Bacteria | 2431 |
| 234 | Ga0207683_10032368 | 3300026121 | Bacteria | 4542 |
| 235 | Ga0207683_10578006 | 3300026121 | Bacteria | 1039 |
| 236 | Ga0209971_1054683 | 3300027682 | Unclassified | 965 |
| 237 | Ga0209971_1054949 | 3300027682 | Bacteria | 963 |
| 238 | Ga0207428_10001903 | 3300027907 | Bacteria | 21136 |
| 239 | Ga0268265_10000887 | 3300028380 | Bacteria | 27910 |
| 240 | Ga0268264_10001791 | 3300028381 | Bacteria | 19636 |
| 241 | Ga0265319_1031939 | 3300028563 | Bacteria | 1829 |
| 242 | Ga0265318_10058774 | 3300028577 | Bacteria | 1434 |
| 243 | Ga0265338_10034296 | 3300028800 | Bacteria | 4908 |
| 244 | Ga0307413_10034991 | 3300031824 | Bacteria | 2877 |
| 245 | Ga0307413_10127585 | 3300031824 | Bacteria | 1735 |
| 246 | Ga0307410_10007408 | 3300031852 | Bacteria | 6004 |
| 247 | Ga0307410_10156296 | 3300031852 | Bacteria | 1703 |
| 248 | Ga0307406_10012061 | 3300031901 | Bacteria | 4917 |
| 249 | Ga0307407_10000821 | 3300031903 | Bacteria | 10305 |
| 250 | Ga0307407_10266484 | 3300031903 | Unclassified | 1180 |
| 251 | Ga0307412_10029797 | 3300031911 | Unclassified | 3428 |
| 252 | Ga0307412_10491357 | 3300031911 | Unclassified | 1020 |
| 253 | Ga0307409_100012234 | 3300031995 | Bacteria | 5458 |
| 254 | Ga0307409_100367500 | 3300031995 | Unclassified | 1363 |
| 255 | Ga0307409_100492667 | 3300031995 | Bacteria | 1192 |
| 256 | Ga0307416_100055057 | 3300032002 | Unclassified | 3201 |
| 257 | Ga0307416_100274902 | 3300032002 | Bacteria | 1657 |
| 258 | Ga0307416_100878169 | 3300032002 | Bacteria | 996 |
| 259 | Ga0307414_10011345 | 3300032004 | Bacteria | 5221 |
| 260 | Ga0307411_10008912 | 3300032005 | Bacteria | 5234 |
| 261 | Ga0307411_10020136 | 3300032005 | Bacteria | 3872 |
| 262 | Ga0307415_100142752 | 3300032126 | Bacteria | 1831 |
| 263 | Ga0373932_0122933 | 3300035112 | Unclassified | 867 |
| 264 | Ga0373945_0243051 | 3300035116 | Bacteria | 758 |
| 265 | Ga0373962_0009357 | 3300035242 | Bacteria | 2427 |
| 266 | Ga0373937_0001515 | 3300036401 | Bacteria | 19517 |
| 267 | Ga0436364_0197126 | 3300037853 | Bacteria | 2040 |
| 268 | Ga0436364_0334514 | 3300037853 | Bacteria | 6855 |
| 269 | Ga0436364_0515695 | 3300037853 | Bacteria | 2930 |
| 270 | Ga0436364_1509325 | 3300037853 | Bacteria | 1104 |
| 271 | Ga0436365_0133092 | 3300039437 | Bacteria | 26573 |
| 272 | Ga0436365_0872509 | 3300039437 | Bacteria | 2211 |
| 273 | Ga0436365_0986342 | 3300039437 | Bacteria | 1815 |
| 274 | Ga0436365_1186907 | 3300039437 | Bacteria | 1878 |
| 275 | Ga0436365_1216125 | 3300039437 | Bacteria | 5830 |
| 276 | Ga0436365_1281712 | 3300039437 | Bacteria | 80367 |
| 277 | Ga0436363_1044428 | 3300039450 | Unclassified | 2866 |
| 278 | Ga0436362_0025424 | 3300039453 | Unclassified | 1131 |
| 279 | Ga0439435_0000660 | 3300042436 | Bacteria | 5691 |
| 280 | Ga0439435_0004062 | 3300042436 | Bacteria | 3117 |
| 281 | Ga0451577_0112336 | 3300042876 | Bacteria | 2438 |
| 282 | Ga0451577_0215901 | 3300042876 | Bacteria | 1733 |
| 283 | Ga0439440_0034385 | 3300042993 | Unclassified | 1212 |
| 284 | Ga0453684_0011209 | 3300044712 | Bacteria | 15091 |
| 285 | Ga0453684_0046010 | 3300044712 | Bacteria | 5812 |
| 286 | Ga0453684_0182838 | 3300044712 | Bacteria | 2460 |
| 287 | Ga0451576_0006349 | 3300045051 | Bacteria | 14518 |
| 288 | Ga0451576_0009970 | 3300045051 | Bacteria | 10955 |
| 289 | Ga0451576_0040455 | 3300045051 | Bacteria | 4933 |
| 290 | Ga0451576_0132350 | 3300045051 | Unclassified | 2600 |
| 291 | Ga0451576_0361958 | 3300045051 | Bacteria | 1519 |
| 292 | Ga0451576_0434345 | 3300045051 | Bacteria | 1378 |
| 293 | Ga0466967_0516191 | 3300045976 | Bacteria | 1174 |
| 294 | Ga0495603_0016873 | 3300046455 | Bacteria | 4419 |
| 295 | Ga0495629_0044289 | 3300046459 | Bacteria | 3123 |
| 296 | Ga0495629_0409209 | 3300046459 | Bacteria | 921 |
| 297 | Ga0495638_0022044 | 3300046460 | Bacteria | 4186 |
| 298 | Ga0495651_0326883 | 3300046462 | Bacteria | 1020 |
| 299 | Ga0495580_0374070 | 3300046472 | Unclassified | 963 |
| 300 | Ga0495584_0049314 | 3300046491 | Bacteria | 2121 |
| 301 | Ga0495594_0094450 | 3300046499 | Bacteria | 1678 |
| 302 | Ga0495594_0319940 | 3300046499 | Unclassified | 884 |
| 303 | Ga0495643_0004818 | 3300046522 | Bacteria | 9296 |
| 304 | Ga0495663_0014584 | 3300046525 | Bacteria | 2204 |
| 305 | Ga0495642_0004304 | 3300046528 | Bacteria | 5530 |
| 306 | Ga0495598_0091958 | 3300046537 | Bacteria | 991 |
| 307 | Ga0495598_0114691 | 3300046537 | Unclassified | 907 |
| 308 | Ga0495609_0098033 | 3300046538 | Bacteria | 1271 |
| 309 | Ga0495621_0005672 | 3300046539 | Bacteria | 3603 |
| 310 | Ga0495621_0022640 | 3300046539 | Bacteria | 2085 |
| 311 | Ga0495633_0224498 | 3300046558 | Unclassified | 859 |
| 312 | Ga0495656_0051830 | 3300046615 | Bacteria | 1758 |
| 313 | Ga0495668_0182143 | 3300046616 | Bacteria | 1151 |
| 314 | Ga0495659_0003742 | 3300046664 | Bacteria | 4837 |
| 315 | Ga0495659_0027220 | 3300046664 | Bacteria | 1971 |
| 316 | Ga0495588_0108377 | 3300046674 | Bacteria | 1462 |
| 317 | Ga0495669_0051805 | 3300046684 | Unclassified | 1843 |
| 318 | Ga0495669_0064403 | 3300046684 | Bacteria | 1663 |
| 319 | Ga0495589_0273159 | 3300046794 | Unclassified | 787 |
| 320 | Ga0495636_0021377 | 3300047318 | Bacteria | 2612 |
| 321 | Ga0495672_0063418 | 3300047320 | Unclassified | 2121 |
| 322 | Ga0495676_0037587 | 3300047321 | Bacteria | 4028 |
| 323 | Ga0495675_0142965 | 3300047444 | Bacteria | 1482 |
| 324 | Ga0495677_0079007 | 3300047445 | Bacteria | 1232 |
| 325 | Ga0495677_0125524 | 3300047445 | Bacteria | 980 |
| 326 | Ga0495685_004318 | 3300047447 | Bacteria | 4584 |
| 327 | Ga0496101_0237779 | 3300048904 | Bacteria | 1417 |
| 328 | Ga0496103_0049977 | 3300048906 | Bacteria | 2586 |
| 329 | Ga0496108_0000114 | 3300048911 | Bacteria | 81031 |
