F443411

General Info

Members Datasets Scaffolds Average Seq Length
435 253 356 448

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0068915|Ga0496123_0068915_573_2147
Length 524
Sequence MILSGFGRRGFFILLLFLFNRNICKVYDNPLRKISNNGKLLLTLYVRNSGQNSSKNAKCCYKINPRSAEVAKVKTKFQCTECGYEAPKWYGKCPGCQSWNSMVEETETVVKTQGRNSPLFDSKDKPLPIIDIDSGQEPRVQTGIGELNRVLGGGIVPGSLVLVGGDPGIGKSTLMLQTSHALTHSGLRVLYVSGEESVKQTKLRADRLDALSPELYVLCETNMERVEEAVEQIQPHFLVIDSIQTVYLPEVTSAPGSVAQVRECTSRFMRIAKGRGIATVLVGHVTKEGAIAGPRMLEHMVDCVLYFEGERHHTYRLLRAVKNRFGSTNEIGIFEMGEDGLREVGNPSELFLSERPLGVAGSTVVASMEGTRPMLVELQALISATHFPSPRRMATGIDHHRLNLIIAVLEKRMGMFLQTQDAYLNVAGGVRLDEPAVDLAVAVSIASSLRDVPTKPDDVIFGEIGLTGEVRAVSRAEQRVKEAEKLGFKRVILPEKSLKGWKHPRGIQLIGVNTVADALAVALD