| 330 | Ga0496108_0408090 | 3300048911 | Bacteria | 1186 |
| 331 | Ga0496109_0077757 | 3300048912 | Unclassified | 3054 |
| 332 | Ga0496110_0028710 | 3300048913 | Bacteria | 4781 |
| 333 | Ga0496110_0729561 | 3300048913 | Unclassified | 893 |
| 334 | Ga0496111_0135348 | 3300048914 | Bacteria | 1825 |
| 335 | Ga0496112_0034459 | 3300048915 | Bacteria | 4927 |
| 336 | Ga0501033_0095706 | 3300049570 | Bacteria | 2170 |
| 337 | Ga0501036_0078031 | 3300049572 | Bacteria | 2802 |
| 338 | Ga0501036_0095993 | 3300049572 | Bacteria | 2506 |
| 339 | Ga0501039_0065527 | 3300049575 | Bacteria | 2818 |
| 340 | Ga0501039_0072377 | 3300049575 | Bacteria | 2678 |
| 341 | Ga0501040_0014732 | 3300049576 | Bacteria | 5158 |
| 342 | Ga0501041_0000881 | 3300049577 | Bacteria | 16230 |
| 343 | Ga0501041_0146887 | 3300049577 | Bacteria | 1471 |
| 344 | Ga0501042_0002368 | 3300049578 | Bacteria | 11557 |
| 345 | Ga0501042_0306743 | 3300049578 | Bacteria | 1147 |
| 346 | Ga0501046_0029483 | 3300049580 | Bacteria | 4460 |
| 347 | Ga0501046_0098149 | 3300049580 | Unclassified | 2250 |
| 348 | Ga0501048_0129697 | 3300049582 | Unclassified | 1783 |
| 349 | Ga0501048_0411040 | 3300049582 | Unclassified | 968 |
| 350 | Ga0501068_0117732 | 3300049584 | Bacteria | 1655 |
| 351 | Ga0501068_0167390 | 3300049584 | Bacteria | 1386 |
| 352 | Ga0501068_0189516 | 3300049584 | Bacteria | 1302 |
| 353 | Ga0501070_0625193 | 3300049586 | Unclassified | 857 |
| 354 | Ga0501071_0123613 | 3300049587 | Bacteria | 1919 |
| 355 | Ga0501071_0452276 | 3300049587 | Unclassified | 983 |
| 356 | Ga0501072_0002447 | 3300049588 | Bacteria | 13910 |
| 357 | Ga0501072_0006817 | 3300049588 | Bacteria | 8672 |
| 358 | Ga0501072_0118970 | 3300049588 | Archaea | 2105 |
| 359 | Ga0501072_0361712 | 3300049588 | Bacteria | 1152 |
| 360 | Ga0501073_0012194 | 3300049589 | Bacteria | 6276 |
| 361 | Ga0501074_0126137 | 3300049590 | Bacteria | 1831 |
| 362 | Ga0501074_0378523 | 3300049590 | Unclassified | 1004 |
| 363 | Ga0501075_0000722 | 3300049591 | Bacteria | 20491 |
| 364 | Ga0501075_0001143 | 3300049591 | Bacteria | 17114 |
| 365 | Ga0501075_0058430 | 3300049591 | Bacteria | 2905 |
| 366 | Ga0501076_0007665 | 3300049592 | Bacteria | 7861 |
| 367 | Ga0501076_0053451 | 3300049592 | Bacteria | 3201 |
| 368 | Ga0501076_0096406 | 3300049592 | Unclassified | 2382 |
| 369 | Ga0501077_0000368 | 3300049593 | Bacteria | 26895 |
| 370 | Ga0501077_0389658 | 3300049593 | Bacteria | 890 |
| 371 | Ga0501079_0007802 | 3300049741 | Bacteria | 8104 |
| 372 | Ga0501079_0055189 | 3300049741 | Bacteria | 3066 |
| 373 | Ga0501080_0003587 | 3300049742 | Bacteria | 13665 |
| 374 | Ga0501080_0430344 | 3300049742 | Unclassified | 1185 |
| 375 | Ga0501080_0459904 | 3300049742 | Bacteria | 1140 |
| 376 | Ga0501081_0004261 | 3300049743 | Bacteria | 9169 |
| 377 | Ga0501081_0035755 | 3300049743 | Bacteria | 3383 |
| 378 | Ga0501081_0416746 | 3300049743 | Unclassified | 995 |
| 379 | Ga0501045_0013310 | 3300049824 | Bacteria | 5808 |
| 380 | Ga0501045_0018250 | 3300049824 | Bacteria | 4989 |
| 381 | nmdc:mga0k408_22051_c1 | 3300050493 | Bacteria | 3583 |
| 382 | nmdc:mga0k408_230268_c1 | 3300050493 | Unclassified | 1106 |
| 383 | nmdc:mga06z11_50181_c1 | 3300050494 | Bacteria | 2132 |
| 384 | nmdc:mga06z11_62931_c1 | 3300050494 | Bacteria | 1940 |
| 385 | nmdc:mga04h51_146304_c1 | 3300050495 | Bacteria | 900 |
| 386 | nmdc:mga05p37_1831_c1 | 3300050507 | Bacteria | 24798 |
| 387 | nmdc:mga05p37_282354_c1 | 3300050507 | Bacteria | 1979 |
| 388 | nmdc:mga05p37_302701_c1 | 3300050507 | Bacteria | 1899 |
| 389 | nmdc:mga05p37_315066_c1 | 3300050507 | Unclassified | 1853 |
| 390 | nmdc:mga05p37_321362_c1 | 3300050507 | Bacteria | 1832 |
| 391 | nmdc:mga05p37_4082_c1 | 3300050507 | Bacteria | 17066 |
| 392 | nmdc:mga05p37_414118_c1 | 3300050507 | Bacteria | 1570 |
| 393 | nmdc:mga05p37_5428_c1 | 3300050507 | Bacteria | 14983 |
| 394 | nmdc:mga09592_2301_c1 | 3300050508 | Bacteria | 15405 |
| 395 | nmdc:mga09592_27305_c1 | 3300050508 | Bacteria | 4736 |
| 396 | nmdc:mga09592_389821_c1 | 3300050508 | Unclassified | 1204 |
| 397 | nmdc:mga09592_478586_c1 | 3300050508 | Bacteria | 1073 |
| 398 | nmdc:mga09592_647170_c1 | 3300050508 | Unclassified | 903 |
| 399 | nmdc:mga09592_94838_c1 | 3300050508 | Bacteria | 2552 |
| 400 | nmdc:mga0qj67_1114_c1 | 3300050509 | Bacteria | 18629 |
| 401 | nmdc:mga0qj67_12929_c1 | 3300050509 | Bacteria | 6299 |
| 402 | nmdc:mga0qj67_135459_c1 | 3300050509 | Bacteria | 1996 |
| 403 | nmdc:mga0qj67_158119_c1 | 3300050509 | Unclassified | 1840 |
| 404 | nmdc:mga0qj67_379414_c1 | 3300050509 | Unclassified | 1142 |
| 405 | nmdc:mga0qj67_41622_c1 | 3300050509 | Bacteria | 3614 |
| 406 | nmdc:mga06r32_151810_c1 | 3300050510 | Bacteria | 2295 |
| 407 | nmdc:mga06r32_1895_c1 | 3300050510 | Bacteria | 18630 |
| 408 | nmdc:mga06r32_33325_c1 | 3300050510 | Bacteria | 4851 |
| 409 | nmdc:mga06r32_59862_c1 | 3300050510 | Bacteria | 3664 |
| 410 | nmdc:mga06r32_70070_c1 | 3300050510 | Bacteria | 3390 |
| 411 | nmdc:mga06r32_83109_c1 | 3300050510 | Bacteria | 3120 |
| 412 | nmdc:mga06r32_83717_c1 | 3300050510 | Bacteria | 3109 |
| 413 | nmdc:mga08y16_20452_c1 | 3300050511 | Bacteria | 6987 |
| 414 | nmdc:mga0n895_114774_c1 | 3300050512 | Unclassified | 2711 |
| 415 | nmdc:mga0n895_311640_c1 | 3300050512 | Bacteria | 1595 |
| 416 | nmdc:mga0n895_5842_c1 | 3300050512 | Bacteria | 10343 |
| 417 | nmdc:mga0a205_162635_c1 | 3300050515 | Bacteria | 2128 |
| 418 | nmdc:mga0a205_36013_c1 | 3300050515 | Bacteria | 4754 |
| 419 | nmdc:mga0a205_71041_c1 | 3300050515 | Bacteria | 3362 |
| 420 | nmdc:mga0a205_769215_c1 | 3300050515 | Bacteria | 811 |
| 421 | Ga0500641_0003543 | 3300053096 | Bacteria | 5516 |
| 422 | Ga0500568_0001762 | 3300053139 | Bacteria | 13363 |
| 423 | Ga0501084_0013954 | 3300054114 | Bacteria | 6650 |
| 424 | Ga0501084_0171263 | 3300054114 | Unclassified | 1832 |
| 425 | Ga0501084_0374301 | 3300054114 | Bacteria | 1204 |
| 426 | Ga0590071_000146 | 3300059421 | Bacteria | 20114 |
| 427 | Ga0590074_008145 | 3300059423 | Bacteria | 1746 |
| 428 | Ga0590075_036147 | 3300059424 | Unclassified | 1259 |
| 429 | Ga0590077_000060 | 3300059426 | Bacteria | 26907 |
| 430 | Ga0590077_003853 | 3300059426 | Bacteria | 3092 |
| 431 | Ga0501082_0000015 | 3300060353 | Bacteria | 116737 |
| 432 | Ga0501082_0001055 | 3300060353 | Bacteria | 24399 |
| 433 | Ga0501082_0069189 | 3300060353 | Bacteria | 3039 |
| 434 | Ga0530510_0048983 | 3300061734 | Bacteria | 3053 |
| 435 | Ga0530510_0169374 | 3300061734 | Unclassified | 1617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006846 | Ga0075430_100026505 | Ga0075430_1000265052 | 218 |
| 2 | 3300006847 | Ga0075431_100095439 | Ga0075431_1000954391 | 218 |
| 3 | 3300050509 | nmdc:mga0qj67_41622_c1 | nmdc:mga0qj67_41622_c1_194_928 | 218 |
| 4 | 3300050510 | nmdc:mga06r32_70070_c1 | nmdc:mga06r32_70070_c1_403_1137 | 218 |
| 5 | 3300006844 | Ga0075428_100008458 | Ga0075428_1000084585 | 219 |
| 6 | 3300006846 | Ga0075430_100009455 | Ga0075430_1000094554 | 219 |
| 7 | 3300006847 | Ga0075431_100008515 | Ga0075431_1000085158 | 219 |
| 8 | 3300006880 | Ga0075429_100006733 | Ga0075429_1000067331 | 219 |
| 9 | 3300009147 | Ga0114129_10019720 | Ga0114129_100197204 | 219 |
| 10 | 3300050507 | nmdc:mga05p37_5428_c1 | nmdc:mga05p37_5428_c1_5099_5863 | 219 |
| 11 | 3300050508 | nmdc:mga09592_2301_c1 | nmdc:mga09592_2301_c1_9119_9883 | 219 |
| 12 | 3300050509 | nmdc:mga0qj67_1114_c1 | nmdc:mga0qj67_1114_c1_9132_9896 | 219 |
| 13 | 3300050510 | nmdc:mga06r32_1895_c1 | nmdc:mga06r32_1895_c1_8735_9499 | 219 |
| 14 | 3300005295 | Ga0065707_10004875 | Ga0065707_100048752 | 221 |
| 15 | 3300006847 | Ga0075431_100036925 | Ga0075431_1000369253 | 221 |
| 16 | 3300009147 | Ga0114129_10327353 | Ga0114129_103273532 | 221 |
| 17 | 3300032002 | Ga0307416_100878169 | Ga0307416_1008781691 | 221 |
| 18 | 3300050507 | nmdc:mga05p37_282354_c1 | nmdc:mga05p37_282354_c1_48_749 | 221 |
| 19 | 3300050508 | nmdc:mga09592_478586_c1 | nmdc:mga09592_478586_c1_133_834 | 221 |
| 20 | 3300050510 | nmdc:mga06r32_33325_c1 | nmdc:mga06r32_33325_c1_2934_3635 | 221 |
| 21 | 3300026121 | Ga0207683_10578006 | Ga0207683_105780062 | 224 |
| 22 | 3300035112 | Ga0373932_0122933 | Ga0373932_0122933_172_846 | 224 |
| 23 | 3300025910 | Ga0207684_10410851 | Ga0207684_104108512 | 227 |
| 24 | 3300039437 | Ga0436365_1186907 | Ga0436365_1186907_52_777 | 227 |
| 25 | 3300026095 | Ga0207676_10039500 | Ga0207676_100395003 | 229 |
| 26 | 3300037853 | Ga0436364_0334514 | Ga0436364_0334514_4612_5313 | 231 |
| 27 | 3300039437 | Ga0436365_1281712 | Ga0436365_1281712_10827_11528 | 231 |
| 28 | 3300039450 | Ga0436363_1044428 | Ga0436363_1044428_546_1247 | 231 |
| 29 | 3300044712 | Ga0453684_0011209 | Ga0453684_0011209_262_990 | 231 |
| 30 | 2162886007 | SwRhRL2b_contig_2711636 | SwRhRL2b_0662.00004350 | 233 |
| 31 | 3300005289 | Ga0065704_10003954 | Ga0065704_100039542 | 233 |
| 32 | 3300005290 | Ga0065712_10095763 | Ga0065712_100957632 | 233 |
| 33 | 3300005293 | Ga0065715_10116607 | Ga0065715_101166072 | 233 |
| 34 | 3300005293 | Ga0065715_10160639 | Ga0065715_101606392 | 233 |
| 35 | 3300005295 | Ga0065707_10006638 | Ga0065707_100066384 | 233 |
| 36 | 3300005295 | Ga0065707_10209933 | Ga0065707_102099332 | 233 |
| 37 | 3300005328 | Ga0070676_10099511 | Ga0070676_100995112 | 233 |
| 38 | 3300005329 | Ga0070683_100000027 | Ga0070683_10000002720 | 233 |
| 39 | 3300005329 | Ga0070683_100030672 | Ga0070683_1000306724 | 233 |
| 40 | 3300005330 | Ga0070690_100304941 | Ga0070690_1003049412 | 233 |
| 41 | 3300005330 | Ga0070690_100761825 | Ga0070690_1007618251 | 233 |
| 42 | 3300005331 | Ga0070670_100010745 | Ga0070670_1000107454 | 233 |
| 43 | 3300005331 | Ga0070670_100015718 | Ga0070670_1000157184 | 233 |
| 44 | 3300005331 | Ga0070670_100146731 | Ga0070670_1001467312 | 233 |
| 45 | 3300005334 | Ga0068869_100469223 | Ga0068869_1004692232 | 233 |
| 46 | 3300005337 | Ga0070682_100406364 | Ga0070682_1004063642 | 233 |
| 47 | 3300005338 | Ga0068868_100066648 | Ga0068868_1000666483 | 233 |
| 48 | 3300005340 | Ga0070689_100042562 | Ga0070689_1000425623 | 233 |
| 49 | 3300005340 | Ga0070689_100529698 | Ga0070689_1005296982 | 233 |
| 50 | 3300005343 | Ga0070687_100173291 | Ga0070687_1001732912 | 233 |
| 51 | 3300005345 | Ga0070692_10041396 | Ga0070692_100413963 | 233 |
| 52 | 3300005347 | Ga0070668_100419075 | Ga0070668_1004190752 | 233 |
| 53 | 3300005353 | Ga0070669_100004052 | Ga0070669_10000405211 | 233 |
| 54 | 3300005354 | Ga0070675_100007304 | Ga0070675_1000073044 | 233 |
| 55 | 3300005354 | Ga0070675_100053914 | Ga0070675_1000539142 | 233 |
| 56 | 3300005354 | Ga0070675_100074800 | Ga0070675_1000748003 | 233 |
| 57 | 3300005354 | Ga0070675_100091338 | Ga0070675_1000913383 | 233 |
| 58 | 3300005355 | Ga0070671_100032449 | Ga0070671_1000324492 | 233 |
| 59 | 3300005355 | Ga0070671_100461678 | Ga0070671_1004616782 | 233 |
| 60 | 3300005356 | Ga0070674_100013797 | Ga0070674_1000137973 | 233 |
| 61 | 3300005356 | Ga0070674_100034615 | Ga0070674_1000346153 | 233 |
| 62 | 3300005364 | Ga0070673_100038263 | Ga0070673_1000382634 | 233 |
| 63 | 3300005364 | Ga0070673_100121438 | Ga0070673_1001214383 | 233 |
| 64 | 3300005364 | Ga0070673_100272529 | Ga0070673_1002725291 | 233 |
| 65 | 3300005365 | Ga0070688_100025371 | Ga0070688_1000253713 | 233 |
| 66 | 3300005365 | Ga0070688_100036121 | Ga0070688_1000361212 | 233 |
| 67 | 3300005365 | Ga0070688_100498642 | Ga0070688_1004986421 | 233 |
| 68 | 3300005366 | Ga0070659_100148650 | Ga0070659_1001486502 | 233 |