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
4 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
5 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
6 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
7 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
8 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
9 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
10 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
11 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
12 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
13 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
14 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
15 2671180694 Paenibacillus sp. A3 Isolate Unclassified
16 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
17 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
18 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
19 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
20 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
21 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
22 2818991459 Paenibacillus sp. 597 Isolate Unclassified
23 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
24 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
25 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
26 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
27 2857472729 Cohnella sp. R-74144 Isolate Unclassified
28 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
29 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
30 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
31 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
32 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
33 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
34 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
35 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
36 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
37 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
38 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
39 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
40 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
41 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
42 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
43 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
44 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
45 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
46 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
47 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
48 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
49 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
50 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
51 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
52 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
53 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
54 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
55 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
56 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
57 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
58 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
59 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
60 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
61 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
62 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
63 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
64 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
65 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
66 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
67 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
68 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
69 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
70 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
71 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
76 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
133 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
156 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
173 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
174 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
175 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
176 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
177 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
178 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
179 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
245 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
246 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
247 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
248 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
249 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
250 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
251 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
252 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
253 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.15
Metatranscriptomes 0.69
Isolates 18.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 3.91
Nodule 0.46
Rhizoplane 0.92
Rhizosphere 71.95
Stem 0
Stem Tuber 0
Unclassified 22.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000180 3300003751 Bacteria 39991
2 Ga0055541_1000148 3300003841 Bacteria 34526
3 Ga0055541_1003085 3300003841 Bacteria 3196
4 Ga0055541_1004269 3300003841 Bacteria 2614
5 Ga0070680_100027566 3300005336 Bacteria 4549
6 Ga0070680_100077939 3300005336 Unclassified 2730
7 Ga0070680_100215474 3300005336 Bacteria 1620
8 Ga0070682_100030223 3300005337 Bacteria 3268
9 Ga0070669_100010869 3300005353 Bacteria 6462
10 Ga0070703_10000278 3300005406 Bacteria 24261
11 Ga0070709_10000055 3300005434 Bacteria 88799
12 Ga0070713_100104058 3300005436 Bacteria 2464
13 Ga0070711_100000002 3300005439 Bacteria 263148
14 Ga0070711_100056257 3300005439 Bacteria 2720
15 Ga0070705_100000036 3300005440 Bacteria 67281
16 Ga0070705_100033666 3300005440 Bacteria 2858
17 Ga0070706_100000042 3300005467 Bacteria 147128
18 Ga0070706_100003271 3300005467 Bacteria 16023
19 Ga0070706_100008145 3300005467 Bacteria 9777
20 Ga0070707_100007439 3300005468 Bacteria 10170
21 Ga0070698_100007518 3300005471 Bacteria 11786
22 Ga0070698_100123354 3300005471 Bacteria 2549
23 Ga0070699_100000088 3300005518 Bacteria 88268
24 Ga0070699_100024821 3300005518 Bacteria 5167
25 Ga0070679_100087325 3300005530 Bacteria 3106
26 Ga0070697_100004372 3300005536 Bacteria 10844
27 Ga0070696_100000040 3300005546 Bacteria 58962
28 Ga0070696_100006866 3300005546 Bacteria 7596
29 Ga0070693_100004548 3300005547 Bacteria 6576
30 Ga0068855_100010092 3300005563 Bacteria 11383
31 Ga0068855_100050513 3300005563 Bacteria 4900
32 Ga0068857_100075699 3300005577 Bacteria 3001
33 Ga0068866_10000132 3300005718 Bacteria 33127
34 Ga0068858_100039105 3300005842 Unclassified 4400
35 Ga0068858_100232771 3300005842 Bacteria 1747
36 Ga0068858_100253983 3300005842 Bacteria 1670
37 Ga0081455_10004528 3300005937 Bacteria 15525
38 Ga0081538_10002993 3300005981 Bacteria 16101
39 Ga0070712_100045425 3300006175 Bacteria 3033
40 Ga0075436_100003310 3300006914 Bacteria 11022
41 Ga0105251_10009356 3300009011 Bacteria 5793
42 Ga0105240_10000353 3300009093 Bacteria 86068
43 Ga0105240_10007200 3300009093 Bacteria 16202
44 Ga0105240_10009142 3300009093 Bacteria 14064
45 Ga0114129_10117226 3300009147 Bacteria 3669
46 Ga0105242_10000424 3300009176 Bacteria 33744
47 Ga0105249_10001745 3300009553 Bacteria 18951
48 Ga0105239_10001293 3300010375 Bacteria 33745
49 Ga0105246_10018979 3300011119 Bacteria 4387
50 Ga0157378_10018369 3300013297 Bacteria 6140
51 Ga0163162_10036072 3300013306 Bacteria 4927
52 Ga0157379_10161662 3300014968 Unclassified 2021
53 Ga0209784_100141 3300025224 Bacteria 67045
54 Ga0209566_100588 3300025225 Bacteria 23106
55 Ga0209566_100775 3300025225 Bacteria 17114
56 Ga0209566_101316 3300025225 Bacteria 8013
57 Ga0209147_100210 3300025229 Bacteria 62804
58 Ga0209437_100331 3300025233 Bacteria 58796