| 69 | 3300005406 | Ga0070703_10009130 | Ga0070703_100091303 | 233 |
| 70 | 3300005438 | Ga0070701_10064546 | Ga0070701_100645462 | 233 |
| 71 | 3300005438 | Ga0070701_10105428 | Ga0070701_101054282 | 233 |
| 72 | 3300005440 | Ga0070705_100148011 | Ga0070705_1001480112 | 233 |
| 73 | 3300005441 | Ga0070700_100265463 | Ga0070700_1002654632 | 233 |
| 74 | 3300005444 | Ga0070694_100001238 | Ga0070694_10000123815 | 233 |
| 75 | 3300005444 | Ga0070694_100009433 | Ga0070694_1000094334 | 233 |
| 76 | 3300005456 | Ga0070678_100192424 | Ga0070678_1001924242 | 233 |
| 77 | 3300005458 | Ga0070681_10099576 | Ga0070681_100995763 | 233 |
| 78 | 3300005458 | Ga0070681_10262499 | Ga0070681_102624992 | 233 |
| 79 | 3300005459 | Ga0068867_100003118 | Ga0068867_1000031187 | 233 |
| 80 | 3300005467 | Ga0070706_100086644 | Ga0070706_1000866443 | 233 |
| 81 | 3300005467 | Ga0070706_100147164 | Ga0070706_1001471642 | 233 |
| 82 | 3300005467 | Ga0070706_100182486 | Ga0070706_1001824862 | 233 |
| 83 | 3300005467 | Ga0070706_100221028 | Ga0070706_1002210282 | 233 |
| 84 | 3300005468 | Ga0070707_100065317 | Ga0070707_1000653172 | 233 |
| 85 | 3300005468 | Ga0070707_100191529 | Ga0070707_1001915292 | 233 |
| 86 | 3300005471 | Ga0070698_100000770 | Ga0070698_10000077019 | 233 |
| 87 | 3300005518 | Ga0070699_100002967 | Ga0070699_10000296711 | 233 |
| 88 | 3300005535 | Ga0070684_100000293 | Ga0070684_10000029316 | 233 |
| 89 | 3300005535 | Ga0070684_100297774 | Ga0070684_1002977742 | 233 |
| 90 | 3300005536 | Ga0070697_100144930 | Ga0070697_1001449302 | 233 |
| 91 | 3300005536 | Ga0070697_100295129 | Ga0070697_1002951292 | 233 |
| 92 | 3300005539 | Ga0068853_100842934 | Ga0068853_1008429341 | 233 |
| 93 | 3300005543 | Ga0070672_100030669 | Ga0070672_1000306693 | 233 |
| 94 | 3300005543 | Ga0070672_100248800 | Ga0070672_1002488002 | 233 |
| 95 | 3300005544 | Ga0070686_100270735 | Ga0070686_1002707352 | 233 |
| 96 | 3300005545 | Ga0070695_100000417 | Ga0070695_10000041717 | 233 |
| 97 | 3300005546 | Ga0070696_100000783 | Ga0070696_1000007838 | 233 |
| 98 | 3300005546 | Ga0070696_100019436 | Ga0070696_1000194362 | 233 |
| 99 | 3300005546 | Ga0070696_100137916 | Ga0070696_1001379163 | 233 |
| 100 | 3300005548 | Ga0070665_100091324 | Ga0070665_1000913242 | 233 |
| 101 | 3300005549 | Ga0070704_100001511 | Ga0070704_1000015114 | 233 |
| 102 | 3300005549 | Ga0070704_100236361 | Ga0070704_1002363612 | 233 |
| 103 | 3300005549 | Ga0070704_100305897 | Ga0070704_1003058972 | 233 |
| 104 | 3300005549 | Ga0070704_100474373 | Ga0070704_1004743732 | 233 |
| 105 | 3300005564 | Ga0070664_100181481 | Ga0070664_1001814812 | 233 |
| 106 | 3300005564 | Ga0070664_100208186 | Ga0070664_1002081862 | 233 |
| 107 | 3300005577 | Ga0068857_100692556 | Ga0068857_1006925561 | 233 |
| 108 | 3300005578 | Ga0068854_100071817 | Ga0068854_1000718171 | 233 |
| 109 | 3300005615 | Ga0070702_100177790 | Ga0070702_1001777902 | 233 |
| 110 | 3300005617 | Ga0068859_100026831 | Ga0068859_1000268314 | 233 |
| 111 | 3300005617 | Ga0068859_100051562 | Ga0068859_1000515623 | 233 |
| 112 | 3300005618 | Ga0068864_100000035 | Ga0068864_10000003543 | 233 |
| 113 | 3300005618 | Ga0068864_100053793 | Ga0068864_1000537933 | 233 |
| 114 | 3300005719 | Ga0068861_100002659 | Ga0068861_10000265910 | 233 |
| 115 | 3300005719 | Ga0068861_100437683 | Ga0068861_1004376832 | 233 |
| 116 | 3300005840 | Ga0068870_10001008 | Ga0068870_100010085 | 233 |
| 117 | 3300005841 | Ga0068863_100101160 | Ga0068863_1001011602 | 233 |
| 118 | 3300005841 | Ga0068863_100352434 | Ga0068863_1003524342 | 233 |
| 119 | 3300005842 | Ga0068858_100054490 | Ga0068858_1000544902 | 233 |
| 120 | 3300005843 | Ga0068860_100003012 | Ga0068860_10000301212 | 233 |
| 121 | 3300005844 | Ga0068862_100000965 | Ga0068862_1000009659 | 233 |
| 122 | 3300005844 | Ga0068862_100620430 | Ga0068862_1006204301 | 233 |
| 123 | 3300006042 | Ga0075368_10005342 | Ga0075368_100053422 | 233 |
| 124 | 3300006178 | Ga0075367_10011813 | Ga0075367_100118134 | 233 |
| 125 | 3300006178 | Ga0075367_10127230 | Ga0075367_101272302 | 233 |
| 126 | 3300006195 | Ga0075366_10019271 | Ga0075366_100192713 | 233 |
| 127 | 3300006195 | Ga0075366_10149204 | Ga0075366_101492042 | 233 |
| 128 | 3300006237 | Ga0097621_100028503 | Ga0097621_1000285034 | 233 |
| 129 | 3300006237 | Ga0097621_100312471 | Ga0097621_1003124712 | 233 |
| 130 | 3300006237 | Ga0097621_100422691 | Ga0097621_1004226911 | 233 |
| 131 | 3300006358 | Ga0068871_100745716 | Ga0068871_1007457162 | 233 |
| 132 | 3300006844 | Ga0075428_100016908 | Ga0075428_1000169086 | 233 |
| 133 | 3300006844 | Ga0075428_100025232 | Ga0075428_1000252324 | 233 |
| 134 | 3300006844 | Ga0075428_100167706 | Ga0075428_1001677062 | 233 |
| 135 | 3300006844 | Ga0075428_100448605 | Ga0075428_1004486052 | 233 |
| 136 | 3300006844 | Ga0075428_100961672 | Ga0075428_1009616721 | 233 |
| 137 | 3300006846 | Ga0075430_100007258 | Ga0075430_1000072582 | 233 |
| 138 | 3300006846 | Ga0075430_100023335 | Ga0075430_1000233352 | 233 |
| 139 | 3300006846 | Ga0075430_100341014 | Ga0075430_1003410142 | 233 |
| 140 | 3300006846 | Ga0075430_100394579 | Ga0075430_1003945791 | 233 |
| 141 | 3300006847 | Ga0075431_100012074 | Ga0075431_1000120745 | 233 |
| 142 | 3300006847 | Ga0075431_100016233 | Ga0075431_1000162332 | 233 |
| 143 | 3300006847 | Ga0075431_100027874 | Ga0075431_1000278746 | 233 |
| 144 | 3300006847 | Ga0075431_100143641 | Ga0075431_1001436411 | 233 |
| 145 | 3300006852 | Ga0075433_10052535 | Ga0075433_100525352 | 233 |
| 146 | 3300006852 | Ga0075433_10073927 | Ga0075433_100739272 | 233 |
| 147 | 3300006852 | Ga0075433_10123302 | Ga0075433_101233022 | 233 |
| 148 | 3300006852 | Ga0075433_10251758 | Ga0075433_102517582 | 233 |
| 149 | 3300006871 | Ga0075434_100022164 | Ga0075434_1000221644 | 233 |
| 150 | 3300006871 | Ga0075434_100056160 | Ga0075434_1000561602 | 233 |
| 151 | 3300006871 | Ga0075434_100113777 | Ga0075434_1001137773 | 233 |
| 152 | 3300006871 | Ga0075434_100124080 | Ga0075434_1001240802 | 233 |
| 153 | 3300006880 | Ga0075429_100030787 | Ga0075429_1000307873 | 233 |
| 154 | 3300006880 | Ga0075429_100037706 | Ga0075429_1000377063 | 233 |
| 155 | 3300006880 | Ga0075429_100595398 | Ga0075429_1005953982 | 233 |
| 156 | 3300006881 | Ga0068865_100113221 | Ga0068865_1001132212 | 233 |
| 157 | 3300006881 | Ga0068865_100118559 | Ga0068865_1001185592 | 233 |
| 158 | 3300006881 | Ga0068865_100514754 | Ga0068865_1005147542 | 233 |
| 159 | 3300006914 | Ga0075436_100303187 | Ga0075436_1003031872 | 233 |
| 160 | 3300006931 | Ga0097620_100026831 | Ga0097620_1000268314 | 233 |
| 161 | 3300006931 | Ga0097620_100051563 | Ga0097620_1000515633 | 233 |
| 162 | 3300007076 | Ga0075435_100009548 | Ga0075435_1000095484 | 233 |
| 163 | 3300007076 | Ga0075435_100155518 | Ga0075435_1001555182 | 233 |
| 164 | 3300007076 | Ga0075435_100233173 | Ga0075435_1002331732 | 233 |
| 165 | 3300009094 | Ga0111539_10021249 | Ga0111539_100212493 | 233 |
| 166 | 3300009094 | Ga0111539_10961141 | Ga0111539_109611412 | 233 |
| 167 | 3300009098 | Ga0105245_10739029 | Ga0105245_107390292 | 233 |
| 168 | 3300009101 | Ga0105247_10226778 | Ga0105247_102267782 | 233 |
| 169 | 3300009147 | Ga0114129_10000560 | Ga0114129_1000056026 | 233 |
| 170 | 3300009147 | Ga0114129_10008161 | Ga0114129_100081616 | 233 |
| 171 | 3300009147 | Ga0114129_10041432 | Ga0114129_100414325 | 233 |
| 172 | 3300009147 | Ga0114129_10103801 | Ga0114129_101038013 | 233 |
| 173 | 3300009147 | Ga0114129_10186272 | Ga0114129_101862722 | 233 |
| 174 | 3300009147 | Ga0114129_10344828 | Ga0114129_103448282 | 233 |
| 175 | 3300009147 | Ga0114129_10509195 | Ga0114129_105091952 | 233 |
| 176 | 3300009147 | Ga0114129_10542023 | Ga0114129_105420232 | 233 |
| 177 | 3300009147 | Ga0114129_11314661 | Ga0114129_113146611 | 233 |
| 178 | 3300009148 | Ga0105243_10193350 | Ga0105243_101933502 | 233 |
| 179 | 3300009177 | Ga0105248_10337528 | Ga0105248_103375281 | 233 |
| 180 | 3300009553 | Ga0105249_10017989 | Ga0105249_100179894 | 233 |
| 181 | 3300010375 | Ga0105239_10678709 | Ga0105239_106787092 | 233 |
| 182 | 3300013105 | Ga0157369_10000363 | Ga0157369_1000036360 | 233 |
| 183 | 3300013297 | Ga0157378_10261213 | Ga0157378_102612132 | 233 |
| 184 | 3300013297 | Ga0157378_10265995 | Ga0157378_102659952 | 233 |
| 185 | 3300013306 | Ga0163162_10457478 | Ga0163162_104574782 | 233 |
| 186 | 3300013308 | Ga0157375_10004712 | Ga0157375_100047125 | 233 |
| 187 | 3300013308 | Ga0157375_10183885 | Ga0157375_101838852 | 233 |
| 188 | 3300014326 | Ga0157380_10185716 | Ga0157380_101857162 | 233 |
| 189 | 3300014326 | Ga0157380_10195099 | Ga0157380_101950992 | 233 |
| 190 | 3300014326 | Ga0157380_10492113 | Ga0157380_104921132 | 233 |
| 191 | 3300014745 | Ga0157377_10025164 | Ga0157377_100251642 | 233 |
| 192 | 3300014969 | Ga0157376_10199727 | Ga0157376_101997273 | 233 |
| 193 | 3300014969 | Ga0157376_11247075 | Ga0157376_112470751 | 233 |
| 194 | 3300021384 | Ga0213876_10022844 | Ga0213876_100228443 | 233 |
| 195 | 3300021388 | Ga0213875_10066872 | Ga0213875_100668722 | 233 |
| 196 | 3300025315 | Ga0207697_10000977 | Ga0207697_100009778 | 233 |
| 197 | 3300025885 | Ga0207653_10007614 | Ga0207653_100076144 | 233 |
| 198 | 3300025885 | Ga0207653_10034966 | Ga0207653_100349662 | 233 |
| 199 | 3300025901 | Ga0207688_10034210 | Ga0207688_100342104 | 233 |
| 200 | 3300025908 | Ga0207643_10000836 | Ga0207643_1000083614 | 233 |
| 201 | 3300025912 | Ga0207707_10010138 | Ga0207707_100101381 | 233 |
| 202 | 3300025918 | Ga0207662_10137365 | Ga0207662_101373652 | 233 |
| 203 | 3300025922 | Ga0207646_10158212 | Ga0207646_101582122 | 233 |
| 204 | 3300025922 | Ga0207646_10301762 | Ga0207646_103017622 | 233 |
| 205 | 3300025922 | Ga0207646_10555662 | Ga0207646_105556622 | 233 |
| 206 | 3300025923 | Ga0207681_10005277 | Ga0207681_100052774 | 233 |
| 207 | 3300025923 | Ga0207681_10029416 | Ga0207681_100294162 | 233 |
| 208 | 3300025925 | Ga0207650_10447138 | Ga0207650_104471382 | 233 |
| 209 | 3300025926 | Ga0207659_10000972 | Ga0207659_1000097215 | 233 |
| 210 | 3300025926 | Ga0207659_10068949 | Ga0207659_100689493 | 233 |
| 211 | 3300025932 | Ga0207690_10316209 | Ga0207690_103162092 | 233 |
| 212 | 3300025933 | Ga0207706_10031618 | Ga0207706_100316182 | 233 |
| 213 | 3300025933 | Ga0207706_10401603 | Ga0207706_104016032 | 233 |
| 214 | 3300025935 | Ga0207709_10076420 | Ga0207709_100764202 | 233 |
| 215 | 3300025936 | Ga0207670_10025838 | Ga0207670_100258382 | 233 |
| 216 | 3300025936 | Ga0207670_10313713 | Ga0207670_103137132 | 233 |
| 217 | 3300025937 | Ga0207669_10015650 | Ga0207669_100156502 | 233 |
| 218 | 3300025937 | Ga0207669_10044318 | Ga0207669_100443182 | 233 |
| 219 | 3300025938 | Ga0207704_10033681 | Ga0207704_100336813 | 233 |
| 220 | 3300025938 | Ga0207704_10149349 | Ga0207704_101493492 | 233 |
| 221 | 3300025940 | Ga0207691_10029954 | Ga0207691_100299544 | 233 |
| 222 | 3300025940 | Ga0207691_10221692 | Ga0207691_102216921 | 233 |
| 223 | 3300025942 | Ga0207689_10151976 | Ga0207689_101519762 | 233 |
| 224 | 3300025942 | Ga0207689_10510440 | Ga0207689_105104402 | 233 |
| 225 | 3300025944 | Ga0207661_10000015 | Ga0207661_10000015165 | 233 |
| 226 | 3300025944 | Ga0207661_10333998 | Ga0207661_103339982 | 233 |
| 227 | 3300025944 | Ga0207661_10335183 | Ga0207661_103351832 | 233 |
| 228 | 3300025945 | Ga0207679_10013659 | Ga0207679_100136592 | 233 |
| 229 | 3300025945 | Ga0207679_10021682 | Ga0207679_100216824 | 233 |
| 230 | 3300025945 | Ga0207679_10083381 | Ga0207679_100833812 | 233 |