59 Ga0209675_1004384 3300025291 Bacteria 6294
60 Ga0209025_1003050 3300025294 Bacteria 16506
61 Ga0209025_1037389 3300025294 Bacteria 2154
62 Ga0207655_1011383 3300025728 Bacteria 5301
63 Ga0207653_10000028 3300025885 Bacteria 113033
64 Ga0207642_10000053 3300025899 Bacteria 34290
65 Ga0207699_10000002 3300025906 Bacteria 662194
66 Ga0207684_10000061 3300025910 Bacteria 203286
67 Ga0207684_10000555 3300025910 Bacteria 45995
68 Ga0207684_10002110 3300025910 Bacteria 20381
69 Ga0207707_10025942 3300025912 Bacteria 5124
70 Ga0207695_10002735 3300025913 Bacteria 25716
71 Ga0207695_10002956 3300025913 Bacteria 24522
72 Ga0207695_10011671 3300025913 Bacteria 10618
73 Ga0207693_10053428 3300025915 Bacteria 3170
74 Ga0207693_10058024 3300025915 Bacteria 3033
75 Ga0207663_10000022 3300025916 Bacteria 134855
76 Ga0207660_10029048 3300025917 Bacteria 3789
77 Ga0207660_10106030 3300025917 Bacteria 2107
78 Ga0207646_10000662 3300025922 Bacteria 44719
79 Ga0207681_10035218 3300025923 Unclassified 3297
80 Ga0207664_10019049 3300025929 Bacteria 5065
81 Ga0207686_10000338 3300025934 Bacteria 33761
82 Ga0207667_10004005 3300025949 Bacteria 18099
83 Ga0207667_10016454 3300025949 Bacteria 8357
84 Ga0207712_10001369 3300025961 Bacteria 16689
85 Ga0207703_10109362 3300026035 Bacteria 2356
86 Ga0207674_10091693 3300026116 Bacteria 3028
87 Ga0265354_1003164 3300028016 Bacteria 1884
88 Ga0268264_10043698 3300028381 Bacteria 3715
89 Ga0265318_10003066 3300028577 Bacteria 8589
90 Ga0265323_10004972 3300028653 Bacteria 5675
91 Ga0265323_10010329 3300028653 Bacteria 3788
92 Ga0265322_10020628 3300028654 Bacteria 1888
93 Ga0265762_1009995 3300030760 Bacteria 1694
94 Ga0265770_1000733 3300030878 Bacteria 4582
95 Ga0265760_10002594 3300031090 Bacteria 5276
96 Ga0265330_10010783 3300031235 Bacteria 4300
97 Ga0265330_10014457 3300031235 Bacteria 3663
98 Ga0265330_10018701 3300031235 Bacteria 3180
99 Ga0265330_10025896 3300031235 Bacteria 2657
100 Ga0265332_10000316 3300031238 Bacteria 36952
101 Ga0265332_10005838 3300031238 Bacteria 5642
102 Ga0265329_10016309 3300031242 Bacteria 2577
103 Ga0265329_10026064 3300031242 Bacteria 1930
104 Ga0265340_10030323 3300031247 Bacteria 2710
105 Ga0265339_10000250 3300031249 Bacteria 43439
106 Ga0265339_10022787 3300031249 Bacteria 3624
107 Ga0265339_10063831 3300031249 Unclassified 1977
108 Ga0265331_10000059 3300031250 Bacteria 172466
109 Ga0265331_10003460 3300031250 Bacteria 10191
110 Ga0265327_10033726 3300031251 Bacteria 2848
111 Ga0265316_10000052 3300031344 Bacteria 126151
112 Ga0265316_10000218 3300031344 Bacteria 66800
113 Ga0265316_10000934 3300031344 Bacteria 31790
114 Ga0265316_10007116 3300031344 Bacteria 10585
115 Ga0265316_10016847 3300031344 Bacteria 6325
116 Ga0265316_10018473 3300031344 Bacteria 5990
117 Ga0265316_10022309 3300031344 Bacteria 5341
118 Ga0265316_10026140 3300031344 Bacteria 4862
119 Ga0265316_10026274 3300031344 Bacteria 4846
120 Ga0307408_100133150 3300031548 Bacteria 1942
121 Ga0316575_10004443 3300031665 Bacteria 4936
122 Ga0316575_10024499 3300031665 Bacteria 2337
123 Ga0316579_10005251 3300031691 Bacteria 5215
124 Ga0316579_10012878 3300031691 Bacteria 3590
125 Ga0265314_10000814 3300031711 Bacteria 37075
126 Ga0265314_10000935 3300031711 Bacteria 34395
127 Ga0265314_10077371 3300031711 Bacteria 2207
128 Ga0265342_10005477 3300031712 Bacteria 9665
129 Ga0265342_10031732 3300031712 Unclassified 3264
130 Ga0265342_10072722 3300031712 Unclassified 2001
131 Ga0316576_10004683 3300031727 Bacteria 8249
132 Ga0316576_10042007 3300031727 Bacteria 3294
133 Ga0316576_10067560 3300031727 Bacteria 2632
134 Ga0316578_10003226 3300031728 Bacteria 7402
135 Ga0316578_10008705 3300031728 Bacteria 5180
136 Ga0316577_10000966 3300031733 Bacteria 12819
137 Ga0316577_10008271 3300031733 Bacteria 5573
138 Ga0316577_10043298 3300031733 Bacteria 2518
139 Ga0316577_10065556 3300031733 Bacteria 2028
140 Ga0316577_10072214 3300031733 Bacteria 1926
141 Ga0316583_10000248 3300032133 Bacteria 14743
142 Ga0316585_10000364 3300032137 Bacteria 10407
143 Ga0316580_10013263 3300032139 Bacteria 2511
144 Ga0373928_0000793 3300035084 Bacteria 6136
145 Ga0373923_0010477 3300035111 Bacteria 3373
146 Ga0373932_0023623 3300035112 Bacteria 1646
147 Ga0373955_0043777 3300035172 Bacteria 2409
148 Ga0316574_0000113 3300035398 Bacteria 24326
149 Ga0316574_0001306 3300035398 Bacteria 11662
150 Ga0316574_0153228 3300035398 Bacteria 1485
151 Ga0373931_0012472 3300035691 Bacteria 4117
152 Ga0373927_0077444 3300035695 Bacteria 2154
153 Ga0373933_0062034 3300035724 Bacteria 2256
154 Ga0373947_0022373 3300035725 Bacteria 3666
155 Ga0373937_0002971 3300036401 Bacteria 14195
156 Ga0373937_0072330 3300036401 Bacteria 3180
157 Ga0373937_0140007 3300036401 Bacteria 2263
158 Ga0316582_0000459 3300036647 Bacteria 15102
159 Ga0316582_0000549 3300036647 Bacteria 14355
160 Ga0316582_0012405 3300036647 Bacteria 4755
161 Ga0316582_0042552 3300036647 Bacteria 2846
162 Ga0316582_0043302 3300036647 Bacteria 2824
163 Ga0316582_0060185 3300036647 Bacteria 2434
164 Ga0316582_0071065 3300036647 Bacteria 2253
165 Ga0316582_0074443 3300036647 Bacteria 2205
166 Ga0316582_0089069 3300036647 Bacteria 2028
167 Ga0316582_0138010 3300036647 Bacteria 1642
168 Ga0316584_0002219 3300036712 Bacteria 12174
169 Ga0316584_0011040 3300036712 Bacteria 6330
170 Ga0316584_0027983 3300036712 Bacteria 4152
171 Ga0316584_0040065 3300036712 Bacteria 3490
172 Ga0395905_0001185 3300037471 Bacteria 32604
173 Ga0395905_0008295 3300037471 Bacteria 10250
174 Ga0395905_0019546 3300037471 Bacteria 6420
175 Ga0395905_0038823 3300037471 Bacteria 4466
176 Ga0395905_0098015 3300037471 Bacteria 2753
177 Ga0316581_0001875 3300037588 Bacteria 4896
178 Ga0316581_0024319 3300037588 Bacteria 1796
179 Ga0395901_0034444 3300038443 Bacteria 5230
180 Ga0400484_39825 3300038725 Bacteria 3221
181 Ga0400491_20087 3300038727 Bacteria 2911
182 Ga0400485_00021 3300038735 Bacteria 4548
183 Ga0400485_08498 3300038735 Bacteria 24704
184 Ga0400488_01835 3300038741 Bacteria 11765
185 Ga0400486_02875 3300038742 Bacteria 7271
186 Ga0400486_04313 3300038742 Bacteria 23853
187 Ga0400483_184254 3300039062 Bacteria 10830
188 Ga0400489_02086 3300039093 Bacteria 2943
189 Ga0400489_21238 3300039093 Bacteria 54343
190 Ga0400489_53685 3300039093 Bacteria 19329
191 Ga0400487_32205 3300039110 Bacteria 23753
192 Ga0436362_1151242 3300039453 Bacteria 2509
193 Ga0451849_0319011 3300041505 Bacteria 4088
194 Ga0439433_0007165 3300041999 Bacteria 2407
195 Ga0439449_0000208 3300042007 Bacteria 20706
196 Ga0439449_0016687 3300042007 Bacteria 2758
197 Ga0439462_0011240 3300042015 Bacteria 2277
198 Ga0451577_0000007 3300042876 Bacteria 694123
199 Ga0451577_0000382 3300042876 Bacteria 82167
200 Ga0451577_0003449 3300042876 Bacteria 17604
201 Ga0451577_0004098 3300042876 Bacteria 15641
202 Ga0451577_0004595 3300042876 Bacteria 14501
203 Ga0451577_0006992 3300042876 Bacteria 11144
204 Ga0451577_0008533 3300042876 Bacteria 9967
205 Ga0451577_0023103 3300042876 Bacteria 5676
206 Ga0451577_0024478 3300042876 Bacteria 5492
207 Ga0451577_0029534 3300042876 Bacteria 4956
208 Ga0451577_0051019 3300042876 Bacteria 3693
209 Ga0451577_0058854 3300042876 Bacteria 3426
210 Ga0451577_0131667 3300042876 Bacteria 2244
211 Ga0451577_0274492 3300042876 Bacteria 1527
212 Ga0466972_0041253 3300044658 Bacteria 2247
213 Ga0453683_0000001 3300044673 Bacteria 1384965
214 Ga0453683_0000051 3300044673 Bacteria 201733
215 Ga0453683_0002337 3300044673 Bacteria 14876
216 Ga0453683_0003693 3300044673 Bacteria 11195
217 Ga0453683_0009886 3300044673 Bacteria 6350
218 Ga0453683_0011090 3300044673 Bacteria 5956
219 Ga0466965_0001844 3300044683 Bacteria 8812
220 Ga0466961_0015230 3300044693 Bacteria 4938
221 Ga0453684_0000089 3300044712 Bacteria 395064
222 Ga0453684_0000094 3300044712 Bacteria 382117
223 Ga0453684_0000117 3300044712 Bacteria 348119
224 Ga0453684_0000776 3300044712 Bacteria 110037
225 Ga0453684_0001287 3300044712 Bacteria 74662
226 Ga0453684_0003508 3300044712 Bacteria 35177