| 231 | 3300025960 | Ga0207651_10025703 | Ga0207651_100257032 | 233 |
| 232 | 3300025960 | Ga0207651_10214785 | Ga0207651_102147852 | 233 |
| 233 | 3300025960 | Ga0207651_10230039 | Ga0207651_102300392 | 233 |
| 234 | 3300025960 | Ga0207651_10470802 | Ga0207651_104708022 | 233 |
| 235 | 3300025961 | Ga0207712_10009112 | Ga0207712_100091124 | 233 |
| 236 | 3300025972 | Ga0207668_10219029 | Ga0207668_102190292 | 233 |
| 237 | 3300026023 | Ga0207677_10078087 | Ga0207677_100780872 | 233 |
| 238 | 3300026035 | Ga0207703_10169388 | Ga0207703_101693882 | 233 |
| 239 | 3300026041 | Ga0207639_10815497 | Ga0207639_108154972 | 233 |
| 240 | 3300026075 | Ga0207708_10003080 | Ga0207708_100030807 | 233 |
| 241 | 3300026075 | Ga0207708_10116976 | Ga0207708_101169762 | 233 |
| 242 | 3300026088 | Ga0207641_10484597 | Ga0207641_104845972 | 233 |
| 243 | 3300026089 | Ga0207648_10006372 | Ga0207648_100063727 | 233 |
| 244 | 3300026095 | Ga0207676_10000026 | Ga0207676_10000026137 | 233 |
| 245 | 3300026095 | Ga0207676_10153660 | Ga0207676_101536602 | 233 |
| 246 | 3300026116 | Ga0207674_10036111 | Ga0207674_100361112 | 233 |
| 247 | 3300026116 | Ga0207674_10485375 | Ga0207674_104853752 | 233 |
| 248 | 3300026116 | Ga0207674_10699252 | Ga0207674_106992522 | 233 |
| 249 | 3300026118 | Ga0207675_100002702 | Ga0207675_10000270211 | 233 |
| 250 | 3300026118 | Ga0207675_100125482 | Ga0207675_1001254822 | 233 |
| 251 | 3300026121 | Ga0207683_10032368 | Ga0207683_100323683 | 233 |
| 252 | 3300027682 | Ga0209971_1054683 | Ga0209971_10546832 | 233 |
| 253 | 3300027682 | Ga0209971_1054949 | Ga0209971_10549492 | 233 |
| 254 | 3300027907 | Ga0207428_10001903 | Ga0207428_1000190316 | 233 |
| 255 | 3300028380 | Ga0268265_10000887 | Ga0268265_1000088712 | 233 |
| 256 | 3300028381 | Ga0268264_10001791 | Ga0268264_1000179112 | 233 |
| 257 | 3300028563 | Ga0265319_1031939 | Ga0265319_10319392 | 233 |
| 258 | 3300028577 | Ga0265318_10058774 | Ga0265318_100587741 | 233 |
| 259 | 3300028800 | Ga0265338_10034296 | Ga0265338_100342965 | 233 |
| 260 | 3300031824 | Ga0307413_10034991 | Ga0307413_100349912 | 233 |
| 261 | 3300031824 | Ga0307413_10127585 | Ga0307413_101275852 | 233 |
| 262 | 3300031852 | Ga0307410_10007408 | Ga0307410_100074082 | 233 |
| 263 | 3300031852 | Ga0307410_10156296 | Ga0307410_101562962 | 233 |
| 264 | 3300031901 | Ga0307406_10012061 | Ga0307406_100120614 | 233 |
| 265 | 3300031903 | Ga0307407_10000821 | Ga0307407_100008213 | 233 |
| 266 | 3300031903 | Ga0307407_10266484 | Ga0307407_102664842 | 233 |
| 267 | 3300031911 | Ga0307412_10029797 | Ga0307412_100297972 | 233 |
| 268 | 3300031911 | Ga0307412_10491357 | Ga0307412_104913571 | 233 |
| 269 | 3300031995 | Ga0307409_100012234 | Ga0307409_1000122345 | 233 |
| 270 | 3300031995 | Ga0307409_100367500 | Ga0307409_1003675002 | 233 |
| 271 | 3300031995 | Ga0307409_100492667 | Ga0307409_1004926672 | 233 |
| 272 | 3300032002 | Ga0307416_100055057 | Ga0307416_1000550572 | 233 |
| 273 | 3300032002 | Ga0307416_100274902 | Ga0307416_1002749022 | 233 |
| 274 | 3300032004 | Ga0307414_10011345 | Ga0307414_100113453 | 233 |
| 275 | 3300032005 | Ga0307411_10008912 | Ga0307411_100089123 | 233 |
| 276 | 3300032005 | Ga0307411_10020136 | Ga0307411_100201363 | 233 |
| 277 | 3300032126 | Ga0307415_100142752 | Ga0307415_1001427522 | 233 |
| 278 | 3300035116 | Ga0373945_0243051 | Ga0373945_0243051_13_714 | 233 |
| 279 | 3300035242 | Ga0373962_0009357 | Ga0373962_0009357_1513_2214 | 233 |
| 280 | 3300036401 | Ga0373937_0001515 | Ga0373937_0001515_17225_17926 | 233 |
| 281 | 3300037853 | Ga0436364_0197126 | Ga0436364_0197126_447_1163 | 233 |
| 282 | 3300037853 | Ga0436364_0515695 | Ga0436364_0515695_2150_2857 | 233 |
| 283 | 3300037853 | Ga0436364_1509325 | Ga0436364_1509325_249_956 | 233 |
| 284 | 3300039437 | Ga0436365_0133092 | Ga0436365_0133092_3528_4235 | 233 |
| 285 | 3300039437 | Ga0436365_0872509 | Ga0436365_0872509_1110_1826 | 233 |
| 286 | 3300039437 | Ga0436365_0986342 | Ga0436365_0986342_191_898 | 233 |
| 287 | 3300039437 | Ga0436365_1216125 | Ga0436365_1216125_2088_2804 | 233 |
| 288 | 3300039453 | Ga0436362_0025424 | Ga0436362_0025424_391_1098 | 233 |
| 289 | 3300042436 | Ga0439435_0000660 | Ga0439435_0000660_2810_3562 | 233 |
| 290 | 3300042436 | Ga0439435_0004062 | Ga0439435_0004062_200_901 | 233 |
| 291 | 3300042876 | Ga0451577_0112336 | Ga0451577_0112336_55_759 | 233 |
| 292 | 3300042876 | Ga0451577_0215901 | Ga0451577_0215901_1003_1704 | 233 |
| 293 | 3300042993 | Ga0439440_0034385 | Ga0439440_0034385_458_1159 | 233 |
| 294 | 3300044712 | Ga0453684_0046010 | Ga0453684_0046010_2979_3680 | 233 |
| 295 | 3300044712 | Ga0453684_0182838 | Ga0453684_0182838_892_1593 | 233 |
| 296 | 3300045051 | Ga0451576_0006349 | Ga0451576_0006349_1636_2337 | 233 |
| 297 | 3300045051 | Ga0451576_0009970 | Ga0451576_0009970_135_836 | 233 |
| 298 | 3300045051 | Ga0451576_0040455 | Ga0451576_0040455_2843_3544 | 233 |
| 299 | 3300045051 | Ga0451576_0132350 | Ga0451576_0132350_1185_1889 | 233 |
| 300 | 3300045051 | Ga0451576_0361958 | Ga0451576_0361958_510_1211 | 233 |
| 301 | 3300045051 | Ga0451576_0434345 | Ga0451576_0434345_618_1319 | 233 |
| 302 | 3300045976 | Ga0466967_0516191 | Ga0466967_0516191_215_922 | 233 |
| 303 | 3300046455 | Ga0495603_0016873 | Ga0495603_0016873_212_913 | 233 |
| 304 | 3300046459 | Ga0495629_0044289 | Ga0495629_0044289_298_999 | 233 |
| 305 | 3300046459 | Ga0495629_0409209 | Ga0495629_0409209_14_715 | 233 |
| 306 | 3300046460 | Ga0495638_0022044 | Ga0495638_0022044_2504_3205 | 233 |
| 307 | 3300046462 | Ga0495651_0326883 | Ga0495651_0326883_88_789 | 233 |
| 308 | 3300046472 | Ga0495580_0374070 | Ga0495580_0374070_213_914 | 233 |
| 309 | 3300046491 | Ga0495584_0049314 | Ga0495584_0049314_286_987 | 233 |
| 310 | 3300046499 | Ga0495594_0094450 | Ga0495594_0094450_867_1568 | 233 |
| 311 | 3300046499 | Ga0495594_0319940 | Ga0495594_0319940_96_797 | 233 |
| 312 | 3300046522 | Ga0495643_0004818 | Ga0495643_0004818_2066_2767 | 233 |
| 313 | 3300046525 | Ga0495663_0014584 | Ga0495663_0014584_801_1502 | 233 |
| 314 | 3300046528 | Ga0495642_0004304 | Ga0495642_0004304_1118_1819 | 233 |
| 315 | 3300046537 | Ga0495598_0091958 | Ga0495598_0091958_236_937 | 233 |
| 316 | 3300046537 | Ga0495598_0114691 | Ga0495598_0114691_113_814 | 233 |
| 317 | 3300046538 | Ga0495609_0098033 | Ga0495609_0098033_346_1047 | 233 |
| 318 | 3300046539 | Ga0495621_0005672 | Ga0495621_0005672_900_1601 | 233 |
| 319 | 3300046539 | Ga0495621_0022640 | Ga0495621_0022640_534_1235 | 233 |
| 320 | 3300046558 | Ga0495633_0224498 | Ga0495633_0224498_46_747 | 233 |
| 321 | 3300046615 | Ga0495656_0051830 | Ga0495656_0051830_659_1360 | 233 |
| 322 | 3300046616 | Ga0495668_0182143 | Ga0495668_0182143_423_1124 | 233 |
| 323 | 3300046664 | Ga0495659_0003742 | Ga0495659_0003742_720_1421 | 233 |
| 324 | 3300046664 | Ga0495659_0027220 | Ga0495659_0027220_962_1663 | 233 |
| 325 | 3300046674 | Ga0495588_0108377 | Ga0495588_0108377_643_1344 | 233 |
| 326 | 3300046684 | Ga0495669_0051805 | Ga0495669_0051805_211_912 | 233 |
| 327 | 3300046684 | Ga0495669_0064403 | Ga0495669_0064403_881_1582 | 233 |
| 328 | 3300046794 | Ga0495589_0273159 | Ga0495589_0273159_44_745 | 233 |
| 329 | 3300047318 | Ga0495636_0021377 | Ga0495636_0021377_1380_2081 | 233 |
| 330 | 3300047320 | Ga0495672_0063418 | Ga0495672_0063418_709_1410 | 233 |
| 331 | 3300047321 | Ga0495676_0037587 | Ga0495676_0037587_1099_1800 | 233 |
| 332 | 3300047444 | Ga0495675_0142965 | Ga0495675_0142965_647_1348 | 233 |
| 333 | 3300047445 | Ga0495677_0079007 | Ga0495677_0079007_95_796 | 233 |
| 334 | 3300047445 | Ga0495677_0125524 | Ga0495677_0125524_55_756 | 233 |
| 335 | 3300047447 | Ga0495685_004318 | Ga0495685_004318_773_1474 | 233 |
| 336 | 3300048904 | Ga0496101_0237779 | Ga0496101_0237779_615_1316 | 233 |
| 337 | 3300048906 | Ga0496103_0049977 | Ga0496103_0049977_1026_1727 | 233 |
| 338 | 3300048911 | Ga0496108_0000114 | Ga0496108_0000114_52376_53128 | 233 |
| 339 | 3300048911 | Ga0496108_0408090 | Ga0496108_0408090_124_825 | 233 |
| 340 | 3300048912 | Ga0496109_0077757 | Ga0496109_0077757_1503_2204 | 233 |
| 341 | 3300048913 | Ga0496110_0028710 | Ga0496110_0028710_1425_2126 | 233 |
| 342 | 3300048913 | Ga0496110_0729561 | Ga0496110_0729561_19_720 | 233 |
| 343 | 3300048914 | Ga0496111_0135348 | Ga0496111_0135348_1107_1808 | 233 |
| 344 | 3300048915 | Ga0496112_0034459 | Ga0496112_0034459_1313_2014 | 233 |
| 345 | 3300049570 | Ga0501033_0095706 | Ga0501033_0095706_1413_2114 | 233 |
| 346 | 3300049572 | Ga0501036_0078031 | Ga0501036_0078031_540_1250 | 233 |
| 347 | 3300049572 | Ga0501036_0095993 | Ga0501036_0095993_1716_2417 | 233 |
| 348 | 3300049575 | Ga0501039_0065527 | Ga0501039_0065527_1061_1762 | 233 |
| 349 | 3300049575 | Ga0501039_0072377 | Ga0501039_0072377_1710_2411 | 233 |
| 350 | 3300049576 | Ga0501040_0014732 | Ga0501040_0014732_3840_4541 | 233 |
| 351 | 3300049577 | Ga0501041_0000881 | Ga0501041_0000881_1547_2248 | 233 |
| 352 | 3300049577 | Ga0501041_0146887 | Ga0501041_0146887_218_919 | 233 |
| 353 | 3300049578 | Ga0501042_0002368 | Ga0501042_0002368_7802_8503 | 233 |
| 354 | 3300049578 | Ga0501042_0306743 | Ga0501042_0306743_123_824 | 233 |
| 355 | 3300049580 | Ga0501046_0029483 | Ga0501046_0029483_1200_1901 | 233 |
| 356 | 3300049580 | Ga0501046_0098149 | Ga0501046_0098149_841_1542 | 233 |
| 357 | 3300049582 | Ga0501048_0129697 | Ga0501048_0129697_687_1388 | 233 |
| 358 | 3300049582 | Ga0501048_0411040 | Ga0501048_0411040_31_732 | 233 |
| 359 | 3300049584 | Ga0501068_0117732 | Ga0501068_0117732_163_864 | 233 |
| 360 | 3300049584 | Ga0501068_0167390 | Ga0501068_0167390_35_745 | 233 |
| 361 | 3300049584 | Ga0501068_0189516 | Ga0501068_0189516_590_1291 | 233 |
| 362 | 3300049586 | Ga0501070_0625193 | Ga0501070_0625193_48_749 | 233 |
| 363 | 3300049587 | Ga0501071_0123613 | Ga0501071_0123613_1190_1891 | 233 |
| 364 | 3300049587 | Ga0501071_0452276 | Ga0501071_0452276_221_922 | 233 |
| 365 | 3300049588 | Ga0501072_0002447 | Ga0501072_0002447_6799_7500 | 233 |
| 366 | 3300049588 | Ga0501072_0006817 | Ga0501072_0006817_3481_4182 | 233 |
| 367 | 3300049588 | Ga0501072_0118970 | Ga0501072_0118970_1110_1811 | 233 |
| 368 | 3300049588 | Ga0501072_0361712 | Ga0501072_0361712_13_789 | 233 |
| 369 | 3300049589 | Ga0501073_0012194 | Ga0501073_0012194_2290_3006 | 233 |
| 370 | 3300049590 | Ga0501074_0126137 | Ga0501074_0126137_854_1555 | 233 |
| 371 | 3300049590 | Ga0501074_0378523 | Ga0501074_0378523_79_939 | 233 |
| 372 | 3300049591 | Ga0501075_0000722 | Ga0501075_0000722_12383_13084 | 233 |
| 373 | 3300049591 | Ga0501075_0001143 | Ga0501075_0001143_7927_8628 | 233 |
| 374 | 3300049591 | Ga0501075_0058430 | Ga0501075_0058430_372_1073 | 233 |
| 375 | 3300049592 | Ga0501076_0007665 | Ga0501076_0007665_1615_2316 | 233 |
| 376 | 3300049592 | Ga0501076_0053451 | Ga0501076_0053451_1652_2353 | 233 |
| 377 | 3300049592 | Ga0501076_0096406 | Ga0501076_0096406_1199_1900 | 233 |
| 378 | 3300049593 | Ga0501077_0000368 | Ga0501077_0000368_15608_16309 | 233 |
| 379 | 3300049593 | Ga0501077_0389658 | Ga0501077_0389658_37_738 | 233 |
| 380 | 3300049741 | Ga0501079_0007802 | Ga0501079_0007802_1724_2425 | 233 |
| 381 | 3300049741 | Ga0501079_0055189 | Ga0501079_0055189_1969_2670 | 233 |
| 382 | 3300049742 | Ga0501080_0003587 | Ga0501080_0003587_11693_12394 | 233 |
| 383 | 3300049742 | Ga0501080_0430344 | Ga0501080_0430344_30_731 | 233 |
| 384 | 3300049742 | Ga0501080_0459904 | Ga0501080_0459904_152_853 | 233 |
| 385 | 3300049743 | Ga0501081_0004261 | Ga0501081_0004261_3048_3749 | 233 |