227 Ga0453684_0006777 3300044712 Bacteria 21555
228 Ga0453684_0013153 3300044712 Bacteria 13494
229 Ga0453684_0013399 3300044712 Bacteria 13323
230 Ga0453684_0018922 3300044712 Bacteria 10531
231 Ga0453684_0020074 3300044712 Bacteria 10115
232 Ga0453684_0020542 3300044712 Bacteria 9949
233 Ga0453684_0030114 3300044712 Bacteria 7678
234 Ga0453684_0031917 3300044712 Bacteria 7386
235 Ga0453684_0060213 3300044712 Bacteria 4887
236 Ga0453684_0062372 3300044712 Unclassified 4775
237 Ga0453684_0075421 3300044712 Bacteria 4239
238 Ga0453684_0129806 3300044712 Bacteria 3025
239 Ga0453684_0137035 3300044712 Bacteria 2928
240 Ga0453684_0160112 3300044712 Bacteria 2663
241 Ga0453684_0179491 3300044712 Bacteria 2486
242 Ga0453684_0201401 3300044712 Bacteria 2320
243 Ga0453684_0217532 3300044712 Bacteria 2215
244 Ga0453684_0260368 3300044712 Bacteria 1987
245 Ga0453684_0280810 3300044712 Bacteria 1899
246 Ga0453684_0428685 3300044712 Bacteria 1476
247 Ga0466968_0002315 3300044735 Bacteria 6965
248 Ga0466968_0002956 3300044735 Bacteria 6279
249 Ga0466960_0000640 3300044901 Bacteria 12107
250 Ga0451576_0000031 3300045051 Bacteria 399742
251 Ga0451576_0000038 3300045051 Bacteria 369709
252 Ga0451576_0000121 3300045051 Bacteria 199083
253 Ga0451576_0001468 3300045051 Bacteria 39960
254 Ga0451576_0001585 3300045051 Bacteria 38234
255 Ga0451576_0008122 3300045051 Bacteria 12360
256 Ga0451576_0051245 3300045051 Bacteria 4328
257 Ga0451576_0051377 3300045051 Bacteria 4322
258 Ga0451576_0246080 3300045051 Bacteria 1869
259 Ga0466967_0026106 3300045976 Bacteria 4832
260 Ga0495592_0049764 3300046454 Bacteria 3115
261 Ga0495580_0000810 3300046472 Bacteria 27074
262 Ga0495582_0046551 3300046473 Bacteria 2389
263 Ga0495664_0001672 3300046477 Bacteria 11785
264 Ga0495594_0002664 3300046499 Bacteria 9287
265 Ga0495608_0022133 3300046511 Bacteria 4357
266 Ga0495628_0018733 3300046516 Bacteria 5730
267 Ga0495666_0024007 3300046526 Bacteria 3015
268 Ga0495587_0013639 3300046536 Bacteria 5105
269 Ga0495645_0002339 3300046543 Bacteria 12866
270 Ga0495667_0013744 3300046559 Bacteria 5469
271 Ga0495667_0077548 3300046559 Bacteria 2161
272 Ga0495623_0027650 3300046679 Bacteria 3652
273 Ga0495658_0047956 3300046683 Bacteria 2407
274 Ga0495604_0128935 3300047317 Bacteria 1820
275 Ga0495680_0037058 3300047322 Bacteria 3909
276 Ga0495675_0013992 3300047444 Bacteria 5073
277 Ga0495684_0048947 3300047471 Bacteria 3231
278 Ga0495602_0000299 3300048088 Bacteria 45610
279 Ga0495626_0017730 3300048091 Bacteria 3590
280 Ga0496102_0021155 3300048905 Bacteria 5752
281 Ga0496108_0000059 3300048911 Bacteria 123078
282 Ga0496115_0012026 3300048918 Bacteria 6505
283 Ga0496116_0002747 3300048919 Bacteria 18082
284 Ga0496116_0005716 3300048919 Bacteria 11441
285 Ga0496116_0007042 3300048919 Bacteria 10072
286 Ga0496116_0007509 3300048919 Bacteria 9650
287 Ga0496116_0011376 3300048919 Bacteria 7376
288 Ga0496116_0018194 3300048919 Bacteria 5426
289 Ga0496116_0023420 3300048919 Bacteria 4598
290 Ga0496116_0023545 3300048919 Bacteria 4584
291 Ga0496116_0050055 3300048919 Bacteria 2786
292 Ga0496117_0000374 3300048920 Bacteria 77253
293 Ga0496117_0046841 3300048920 Bacteria 3107
294 Ga0496117_0108402 3300048920 Bacteria 1737
295 Ga0496118_0035778 3300048921 Bacteria 4025
296 Ga0496118_0129902 3300048921 Bacteria 1620
297 Ga0496119_0000033 3300048922 Bacteria 218976
298 Ga0496119_0000469 3300048922 Bacteria 54992
299 Ga0496119_0010940 3300048922 Bacteria 7577
300 Ga0496119_0042394 3300048922 Bacteria 2885
301 Ga0496119_0072512 3300048922 Bacteria 2011
302 Ga0496120_0000171 3300048923 Bacteria 110335
303 Ga0496120_0000925 3300048923 Bacteria 40696
304 Ga0496120_0003045 3300048923 Bacteria 15808
305 Ga0496120_0004721 3300048923 Bacteria 11220
306 Ga0496121_0077110 3300048924 Bacteria 2655
307 Ga0496122_0000015 3300048925 Bacteria 489028
308 Ga0496122_0000041 3300048925 Bacteria 282392
309 Ga0496122_0001838 3300048925 Bacteria 32345
310 Ga0496122_0006076 3300048925 Bacteria 14073
311 Ga0496122_0034863 3300048925 Bacteria 4109
312 Ga0496122_0040098 3300048925 Bacteria 3727
313 Ga0496122_0062389 3300048925 Bacteria 2729
314 Ga0496122_0114344 3300048925 Bacteria 1761
315 Ga0496122_0148729 3300048925 Bacteria 1450
316 Ga0496123_0000193 3300048926 Bacteria 123847
317 Ga0496123_0001134 3300048926 Bacteria 39790
318 Ga0496123_0009829 3300048926 Bacteria 8543
319 Ga0496123_0013838 3300048926 Bacteria 6732
320 Ga0496123_0023522 3300048926 Bacteria 4713
321 Ga0496123_0068915 3300048926 Bacteria 2225
322 Ga0496124_0000697 3300048927 Bacteria 55040
323 Ga0496124_0001169 3300048927 Bacteria 41092
324 Ga0496125_0000043 3300048928 Bacteria 301512
325 Ga0496125_0004005 3300048928 Bacteria 17323
326 Ga0496125_0004147 3300048928 Bacteria 16901
327 Ga0496126_0000076 3300048929 Bacteria 234420
328 Ga0496126_0000168 3300048929 Bacteria 152201
329 Ga0496126_0000887 3300048929 Bacteria 52527
330 Ga0496126_0005326 3300048929 Bacteria 14745
331 Ga0496126_0019406 3300048929 Bacteria 6696
332 Ga0496126_0020762 3300048929 Bacteria 6429
333 Ga0496126_0031039 3300048929 Bacteria 5054
334 Ga0501034_0001586 3300049571 Bacteria 29589
335 Ga0501034_0160179 3300049571 Unclassified 2222
336 Ga0501034_0246798 3300049571 Bacteria 1730
337 Ga0501217_006156 3300049661 Bacteria 2538
338 Ga0501083_0081040 3300049744 Bacteria 2152
339 Ga0501035_0206860 3300049822 Bacteria 1681
340 nmdc:mga05p37_149_c1 3300050507 Bacteria 65984
341 nmdc:mga08x19_142537_c1 3300050514 Bacteria 1619
342 nmdc:mga08x19_39_c1 3300050514 Bacteria 158844
343 nmdc:mga08x19_96388_c1 3300050514 Bacteria 1958
344 nmdc:mga0a205_43369_c1 3300050515 Bacteria 4337
345 Ga0495601_0005304 3300053077 Bacteria 7501
346 Ga0495612_0001650 3300053078 Bacteria 9181
347 Ga0495595_0021189 3300053084 Bacteria 2837
348 Ga0495619_0029810 3300053085 Bacteria 3528
349 Ga0495619_0032873 3300053085 Bacteria 3367
350 Ga0500566_0000656 3300053094 Bacteria 19418
351 Ga0500595_000009 3300053119 Bacteria 278382
352 Ga0500637_0000910 3300053178 Bacteria 11920
353 Ga0500637_0002095 3300053178 Bacteria 8735
354 Ga0501084_0076183 3300054114 Bacteria 2812
355 Ga0530510_0000496 3300061734 Bacteria 25056
356 Ga0530510_0093564 3300061734 Bacteria 2195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046526 Ga0495666_0024007 Ga0495666_0024007_28_1131 365
2 3300048919 Ga0496116_0023545 Ga0496116_0023545_3399_4517 370
3 3300044673 Ga0453683_0009886 Ga0453683_0009886_1424_2677 399
4 3300005406 Ga0070703_10000278 Ga0070703_100002783 403
5 3300005434 Ga0070709_10000055 Ga0070709_1000005521 403
6 3300005436 Ga0070713_100104058 Ga0070713_1001040582 403
7 3300005467 Ga0070706_100000042 Ga0070706_100000042112 403
8 3300005518 Ga0070699_100000088 Ga0070699_10000008822 403
9 3300044673 Ga0453683_0002337 Ga0453683_0002337_5027_6289 412
10 3300044712 Ga0453684_0160112 Ga0453684_0160112_444_1706 412
11 3300045051 Ga0451576_0000038 Ga0451576_0000038_136078_137340 412
12 3300036647 Ga0316582_0074443 Ga0316582_0074443_107_1354 414
13 3300042876 Ga0451577_0008533 Ga0451577_0008533_4370_5620 415
14 3300042876 Ga0451577_0023103 Ga0451577_0023103_439_1689 415
15 3300045976 Ga0466967_0026106 Ga0466967_0026106_3171_4559 415
16 3300049571 Ga0501034_0246798 Ga0501034_0246798_334_1605 415
17 3300031235 Ga0265330_10018701 Ga0265330_100187013 416
18 3300031344 Ga0265316_10007116 Ga0265316_100071165 416
19 3300031344 Ga0265316_10018473 Ga0265316_100184733 416
20 3300036647 Ga0316582_0012405 Ga0316582_0012405_3450_4718 416
21 3300044673 Ga0453683_0000001 Ga0453683_0000001_614854_616107 416
22 3300044712 Ga0453684_0062372 Ga0453684_0062372_1193_2446 416
23 3300045051 Ga0451576_0008122 Ga0451576_0008122_3248_4501 416
24 3300031242 Ga0265329_10026064 Ga0265329_100260641 417
25 3300031249 Ga0265339_10063831 Ga0265339_100638312 417
26 3300037471 Ga0395905_0019546 Ga0395905_0019546_611_1945 417
27 3300037471 Ga0395905_0038823 Ga0395905_0038823_495_1823 417
28 3300037471 Ga0395905_0098015 Ga0395905_0098015_75_1406 417
29 3300038443 Ga0395901_0034444 Ga0395901_0034444_151_1479 417
30 3300044712 Ga0453684_0013153 Ga0453684_0013153_1147_2403 417
31 3300044712 Ga0453684_0217532 Ga0453684_0217532_321_1577 417
32 3300044712 Ga0453684_0280810 Ga0453684_0280810_152_1408 417
33 3300045051 Ga0451576_0246080 Ga0451576_0246080_280_1542 418
34 3300005467 Ga0070706_100003271 Ga0070706_10000327114 419
35 3300005536 Ga0070697_100004372 Ga0070697_1000043728 419
36 3300025910 Ga0207684_10000555 Ga0207684_1000055525 419
37 3300025910 Ga0207684_10002110 Ga0207684_1000211017 419
38 3300025922 Ga0207646_10000662 Ga0207646_1000066222 419
39 3300048918 Ga0496115_0012026 Ga0496115_0012026_2685_4028 419
40 3300049822 Ga0501035_0206860 Ga0501035_0206860_120_1391 419
41 3300031691 Ga0316579_10005251 Ga0316579_100052513 420
42 3300031691 Ga0316579_10012878 Ga0316579_100128783 420
43 3300042876 Ga0451577_0058854 Ga0451577_0058854_198_1466 420
44 3300044712 Ga0453684_0020074 Ga0453684_0020074_4619_5890 420
45 3300048922 Ga0496119_0072512 Ga0496119_0072512_58_1347 420
46 3300025915 Ga0207693_10053428 Ga0207693_100534283 422
47 3300025929 Ga0207664_10019049 Ga0207664_100190494 422
48 3300035111 Ga0373923_0010477 Ga0373923_0010477_867_2258 422
49 3300035172 Ga0373955_0043777 Ga0373955_0043777_574_1965 422
50 3300035724 Ga0373933_0062034 Ga0373933_0062034_469_1860 422
51 3300036401 Ga0373937_0002971 Ga0373937_0002971_12208_13599 422
52 3300036401 Ga0373937_0072330 Ga0373937_0072330_167_1558 422
53 3300046454 Ga0495592_0049764 Ga0495592_0049764_591_1982 422
54 3300046477 Ga0495664_0001672 Ga0495664_0001672_6598_7989 422
55 3300046511 Ga0495608_0022133 Ga0495608_0022133_1877_3268 422
56 3300046516 Ga0495628_0018733 Ga0495628_0018733_2784_4175 422
57 3300046536 Ga0495587_0013639 Ga0495587_0013639_2343_3734 422
58 3300046543 Ga0495645_0002339 Ga0495645_0002339_7764_9155 422
59 3300046559 Ga0495667_0013744 Ga0495667_0013744_1199_2590 422
60 3300046559 Ga0495667_0077548 Ga0495667_0077548_421_1812 422
61 3300046679 Ga0495623_0027650 Ga0495623_0027650_1748_3139 422
62 3300047317 Ga0495604_0128935 Ga0495604_0128935_104_1495 422
63 3300047322 Ga0495680_0037058 Ga0495680_0037058_1685_3076 422
64 3300047444 Ga0495675_0013992 Ga0495675_0013992_2486_3877 422
65 3300048088 Ga0495602_0000299 Ga0495602_0000299_3043_4434 422
66 3300048919 Ga0496116_0011376 Ga0496116_0011376_18_1289 422
67 3300053077 Ga0495601_0005304 Ga0495601_0005304_4216_5607 422
68 3300053078 Ga0495612_0001650 Ga0495612_0001650_2733_4124 422
69 3300053084 Ga0495595_0021189 Ga0495595_0021189_944_2335 422
70 3300053085 Ga0495619_0029810 Ga0495619_0029810_1957_3348 422
71 3300053085 Ga0495619_0032873 Ga0495619_0032873_1923_3314 422
72 3300009011 Ga0105251_10009356 Ga0105251_100093565 423
73 3300011119 Ga0105246_10018979 Ga0105246_100189792 423
74 3300041999 Ga0439433_0007165 Ga0439433_0007165_110_1381 423
75 3300042007 Ga0439449_0016687 Ga0439449_0016687_1257_2528 423
76 3300044693 Ga0466961_0015230 Ga0466961_0015230_2765_4036 423
77 3300044735 Ga0466968_0002315 Ga0466968_0002315_343_1614 423
78 3300048919 Ga0496116_0005716 Ga0496116_0005716_5230_6501 423
79 3300048920 Ga0496117_0108402 Ga0496117_0108402_76_1347 423
80 3300048922 Ga0496119_0000469 Ga0496119_0000469_5230_6501 423
81 3300048923 Ga0496120_0003045 Ga0496120_0003045_5229_6500 423
82 3300048925 Ga0496122_0034863 Ga0496122_0034863_375_1646 423
83 3300048925 Ga0496122_0040098 Ga0496122_0040098_99_1370 423
84 3300048927 Ga0496124_0000697 Ga0496124_0000697_5229_6500 423
85 3300048929 Ga0496126_0005326 Ga0496126_0005326_474_1745 423
86 3300048929 Ga0496126_0020762 Ga0496126_0020762_2717_3988 423
87 3300005336 Ga0070680_100027566 Ga0070680_1000275662 424
88 3300025917 Ga0207660_10106030 Ga0207660_101060301 424
89 3300035725 Ga0373947_0022373 Ga0373947_0022373_1011_2402 429
90 3300036401 Ga0373937_0140007 Ga0373937_0140007_732_2123 429
91 3300044712 Ga0453684_0060213 Ga0453684_0060213_1823_3181 429
92 3300047471 Ga0495684_0048947 Ga0495684_0048947_539_1930 429
93 3300048911 Ga0496108_0000059 Ga0496108_0000059_96564_97964 429
94 3300035695 Ga0373927_0077444 Ga0373927_0077444_13_1458 430
95 3300042876 Ga0451577_0029534 Ga0451577_0029534_2523_3887 432
96 3300031665 Ga0316575_10004443 Ga0316575_100044433 433
97 3300031733 Ga0316577_10065556 Ga0316577_100655562 433
98 3300035398 Ga0316574_0000113 Ga0316574_0000113_21386_22690 433
99 3300035398 Ga0316574_0001306 Ga0316574_0001306_7085_8389 433
100 3300036647 Ga0316582_0000459 Ga0316582_0000459_1894_3198 433
101 3300038727 Ga0400491_20087 Ga0400491_20087_232_1536 433
102 3300038735 Ga0400485_08498 Ga0400485_08498_1208_2512 433
103 3300039110 Ga0400487_32205 Ga0400487_32205_21242_22546 433
104 3300044658 Ga0466972_0041253 Ga0466972_0041253_723_2096 433
105 3300044683 Ga0466965_0001844 Ga0466965_0001844_174_1547 433
106 3300044735 Ga0466968_0002956 Ga0466968_0002956_513_1886 433
107 3300044901 Ga0466960_0000640 Ga0466960_0000640_7255_8628 433
108 3300025906 Ga0207699_10000002 Ga0207699_10000002168 434
109 3300050514 nmdc:mga08x19_39_c1 nmdc:mga08x19_39_c1_127186_128496 434
110 3300042876 Ga0451577_0000007 Ga0451577_0000007_340062_341402 435
111 3300044712 Ga0453684_0000094 Ga0453684_0000094_340062_341402 435
112 3300049661 Ga0501217_006156 Ga0501217_006156_678_1988 435
113 3300045051 Ga0451576_0000121 Ga0451576_0000121_126044_127459 436
114 3300042876 Ga0451577_0274492 Ga0451577_0274492_22_1344 437
115 3300044712 Ga0453684_0260368 Ga0453684_0260368_108_1472 437
116 3300061734 Ga0530510_0000496 Ga0530510_0000496_19516_20877 438
117 3300005842 Ga0068858_100232771 Ga0068858_1002327712 439
118 3300013306 Ga0163162_10036072 Ga0163162_100360722 439
119 3300026035 Ga0207703_10109362 Ga0207703_101093621 439
120 3300044673 Ga0453683_0011090 Ga0453683_0011090_3401_4735 439
121 3300044712 Ga0453684_0001287 Ga0453684_0001287_23905_25275 439
122 3300050507 nmdc:mga05p37_149_c1 nmdc:mga05p37_149_c1_20125_21504 439
123 3300009147 Ga0114129_10117226 Ga0114129_101172261 440
124 3300042876 Ga0451577_0003449 Ga0451577_0003449_13701_15041 440
125 3300045051 Ga0451576_0001468 Ga0451576_0001468_7348_8682 440
126 3300049571 Ga0501034_0160179 Ga0501034_0160179_319_1671 440
127 3300049744 Ga0501083_0081040 Ga0501083_0081040_13_1374 440
128 iso_pu_bacteria 2929199973 2929201489 444
129 3300028381 Ga0268264_10043698 Ga0268264_100436982 445
130 3300031727 Ga0316576_10067560 Ga0316576_100675602 445
131 3300031733 Ga0316577_10043298 Ga0316577_100432982 445
132 3300036712 Ga0316584_0027983 Ga0316584_0027983_1942_3321 445
133 3300044712 Ga0453684_0013399 Ga0453684_0013399_5180_6550 445
134 3300028016 Ga0265354_1003164 Ga0265354_10031642 446
135 3300030878 Ga0265770_1000733 Ga0265770_10007332 446
136 3300031090 Ga0265760_10002594 Ga0265760_100025943 446
137 3300042876 Ga0451577_0000382 Ga0451577_0000382_75705_77048 446
138 3300044712 Ga0453684_0000776 Ga0453684_0000776_103547_104890 446
139 3300005577 Ga0068857_100075699 Ga0068857_1000756992 447
140 3300026116 Ga0207674_10091693 Ga0207674_100916932 447
141 3300039093 Ga0400489_02086 Ga0400489_02086_1074_2474 447
142 3300039453 Ga0436362_1151242 Ga0436362_1151242_490_1893 447
143 3300042876 Ga0451577_0004595 Ga0451577_0004595_6387_7733 447
144 3300042876 Ga0451577_0051019 Ga0451577_0051019_761_2107 447
145 3300044673 Ga0453683_0000051 Ga0453683_0000051_130847_132193 447
146 3300044673 Ga0453683_0003693 Ga0453683_0003693_5755_7251 447
147 3300044712 Ga0453684_0006777 Ga0453684_0006777_17665_19011 447
148 3300044712 Ga0453684_0030114 Ga0453684_0030114_5684_7030 447
149 3300044712 Ga0453684_0031917 Ga0453684_0031917_256_1602 447
150 3300044712 Ga0453684_0075421 Ga0453684_0075421_2855_4222 447
151 3300045051 Ga0451576_0000031 Ga0451576_0000031_260383_261729 447
152 3300045051 Ga0451576_0051245 Ga0451576_0051245_2462_3817 447
153 3300048925 Ga0496122_0000041 Ga0496122_0000041_120467_121819 447
154 3300048926 Ga0496123_0009829 Ga0496123_0009829_2525_3877 447
155 3300048929 Ga0496126_0000168 Ga0496126_0000168_13560_14912 447
156 3300054114 Ga0501084_0076183 Ga0501084_0076183_1266_2627 447
157 3300061734 Ga0530510_0093564 Ga0530510_0093564_290_1651 447
158 3300005353 Ga0070669_100010869 Ga0070669_1000108695 448
159 3300005439 Ga0070711_100056257 Ga0070711_1000562572 448
160 3300005718 Ga0068866_10000132 Ga0068866_1000013213 448
161 3300005842 Ga0068858_100039105 Ga0068858_1000391053 448
162 3300005937 Ga0081455_10004528 Ga0081455_1000452818 448
163 3300005981 Ga0081538_10002993 Ga0081538_100029935 448
164 3300009093 Ga0105240_10007200 Ga0105240_100072003 448
165 3300009176 Ga0105242_10000424 Ga0105242_1000042413 448
166 3300009553 Ga0105249_10001745 Ga0105249_1000174512 448
167 3300010375 Ga0105239_10001293 Ga0105239_1000129313 448
168 3300013297 Ga0157378_10018369 Ga0157378_100183695 448
169 3300025899 Ga0207642_10000053 Ga0207642_1000005321 448
170 3300025913 Ga0207695_10002956 Ga0207695_1000295613 448
171 3300025923 Ga0207681_10035218 Ga0207681_100352183 448
172 3300025934 Ga0207686_10000338 Ga0207686_1000033820 448
173 3300025961 Ga0207712_10001369 Ga0207712_100013698 448
174 3300030760 Ga0265762_1009995 Ga0265762_10099951 448
175 3300031251 Ga0265327_10033726 Ga0265327_100337261 448
176 3300035084 Ga0373928_0000793 Ga0373928_0000793_185_1534 448
177 3300035112 Ga0373932_0023623 Ga0373932_0023623_247_1596 448
178 3300042876 Ga0451577_0131667 Ga0451577_0131667_682_2034 448
179 3300044712 Ga0453684_0018922 Ga0453684_0018922_5160_6512 448
180 3300044712 Ga0453684_0020542 Ga0453684_0020542_8294_9643 448
181 3300044712 Ga0453684_0179491 Ga0453684_0179491_916_2265 448
182 3300044712 Ga0453684_0201401 Ga0453684_0201401_232_1584 448
183 3300045051 Ga0451576_0051377 Ga0451576_0051377_2257_3606 448
184 iso_pu_bacteria 2510917027 2511180899 448
185 iso_pu_bacteria 2512564013 2512635706 448
186 iso_pu_bacteria 2857465823 2857472316 448
187 iso_pu_bacteria 2857591370 2857597818 448
188 iso_pu_bacteria 2915597211 2915598667 448
189 iso_pu_bacteria 2915606848 2915609962 448
190 iso_pu_bacteria 2929183550 2929183814 448
191 3300028653 Ga0265323_10004972 Ga0265323_100049722 449
192 3300028653 Ga0265323_10010329 Ga0265323_100103292 449
193 3300028654 Ga0265322_10020628 Ga0265322_100206282 449
194 3300031235 Ga0265330_10014457 Ga0265330_100144573 449
195 3300031235 Ga0265330_10025896 Ga0265330_100258961 449
196 3300031238 Ga0265332_10000316 Ga0265332_1000031625 449
197 3300031242 Ga0265329_10016309 Ga0265329_100163092 449
198 3300031247 Ga0265340_10030323 Ga0265340_100303232 449
199 3300031249 Ga0265339_10022787 Ga0265339_100227873 449
200 3300031250 Ga0265331_10000059 Ga0265331_10000059150 449
201 3300031344 Ga0265316_10000052 Ga0265316_10000052109 449
202 3300031344 Ga0265316_10016847 Ga0265316_100168475 449
203 3300031344 Ga0265316_10026140 Ga0265316_100261403 449
204 3300031548 Ga0307408_100133150 Ga0307408_1001331501 449
205 3300031711 Ga0265314_10000814 Ga0265314_1000081425 449
206 3300031712 Ga0265342_10005477 Ga0265342_100054772 449
207 3300031712 Ga0265342_10031732 Ga0265342_100317323 449
208 3300031712 Ga0265342_10072722 Ga0265342_100727223 449
209 3300036647 Ga0316582_0043302 Ga0316582_0043302_1313_2668 449
210 3300037471 Ga0395905_0001185 Ga0395905_0001185_947_2377 449
211 3300037471 Ga0395905_0008295 Ga0395905_0008295_3562_4989 449
212 3300042876 Ga0451577_0006992 Ga0451577_0006992_6446_7813 449
213 3300044712 Ga0453684_0000089 Ga0453684_0000089_387103_388470 449
214 3300044712 Ga0453684_0137035 Ga0453684_0137035_132_1496 449
215 3300044712 Ga0453684_0428685 Ga0453684_0428685_96_1451 449
216 iso_pu_bacteria 2898907183 2898908910 449
217 3300005842 Ga0068858_100253983 Ga0068858_1002539832 450
218 3300009093 Ga0105240_10000353 Ga0105240_1000035310 450
219 3300009093 Ga0105240_10009142 Ga0105240_100091427 450
220 3300025913 Ga0207695_10002735 Ga0207695_1000273510 450
221 3300025913 Ga0207695_10011671 Ga0207695_1001167110 450
222 3300025949 Ga0207667_10016454 Ga0207667_100164541 450
223 3300028577 Ga0265318_10003066 Ga0265318_100030666 450
224 3300031235 Ga0265330_10010783 Ga0265330_100107832 450
225 3300031344 Ga0265316_10022309 Ga0265316_100223093 450
226 3300031344 Ga0265316_10026274 Ga0265316_100262741 450
227 3300031711 Ga0265314_10077371 Ga0265314_100773712 450
228 3300036647 Ga0316582_0060185 Ga0316582_0060185_127_1485 450
229 3300036647 Ga0316582_0138010 Ga0316582_0138010_181_1539 450
230 3300044712 Ga0453684_0003508 Ga0453684_0003508_13062_14426 450
231 3300045051 Ga0451576_0001585 Ga0451576_0001585_6518_7876 450
232 3300048919 Ga0496116_0007042 Ga0496116_0007042_4737_6101 450
233 iso_pu_bacteria 2600255229 2601444973 450
234 iso_pu_bacteria 2852673933 2852676585 450
235 iso_pu_bacteria 2857472729 2857479008 450
236 iso_pu_bacteria 2928510474 2928513080 450
237 3300005336 Ga0070680_100077939 Ga0070680_1000779392 451
238 3300005337 Ga0070682_100030223 Ga0070682_1000302232 451
239 3300005467 Ga0070706_100008145 Ga0070706_1000081459 451
240 3300005468 Ga0070707_100007439 Ga0070707_10000743910 451
241 3300005471 Ga0070698_100007518 Ga0070698_1000075185 451
242 3300005518 Ga0070699_100024821 Ga0070699_1000248215 451
243 3300005530 Ga0070679_100087325 Ga0070679_1000873253 451
244 3300025912 Ga0207707_10025942 Ga0207707_100259424 451
245 3300025917 Ga0207660_10029048 Ga0207660_100290483 451
246 3300031727 Ga0316576_10042007 Ga0316576_100420072 451
247 3300031733 Ga0316577_10008271 Ga0316577_100082714 451
248 3300035398 Ga0316574_0153228 Ga0316574_0153228_12_1370 451
249 3300035691 Ga0373931_0012472 Ga0373931_0012472_1066_2424 451
250 3300042876 Ga0451577_0024478 Ga0451577_0024478_2522_3889 451
251 3300044712 Ga0453684_0129806 Ga0453684_0129806_717_2084 451
252 3300048905 Ga0496102_0021155 Ga0496102_0021155_4360_5736 451
253 3300049571 Ga0501034_0001586 Ga0501034_0001586_16835_18244 451
254 iso_pu_bacteria 2524023129 2524189963 451
255 iso_pu_bacteria 2548877040 2550903182 451
256 iso_pu_bacteria 2563366752 2563930157 451
257 iso_pu_bacteria 2571042143 2571531564 451
258 iso_pu_bacteria 2571042588 2573039791 451
259 iso_pu_bacteria 2576861424 2578338919 451
260 iso_pu_bacteria 2579778775 2580929946 451
261 iso_pu_bacteria 2600255286 2601641717 451
262 iso_pu_bacteria 2619619294 2621273331 451
263 iso_pu_bacteria 2643221543 2643738808 451
264 iso_pu_bacteria 2671180694 2673821689 451
265 iso_pu_bacteria 2721755693 2723606227 451
266 iso_pu_bacteria 2728368933 2728529855 451
267 iso_pu_bacteria 2728369359 2730136850 451
268 iso_pu_bacteria 2751185905 2753813113 451
269 iso_pu_bacteria 2791355222 2793182108 451
270 iso_pu_bacteria 2802428803 2802440691 451
271 iso_pu_bacteria 2818991459 2819676066 451
272 iso_pu_bacteria 2821111986 2821118287 451
273 iso_pu_bacteria 2857453340 2857460069 451
274 iso_pu_bacteria 2864733723 2864738905 451
275 iso_pu_bacteria 2864997549 2865001989 451
276 iso_pu_bacteria 2865002811 2865007606 451
277 iso_pu_bacteria 2881636855 2881639836 451
278 iso_pu_bacteria 2885526491 2885529949 451
279 iso_pu_bacteria 2888578766 2888584496 451
280 iso_pu_bacteria 2889042446 2889048043 451
281 iso_pu_bacteria 2889049205 2889053057 451
282 iso_pu_bacteria 2889276214 2889276780 451
283 iso_pu_bacteria 2904113452 2904116944 451
284 iso_pu_bacteria 2904162308 2904168120 451
285 iso_pu_bacteria 2904490793 2904496983 451
286 iso_pu_bacteria 2904595352 2904600747 451
287 iso_pu_bacteria 2904755435 2904755707 451
288 iso_pu_bacteria 2907202186 2907208235 451
289 iso_pu_bacteria 2919160200 2919166214 451
290 iso_pu_bacteria 2919425241 2919432378 451
291 iso_pu_bacteria 2925326138 2925332804 451
292 iso_pu_bacteria 2929206907 2929211916 451
293 iso_pu_bacteria 2931384279 2931385149 451
294 iso_pu_bacteria 2938649242 2938653425 451
295 iso_pu_bacteria 2939679117 2939685089 451
296 iso_pu_bacteria 2939702853 2939707569 451
297 iso_pu_bacteria 2945991243 2945996227 451
298 iso_pu_bacteria 2946053406 2946058917 451
299 iso_pu_bacteria 2968558590 2968562402 451
300 iso_pu_bacteria 2971410472 2971410894 451
301 iso_pu_bacteria 2980125574 2980128541 451
302 iso_pu_bacteria 2980182181 2980186783 451
303 iso_pu_bacteria 2984527788 2984531194 451
304 iso_pu_bacteria 2984532647 2984537303 451
305 iso_pu_bacteria 2988225383 2988229909 451
306 iso_pu_bacteria 2996632988 2996636904 451
307 iso_pu_bacteria 2996706504 2996707518 451
308 iso_pu_bacteria 648028048 648172222 451
309 iso_pu_bacteria 8002317523 8002324019 451
310 iso_pu_bacteria 8046991243 8046991356 451
311 iso_pu_bacteria 8054465665 8054471348 451
312 iso_pu_bacteria 8054795415 8054802028 451
313 iso_pu_bacteria 8055632911 8055634053 451
314 iso_pu_bacteria 8056533031 8056535643 451
315 iso_pu_bacteria 8057473075 8057473419 451
316 iso_pu_bacteria 8057733483 8057735177 451
317 iso_pu_bacteria 8057977335 8057979836 451
318 3300005471 Ga0070698_100123354 Ga0070698_1001233541 452
319 3300031238 Ga0265332_10005838 Ga0265332_100058383 452
320 3300031249 Ga0265339_10000250 Ga0265339_1000025012 452
321 3300031250 Ga0265331_10003460 Ga0265331_100034604 452
322 3300031344 Ga0265316_10000218 Ga0265316_1000021827 452
323 3300031344 Ga0265316_10000934 Ga0265316_1000093416 452
324 3300031665 Ga0316575_10024499 Ga0316575_100244992 452
325 3300031711 Ga0265314_10000935 Ga0265314_1000093522 452
326 3300031727 Ga0316576_10004683 Ga0316576_100046836 452
327 3300031728 Ga0316578_10008705 Ga0316578_100087053 452
328 3300031733 Ga0316577_10000966 Ga0316577_100009668 452
329 3300032137 Ga0316585_10000364 Ga0316585_100003644 452
330 3300032139 Ga0316580_10013263 Ga0316580_100132632 452
331 3300036647 Ga0316582_0000549 Ga0316582_0000549_2817_4184 452
332 3300036712 Ga0316584_0002219 Ga0316584_0002219_7980_9347 452
333 3300037588 Ga0316581_0001875 Ga0316581_0001875_1407_2774 452
334 3300053119 Ga0500595_000009 Ga0500595_000009_247543_248910 452
335 3300014968 Ga0157379_10161662 Ga0157379_101616622 453
336 3300025229 Ga0209147_100210 Ga0209147_10021077 453
337 3300031728 Ga0316578_10003226 Ga0316578_100032264 453
338 3300031733 Ga0316577_10072214 Ga0316577_100722141 453
339 3300032133 Ga0316583_10000248 Ga0316583_100002484 453
340 3300036647 Ga0316582_0042552 Ga0316582_0042552_758_2128 453
341 3300036647 Ga0316582_0071065 Ga0316582_0071065_377_1747 453
342 3300036647 Ga0316582_0089069 Ga0316582_0089069_57_1427 453
343 3300036712 Ga0316584_0011040 Ga0316584_0011040_2328_3698 453
344 3300036712 Ga0316584_0040065 Ga0316584_0040065_94_1464 453
345 3300037588 Ga0316581_0024319 Ga0316581_0024319_80_1450 453
346 3300038725 Ga0400484_39825 Ga0400484_39825_542_1912 453
347 3300038735 Ga0400485_00021 Ga0400485_00021_2034_3401 453
348 3300038741 Ga0400488_01835 Ga0400488_01835_1804_3174 453
349 3300038742 Ga0400486_02875 Ga0400486_02875_1148_2515 453
350 3300038742 Ga0400486_04313 Ga0400486_04313_1145_2512 453
351 3300039062 Ga0400483_184254 Ga0400483_184254_5087_6457 453
352 3300039093 Ga0400489_21238 Ga0400489_21238_37762_39132 453
353 3300039093 Ga0400489_53685 Ga0400489_53685_2954_4321 453
354 3300046472 Ga0495580_0000810 Ga0495580_0000810_9110_10480 453
355 3300046473 Ga0495582_0046551 Ga0495582_0046551_78_1448 453
356 3300046499 Ga0495594_0002664 Ga0495594_0002664_5958_7328 453
357 3300046683 Ga0495658_0047956 Ga0495658_0047956_98_1468 453
358 3300048919 Ga0496116_0023420 Ga0496116_0023420_3031_4422 453
359 3300048919 Ga0496116_0050055 Ga0496116_0050055_177_1568 453
360 3300048920 Ga0496117_0000374 Ga0496117_0000374_74310_75701 453
361 3300048921 Ga0496118_0129902 Ga0496118_0129902_98_1489 453
362 3300048922 Ga0496119_0000033 Ga0496119_0000033_209081_210472 453
363 3300048922 Ga0496119_0042394 Ga0496119_0042394_337_1728 453
364 3300048923 Ga0496120_0000171 Ga0496120_0000171_107759_109150 453
365 3300048923 Ga0496120_0000925 Ga0496120_0000925_12305_13696 453
366 3300048923 Ga0496120_0004721 Ga0496120_0004721_4948_6339 453
367 3300048925 Ga0496122_0000015 Ga0496122_0000015_438867_440336 453
368 3300048925 Ga0496122_0001838 Ga0496122_0001838_23679_25070 453
369 3300048926 Ga0496123_0000193 Ga0496123_0000193_99420_100811 453
370 3300048926 Ga0496123_0001134 Ga0496123_0001134_10401_11870 453
371 3300048928 Ga0496125_0000043 Ga0496125_0000043_249254_250645 453
372 3300048929 Ga0496126_0000076 Ga0496126_0000076_184109_185578 453
373 3300048929 Ga0496126_0000887 Ga0496126_0000887_31799_33190 453
374 3300053178 Ga0500637_0002095 Ga0500637_0002095_5229_6608 453
375 3300005336 Ga0070680_100215474 Ga0070680_1002154741 454
376 3300005439 Ga0070711_100000002 Ga0070711_100000002124 454
377 3300005440 Ga0070705_100000036 Ga0070705_10000003629 454
378 3300005440 Ga0070705_100033666 Ga0070705_1000336662 454
379 3300005546 Ga0070696_100000040 Ga0070696_10000004047 454
380 3300005546 Ga0070696_100006866 Ga0070696_1000068667 454
381 3300005547 Ga0070693_100004548 Ga0070693_1000045482 454
382 3300005563 Ga0068855_100050513 Ga0068855_1000505134 454
383 3300006175 Ga0070712_100045425 Ga0070712_1000454253 454
384 3300006914 Ga0075436_100003310 Ga0075436_1000033104 454
385 3300025885 Ga0207653_10000028 Ga0207653_1000002896 454
386 3300025910 Ga0207684_10000061 Ga0207684_1000006196 454
387 3300025915 Ga0207693_10058024 Ga0207693_100580243 454
388 3300025916 Ga0207663_10000022 Ga0207663_10000022107 454
389 3300042876 Ga0451577_0004098 Ga0451577_0004098_5180_6562 454
390 3300044712 Ga0453684_0000117 Ga0453684_0000117_341435_342817 454
391 3300048925 Ga0496122_0062389 Ga0496122_0062389_683_2050 454
392 3300048925 Ga0496122_0148729 Ga0496122_0148729_59_1426 454
393 3300050514 nmdc:mga08x19_142537_c1 nmdc:mga08x19_142537_c1_145_1593 454
394 3300050514 nmdc:mga08x19_96388_c1 nmdc:mga08x19_96388_c1_294_1673 454
395 3300050515 nmdc:mga0a205_43369_c1 nmdc:mga0a205_43369_c1_1272_2651 454
396 3300053094 Ga0500566_0000656 Ga0500566_0000656_6124_7500 454
397 3300053178 Ga0500637_0000910 Ga0500637_0000910_9805_11181 454
398 3300003751 Ga0055538_1000180 Ga0055538_100018026 455
399 3300003841 Ga0055541_1000148 Ga0055541_100014829 455
400 3300003841 Ga0055541_1003085 Ga0055541_10030852 455
401 3300003841 Ga0055541_1004269 Ga0055541_10042692 455
402 3300005563 Ga0068855_100010092 Ga0068855_1000100922 455
403 3300025224 Ga0209784_100141 Ga0209784_10014169 455
404 3300025225 Ga0209566_100588 Ga0209566_10058816 455
405 3300025225 Ga0209566_100775 Ga0209566_1007755 455
406 3300025225 Ga0209566_101316 Ga0209566_1013163 455
407 3300025233 Ga0209437_100331 Ga0209437_10033169 455
408 3300025291 Ga0209675_1004384 Ga0209675_10043842 455
409 3300025294 Ga0209025_1003050 Ga0209025_10030506 455
410 3300025294 Ga0209025_1037389 Ga0209025_10373892 455
411 3300025728 Ga0207655_1011383 Ga0207655_10113832 455
412 3300025949 Ga0207667_10004005 Ga0207667_100040055 455
413 3300041505 Ga0451849_0319011 Ga0451849_0319011_63_1523 455
414 3300042007 Ga0439449_0000208 Ga0439449_0000208_4074_5441 455
415 3300042015 Ga0439462_0011240 Ga0439462_0011240_620_1987 455
416 3300048091 Ga0495626_0017730 Ga0495626_0017730_203_1570 455
417 3300048919 Ga0496116_0002747 Ga0496116_0002747_9720_11087 455
418 3300048919 Ga0496116_0007509 Ga0496116_0007509_2853_4220 455
419 3300048919 Ga0496116_0018194 Ga0496116_0018194_775_2148 455
420 3300048920 Ga0496117_0046841 Ga0496117_0046841_439_1812 455
421 3300048921 Ga0496118_0035778 Ga0496118_0035778_457_1830 455
422 3300048922 Ga0496119_0010940 Ga0496119_0010940_4280_5653 455
423 3300048924 Ga0496121_0077110 Ga0496121_0077110_1197_2606 455
424 3300048925 Ga0496122_0006076 Ga0496122_0006076_5811_7178 455
425 3300048925 Ga0496122_0114344 Ga0496122_0114344_153_1661 455
426 3300048926 Ga0496123_0013838 Ga0496123_0013838_3781_5154 455
427 3300048926 Ga0496123_0023522 Ga0496123_0023522_1474_2841 455
428 3300048926 Ga0496123_0068915 Ga0496123_0068915_573_2147 455
429 3300048927 Ga0496124_0001169 Ga0496124_0001169_6468_7835 455
430 3300048928 Ga0496125_0004005 Ga0496125_0004005_5541_6908 455
431 3300048928 Ga0496125_0004147 Ga0496125_0004147_7014_8387 455
432 3300048929 Ga0496126_0019406 Ga0496126_0019406_5102_6574 455
433 3300048929 Ga0496126_0031039 Ga0496126_0031039_2143_3516 455
434 iso_pu_bacteria 2512564039 2512736559 455
435 iso_pu_bacteria 2980176882 2980179408 455

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18073

Rubredoxin_2

Rubredoxin metal binding domain

77

104

0.98

PF06745

ATPase

KaiC

140

216

0.89

PF13541

ChlI

Subunit ChlI of Mg-chelatase

397

497

0.88

PF13481

AAA_25

AAA domain

131

290

0.85

PF05362

Lon_C

Lon protease (S16) C-terminal proteolytic domain

409

524

0.84

PF06745

ATPase

KaiC

217

344

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lkq-assembly1.cif.gz_B protease domain of rada 0.9595 279 453
5lkq-assembly1.cif.gz_B protease domain of rada 0.9436 279 453
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.941 285 455
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.9293 285 455
8dvh-assembly1.cif.gz_B crystal structure of atp-dependent lon protease from bacillus subtillis (bslonba) 0.9274 287 455
ID Description Score Start End Superfamily
af_Q2G243_272_444_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.997 285 454 3.30.230.10
af_F4K8X8_240_443_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9884 78 275 3.40.50.300
af_P24554_64_278_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9801 58 273 3.40.50.300
af_P24554_64_278_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9756 58 273 3.40.50.300
af_P9WHJ9_62_274_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9748 63 273 3.40.50.300
ID Description Score Start End GO Terms
AF-W1XIA3-F1-model_v4 DNA repair protein RadA 0.9939 294 402 GO:0000725
GO:0005829
AF-T1A795-F1-model_v4 DNA repair protein RadA 0.992 305 396 GO:0000725
GO:0005829
AF-A0A534VRD1-F1-model_v4 DNA repair protein RadA 0.9893 309 453 GO:0000725
GO:0004176
GO:0004252
GO:0006508
AF-A0A381YMY0-F1-model_v4 RecA family profile 1 domain-containing protein 0.986 59 455 GO:0000725
GO:0003684
GO:0005524
GO:0005829
GO:0016887
GO:0140664
AF-A0A381YMY0-F1-model_v4 RecA family profile 1 domain-containing protein 0.9835 59 455 GO:0000725
GO:0003684
GO:0005524
GO:0005829
GO:0016887
GO:0140664

Feature Viewer

pLDDT pTM Quality
87.24 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map