| 386 | 3300049743 | Ga0501081_0035755 | Ga0501081_0035755_1490_2191 | 233 |
| 387 | 3300049743 | Ga0501081_0416746 | Ga0501081_0416746_158_859 | 233 |
| 388 | 3300049824 | Ga0501045_0013310 | Ga0501045_0013310_3370_4071 | 233 |
| 389 | 3300049824 | Ga0501045_0018250 | Ga0501045_0018250_136_837 | 233 |
| 390 | 3300050493 | nmdc:mga0k408_22051_c1 | nmdc:mga0k408_22051_c1_672_1397 | 233 |
| 391 | 3300050493 | nmdc:mga0k408_230268_c1 | nmdc:mga0k408_230268_c1_300_1001 | 233 |
| 392 | 3300050494 | nmdc:mga06z11_50181_c1 | nmdc:mga06z11_50181_c1_37_738 | 233 |
| 393 | 3300050494 | nmdc:mga06z11_62931_c1 | nmdc:mga06z11_62931_c1_759_1484 | 233 |
| 394 | 3300050495 | nmdc:mga04h51_146304_c1 | nmdc:mga04h51_146304_c1_129_830 | 233 |
| 395 | 3300050507 | nmdc:mga05p37_1831_c1 | nmdc:mga05p37_1831_c1_18993_19694 | 233 |
| 396 | 3300050507 | nmdc:mga05p37_302701_c1 | nmdc:mga05p37_302701_c1_662_1363 | 233 |
| 397 | 3300050507 | nmdc:mga05p37_315066_c1 | nmdc:mga05p37_315066_c1_254_961 | 233 |
| 398 | 3300050507 | nmdc:mga05p37_321362_c1 | nmdc:mga05p37_321362_c1_209_910 | 233 |
| 399 | 3300050507 | nmdc:mga05p37_4082_c1 | nmdc:mga05p37_4082_c1_11965_12666 | 233 |
| 400 | 3300050507 | nmdc:mga05p37_414118_c1 | nmdc:mga05p37_414118_c1_327_1028 | 233 |
| 401 | 3300050508 | nmdc:mga09592_27305_c1 | nmdc:mga09592_27305_c1_1924_2625 | 233 |
| 402 | 3300050508 | nmdc:mga09592_389821_c1 | nmdc:mga09592_389821_c1_89_790 | 233 |
| 403 | 3300050508 | nmdc:mga09592_647170_c1 | nmdc:mga09592_647170_c1_109_810 | 233 |
| 404 | 3300050508 | nmdc:mga09592_94838_c1 | nmdc:mga09592_94838_c1_1183_1884 | 233 |
| 405 | 3300050509 | nmdc:mga0qj67_12929_c1 | nmdc:mga0qj67_12929_c1_451_1152 | 233 |
| 406 | 3300050509 | nmdc:mga0qj67_135459_c1 | nmdc:mga0qj67_135459_c1_915_1616 | 233 |
| 407 | 3300050509 | nmdc:mga0qj67_158119_c1 | nmdc:mga0qj67_158119_c1_60_761 | 233 |
| 408 | 3300050509 | nmdc:mga0qj67_379414_c1 | nmdc:mga0qj67_379414_c1_48_749 | 233 |
| 409 | 3300050510 | nmdc:mga06r32_151810_c1 | nmdc:mga06r32_151810_c1_1045_1746 | 233 |
| 410 | 3300050510 | nmdc:mga06r32_59862_c1 | nmdc:mga06r32_59862_c1_827_1528 | 233 |
| 411 | 3300050510 | nmdc:mga06r32_83109_c1 | nmdc:mga06r32_83109_c1_1722_2423 | 233 |
| 412 | 3300050510 | nmdc:mga06r32_83717_c1 | nmdc:mga06r32_83717_c1_395_1096 | 233 |
| 413 | 3300050511 | nmdc:mga08y16_20452_c1 | nmdc:mga08y16_20452_c1_6183_6884 | 233 |
| 414 | 3300050512 | nmdc:mga0n895_114774_c1 | nmdc:mga0n895_114774_c1_690_1391 | 233 |
| 415 | 3300050512 | nmdc:mga0n895_311640_c1 | nmdc:mga0n895_311640_c1_426_1127 | 233 |
| 416 | 3300050512 | nmdc:mga0n895_5842_c1 | nmdc:mga0n895_5842_c1_5914_6615 | 233 |
| 417 | 3300050515 | nmdc:mga0a205_162635_c1 | nmdc:mga0a205_162635_c1_1278_1979 | 233 |
| 418 | 3300050515 | nmdc:mga0a205_36013_c1 | nmdc:mga0a205_36013_c1_593_1294 | 233 |
| 419 | 3300050515 | nmdc:mga0a205_71041_c1 | nmdc:mga0a205_71041_c1_1117_1818 | 233 |
| 420 | 3300050515 | nmdc:mga0a205_769215_c1 | nmdc:mga0a205_769215_c1_80_781 | 233 |
| 421 | 3300053096 | Ga0500641_0003543 | Ga0500641_0003543_1628_2365 | 233 |
| 422 | 3300053139 | Ga0500568_0001762 | Ga0500568_0001762_113_814 | 233 |
| 423 | 3300054114 | Ga0501084_0013954 | Ga0501084_0013954_5761_6462 | 233 |
| 424 | 3300054114 | Ga0501084_0171263 | Ga0501084_0171263_977_1678 | 233 |
| 425 | 3300054114 | Ga0501084_0374301 | Ga0501084_0374301_63_779 | 233 |
| 426 | 3300059421 | Ga0590071_000146 | Ga0590071_000146_13479_14180 | 233 |
| 427 | 3300059423 | Ga0590074_008145 | Ga0590074_008145_256_957 | 233 |
| 428 | 3300059424 | Ga0590075_036147 | Ga0590075_036147_100_801 | 233 |
| 429 | 3300059426 | Ga0590077_000060 | Ga0590077_000060_5279_5980 | 233 |
| 430 | 3300059426 | Ga0590077_003853 | Ga0590077_003853_467_1168 | 233 |
| 431 | 3300060353 | Ga0501082_0000015 | Ga0501082_0000015_15535_16245 | 233 |
| 432 | 3300060353 | Ga0501082_0001055 | Ga0501082_0001055_8706_9407 | 233 |
| 433 | 3300060353 | Ga0501082_0069189 | Ga0501082_0069189_1445_2146 | 233 |
| 434 | 3300061734 | Ga0530510_0048983 | Ga0530510_0048983_1781_2482 | 233 |
| 435 | 3300061734 | Ga0530510_0169374 | Ga0530510_0169374_570_1271 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nqa-assembly2.cif.gz_B | crystal structure of galnac-t4 in complex with the monoglycopeptide 3 | 0.8376 | 5 | 111 |
| 5nqa-assembly1.cif.gz_A | crystal structure of galnac-t4 in complex with the monoglycopeptide 3 | 0.8331 | 5 | 112 |
| 6h0b-assembly2.cif.gz_B | crystal structure of the human galnac-t4 in complex with udp, manganese and the diglycopeptide 6. | 0.8065 | 5 | 111 |
| 1xhb-assembly1.cif.gz_A | the crystal structure of udp-galnac: polypeptide alpha-n-acetylgalactosaminyltransferase-t1 | 0.7979 | 3 | 111 |
| 7p5l-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 - apo form | 0.7738 | 3 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9161 | 6 | 223 | 3.90.550.10 |
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8958 | 6 | 223 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8725 | 7 | 230 | 3.90.550.10 |
| af_Q9VLQ1_42_326_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8432 | 1 | 232 | 3.90.550.10 |
| af_Q9VLQ1_42_326_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8366 | 1 | 232 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5GRG0-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9605 | 1 | 233 |
GO:0016757
|
| AF-A0A3N5GRG0-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9565 | 1 | 233 |
GO:0016757
|
| AF-A0A535Y9A2-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9553 | 1 | 232 |
GO:0016757
|
| AF-K1X9F1-F1-model_v4 | Glycosyl transferase family protein | 0.9547 | 1 | 232 |
GO:0016757
|
| AF-A0A842NWJ9-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9516 | 1 | 231 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar