F443399

General Info

Members Datasets Scaffolds Average Seq Length
435 221 424 197

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0116365|Ga0495633_0116365_86_769
Length 227
Sequence MQSAVTTGCAGLPASDLESAPPTSAAAPAAADVHGSNLRHYIRTYDNNLPPELCSKLIASFDTLARFQQRNGRGVRAGLEDSAWTELDVSKLSDAGFLAFFRQQISQSLQRYNADVGLPIAVPDSPLLSPLILKRYRAGDEEKFQTHFDAINEVCDRYLVFLWYLNDVDEGGQTWFPGLQTGVAPRAGRLLMFPPYWMYAHQGQPSPRQDKYILSTYLRFPQRHSTP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221695 Lysobacter sp. Root494 Isolate Unclassified
3 2818991457 Xanthomonas translucens 569 Isolate Unclassified
4 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
5 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
6 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
7 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
8 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
182 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
183 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
184 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
215 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.32
Metatranscriptomes 1.38
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 1.15
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 6.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3442042 2162886007 Bacteria 10147
2 JGI24736J21556_1009121 3300001904 Bacteria 1641
3 JGI24741J21665_1000632 3300001915 Bacteria 10638
4 JGI24741J21665_1002161 3300001915 Bacteria 5228
5 JGI24740J21852_10001167 3300001979 Bacteria 11856
6 rootL2_10240384 3300003322 Bacteria 1349
7 Ga0058692_1000015 3300003856 Bacteria 295729
8 Ga0065704_10070532 3300005289 Bacteria 21492
9 Ga0065715_10019056 3300005293 Unclassified 1856
10 Ga0065715_10209302 3300005293 Bacteria 1322
11 Ga0065715_10459884 3300005293 Bacteria 815
12 Ga0070658_10047083 3300005327 Bacteria 3489
13 Ga0070658_10237015 3300005327 Bacteria 1546
14 Ga0070658_10449760 3300005327 Bacteria 1110
15 Ga0070658_10556109 3300005327 Unclassified 993
16 Ga0070676_10017708 3300005328 Bacteria 3943
17 Ga0070683_100005475 3300005329 Bacteria 10606
18 Ga0070683_100032471 3300005329 Bacteria 4754
19 Ga0070690_100428487 3300005330 Bacteria 977
20 Ga0070670_100001333 3300005331 Bacteria 19737
21 Ga0070670_100008483 3300005331 Bacteria 8765
22 Ga0070670_100365835 3300005331 Bacteria 1269
23 Ga0068869_100025888 3300005334 Bacteria 4078
24 Ga0070666_10103915 3300005335 Bacteria 1960
25 Ga0070666_10204701 3300005335 Bacteria 1389
26 Ga0070666_10241086 3300005335 Bacteria 1278
27 Ga0070680_100002255 3300005336 Bacteria 14244
28 Ga0070680_100005213 3300005336 Bacteria 9831
29 Ga0070680_100082029 3300005336 Bacteria 2661
30 Ga0070680_100488850 3300005336 Bacteria 1052
31 Ga0070682_100008925 3300005337 Bacteria 5663
32 Ga0070682_100630443 3300005337 Bacteria 851
33 Ga0068868_100036512 3300005338 Bacteria 3804
34 Ga0070660_100003577 3300005339 Bacteria 10725
35 Ga0070660_100029373 3300005339 Bacteria 4120
36 Ga0070660_100046969 3300005339 Bacteria 3311
37 Ga0070689_100168655 3300005340 Bacteria 1773
38 Ga0070691_10007485 3300005341 Bacteria 5008
39 Ga0070691_10013243 3300005341 Bacteria 3777
40 Ga0070661_100001391 3300005344 Bacteria 16915
41 Ga0070661_100022084 3300005344 Bacteria 4552
42 Ga0070661_100110674 3300005344 Bacteria 2051
43 Ga0070692_10000071 3300005345 Bacteria 20674
44 Ga0070692_10020071 3300005345 Bacteria 3235
45 Ga0070668_100377354 3300005347 Bacteria 1206
46 Ga0070669_100030901 3300005353 Bacteria 3866
47 Ga0070675_100031955 3300005354 Bacteria 4257
48 Ga0070675_100232495 3300005354 Bacteria 1608
49 Ga0070675_100259810 3300005354 Bacteria 1522
50 Ga0070671_100090168 3300005355 Bacteria 2566
51 Ga0070671_100212821 3300005355 Bacteria 1639
52 Ga0070671_100447270 3300005355 Bacteria 1108
53 Ga0070671_100643450 3300005355 Unclassified 918
54 Ga0070659_100006738 3300005366 Bacteria 8304
55 Ga0070659_100011558 3300005366 Bacteria 6533
56 Ga0070659_100138862 3300005366 Bacteria 1978
57 Ga0070667_100013113 3300005367 Bacteria 6852
58 Ga0070667_100028625 3300005367 Bacteria 4639
59 Ga0070667_100393734 3300005367 Bacteria 1260
60 Ga0070663_100003048 3300005455 Bacteria 9574
61 Ga0070663_100043559 3300005455 Bacteria 3159
62 Ga0070663_100054125 3300005455 Bacteria 2867
63 Ga0070678_100057190 3300005456 Unclassified 2856
64 Ga0070678_100073656 3300005456 Bacteria 2564
65 Ga0070662_100022746 3300005457 Bacteria 4295
66 Ga0070681_10001889 3300005458 Bacteria 18908
67 Ga0070681_10014339 3300005458 Bacteria 7887
68 Ga0070681_10585092 3300005458 Unclassified 1030
69 Ga0070681_10651630 3300005458 Bacteria 968
70 Ga0070679_100001282 3300005530 Bacteria 22205
71 Ga0070679_100009649 3300005530 Bacteria 9131
72 Ga0070679_100048734 3300005530 Bacteria 4220
73 Ga0070679_100601474 3300005530 Bacteria 1043
74 Ga0070684_100002977 3300005535 Bacteria 12606
75 Ga0070684_100015785 3300005535 Bacteria 6163
76 Ga0070684_100513202 3300005535 Unclassified 1111
77 Ga0068853_100003823 3300005539 Bacteria 11530
78 Ga0068853_100018524 3300005539 Bacteria 5765
79 Ga0068853_100110050 3300005539 Bacteria 2446
80 Ga0068853_100112765 3300005539 Unclassified 2416
81 Ga0068853_100271689 3300005539 Bacteria 1561
82 Ga0068853_100756982 3300005539 Unclassified 928
83 Ga0070672_100011899 3300005543 Bacteria 6083
84 Ga0070672_100098362 3300005543 Bacteria 2370
85 Ga0070696_100000453 3300005546 Bacteria 25648
86 Ga0070696_100010672 3300005546 Bacteria 6153
87 Ga0070696_100191970 3300005546 Bacteria 1521
88 Ga0070696_100270525 3300005546 Bacteria 1292
89 Ga0070693_100148195 3300005547 Bacteria 1483
90 Ga0070665_100002510 3300005548 Bacteria 20169
91 Ga0070665_100046217 3300005548 Bacteria 4373
92 Ga0070665_100297326 3300005548 Bacteria 1617
93 Ga0068855_100005848 3300005563 Bacteria 15017
94 Ga0068855_100021119 3300005563 Bacteria 7807
95 Ga0068855_100187878 3300005563 Bacteria 2332
96 Ga0068855_100465679 3300005563 Bacteria 1378
97 Ga0068855_100599106 3300005563 Bacteria 1188
98 Ga0070664_100017857 3300005564 Bacteria 5824
99 Ga0070664_100114284 3300005564 Bacteria 2358
100 Ga0070664_100659240 3300005564 Bacteria 973
101 Ga0068857_100012544 3300005577 Bacteria 7379
102 Ga0068857_100014953 3300005577 Bacteria 6769
103 Ga0068857_100274185 3300005577 Bacteria 1551
104 Ga0068857_100454728 3300005577 Bacteria 1197
105 Ga0068854_100005083 3300005578 Bacteria 8287
106 Ga0068854_100017416 3300005578 Bacteria 4808
107 Ga0068854_100387152 3300005578 Bacteria 1153
108 Ga0068856_100010653 3300005614 Bacteria 8935
109 Ga0068856_100029312 3300005614 Bacteria 5376
110 Ga0068856_100040993 3300005614 Bacteria 4549
111 Ga0068856_100084345 3300005614 Bacteria 3156
112 Ga0068856_100305740 3300005614 Bacteria 1608
113 Ga0068852_100002174 3300005616 Bacteria 13434
114 Ga0068852_100002947 3300005616 Bacteria 11827
115 Ga0068852_100033354 3300005616 Bacteria 4273
116 Ga0068852_100035680 3300005616 Bacteria 4151
117 Ga0068852_100109868 3300005616 Bacteria 2504
118 Ga0068852_100131447 3300005616 Bacteria 2306
119 Ga0068852_101461223 3300005616 Unclassified 706
120 Ga0068859_100057571 3300005617 Bacteria 3915
121 Ga0068859_100444290 3300005617 Bacteria 1393
122 Ga0068859_100493556 3300005617 Bacteria 1320
123 Ga0068859_100969741 3300005617 Bacteria 933
124 Ga0068864_100145158 3300005618 Bacteria 2144
125 Ga0068864_100879986 3300005618 Bacteria 884
126 Ga0068866_10361231 3300005718 Unclassified 926
127 Ga0068851_10001469 3300005834 Bacteria 10328
128 Ga0068851_10015366 3300005834 Bacteria 3647
129 Ga0068870_10108066 3300005840 Bacteria 1583
130 Ga0068863_100019924 3300005841 Bacteria 6416
131 Ga0068863_100764969 3300005841 Bacteria 962
132 Ga0068858_100000552 3300005842 Bacteria 39001
133 Ga0068860_100004492 3300005843 Bacteria 14229
134 Ga0068860_100251343 3300005843 Bacteria 1722
135 Ga0081455_10535998 3300005937 Bacteria 777
136 Ga0070716_100967727 3300006173 Bacteria 671
137 Ga0097621_100009209 3300006237 Bacteria 7161
138 Ga0097621_100065782 3300006237 Bacteria 2985
139 Ga0097621_100347879 3300006237 Bacteria 1318
140 Ga0097621_100684483 3300006237 Unclassified 943
141 Ga0068871_100013138 3300006358 Bacteria 6140
142 Ga0068871_100053448 3300006358 Bacteria 3274
143 Ga0068871_100289213 3300006358 Bacteria 1436
144 Ga0068871_100485756 3300006358 Bacteria 1111
145 Ga0068865_100033682 3300006881 Bacteria 3431
146 Ga0068865_100180157 3300006881 Bacteria 1627
147 Ga0097620_100057572 3300006931 Bacteria 3915
148 Ga0097620_100444340 3300006931 Bacteria 1393
149 Ga0097620_100493503 3300006931 Bacteria 1320
150 Ga0097620_100969795 3300006931 Bacteria 933
151 Ga0099794_10135049 3300007265 Bacteria 1247
152 Ga0105251_10000536 3300009011 Bacteria 35805
153 Ga0105240_10068734 3300009093 Bacteria 4387
154 Ga0105240_10097907 3300009093 Unclassified 3574
155 Ga0105243_10002553 3300009148 Bacteria 15212
156 Ga0105241_10085045 3300009174 Bacteria 2485
157 Ga0105241_10166592 3300009174 Bacteria 1816
158 Ga0105241_10446338 3300009174 Bacteria 1143
159 Ga0105242_10506915 3300009176 Bacteria 1149
160 Ga0105248_10188800 3300009177 Bacteria 2322
161 Ga0105237_10194541 3300009545 Bacteria 2027
162 Ga0105238_10030248 3300009551 Bacteria 5511
163 Ga0105238_10072049 3300009551 Bacteria 3452
164 Ga0105238_10197203 3300009551 Bacteria 1989
165 Ga0105249_10102680 3300009553 Bacteria 2692
166 Ga0105249_12178909 3300009553 Bacteria 627
167 Ga0105239_10387344 3300010375 Bacteria 1581
168 Ga0105239_11677591 3300010375 Bacteria 735
169 Ga0105246_10652219 3300011119 Unclassified 916
170 Ga0157373_10003813 3300013100 Bacteria 11400
171 Ga0157373_10006174 3300013100 Bacteria 8952
172 Ga0157373_10058160 3300013100 Bacteria 2741
173 Ga0157371_10004842 3300013102 Bacteria 11580
174 Ga0157371_10007372 3300013102 Bacteria 8912
175 Ga0157371_10007771 3300013102 Bacteria 8619
176 Ga0157371_10050130 3300013102 Bacteria 2966
177 Ga0157370_10006886 3300013104 Bacteria 12442
178 Ga0157370_10011762 3300013104 Bacteria 9137
179 Ga0157370_10066326 3300013104 Bacteria 3414
180 Ga0157370_10146851 3300013104 Bacteria 2195
181 Ga0157370_10150961 3300013104 Bacteria 2162
182 Ga0157369_10021635 3300013105 Bacteria 7192
183 Ga0157369_10036622 3300013105 Bacteria 5374
184 Ga0157369_10131816 3300013105 Bacteria 2648
185 Ga0157374_10069123 3300013296 Unclassified 3325
186 Ga0157374_10207822 3300013296 Bacteria 1919
187 Ga0157374_10290887 3300013296 Bacteria 1615
188 Ga0157374_10366370 3300013296 Bacteria 1434
189 Ga0157378_10000233 3300013297 Bacteria 54246
190 Ga0157378_10151700 3300013297 Bacteria 2160
191 Ga0157378_10384863 3300013297 Bacteria 1378
192 Ga0163162_10007447 3300013306 Bacteria 10644
193 Ga0163162_10521215 3300013306 Bacteria 1318
194 Ga0163162_10787164 3300013306 Unclassified 1069
195 Ga0157372_10007463 3300013307 Bacteria 11633
196 Ga0157372_10031785 3300013307 Bacteria 5783
197 Ga0157372_10071758 3300013307 Bacteria 3901
198 Ga0157372_10107380 3300013307 Bacteria 3194
199 Ga0157372_10234790 3300013307 Bacteria 2127
200 Ga0157372_10662469 3300013307 Bacteria 1215
201 Ga0157375_10119114 3300013308 Bacteria 2747
202 Ga0157375_10140551 3300013308 Bacteria 2541
203 Ga0157375_10156827 3300013308 Bacteria 2415
204 Ga0163163_10156096 3300014325 Bacteria 2326
205 Ga0157380_12241240 3300014326 Bacteria 610
206 Ga0157379_10013342 3300014968 Bacteria 7195
207 Ga0157376_10001465 3300014969 Bacteria 15554
208 Ga0157376_10034260 3300014969 Bacteria 4099
209 Ga0157376_10525990 3300014969 Bacteria 1166
210 Ga0157376_11521668 3300014969 Bacteria 702
211 Ga0182005_1001760 3300015265 Bacteria 8321
212 Ga0206356_11613719 3300020070 Bacteria 6497
213 Ga0206351_10308234 3300020077 Bacteria 1022
214 Ga0206354_10072639 3300020081 Bacteria 6149
215 Ga0206353_11599220 3300020082 Bacteria 1800
216 Ga0154015_1251617 3300020610 Bacteria 10886
217 Ga0224712_10001382 3300022467 Bacteria 5564
218 Ga0207656_10090172 3300025321 Bacteria 1390
219 Ga0207656_10118540 3300025321 Bacteria 1230
220 Ga0207713_1000324 3300025735 Bacteria 53955
221 Ga0207642_10125190 3300025899 Bacteria 1332
222 Ga0207680_10047252 3300025903 Bacteria 2550
223 Ga0207680_10345446 3300025903 Bacteria 1044
224 Ga0207647_10000019 3300025904 Bacteria 123924
225 Ga0207647_10000442 3300025904 Bacteria 33729
226 Ga0207647_10011322 3300025904 Bacteria 6261
227 Ga0207645_10016244 3300025907 Bacteria 4929
228 Ga0207643_10024381 3300025908 Bacteria 3338
229 Ga0207705_10002186 3300025909 Bacteria 15128
230 Ga0207705_10003179 3300025909 Bacteria 12503
231 Ga0207705_10161214 3300025909 Unclassified 1685
232 Ga0207654_10041304 3300025911 Bacteria 2604
233 Ga0207654_10520813 3300025911 Bacteria 842
234 Ga0207707_10001164 3300025912 Bacteria 24810
235 Ga0207707_10003566 3300025912 Bacteria 13794
236 Ga0207707_10004352 3300025912 Bacteria 12529
237 Ga0207695_10011397 3300025913 Bacteria 10777
238 Ga0207695_10014515 3300025913 Bacteria 9325
239 Ga0207695_10054886 3300025913 Bacteria 4157
240 Ga0207695_10077857 3300025913 Bacteria 3366
241 Ga0207671_10018898 3300025914 Bacteria 5280
242 Ga0207660_10000312 3300025917 Bacteria 31823
243 Ga0207660_10002295 3300025917 Bacteria 12602
244 Ga0207660_10002581 3300025917 Bacteria 11895
245 Ga0207660_10083502 3300025917 Unclassified 2352
246 Ga0207657_10004965 3300025919 Bacteria 14000
247 Ga0207657_10008129 3300025919 Bacteria 10697
248 Ga0207657_10215214 3300025919 Bacteria 1541
249 Ga0207649_10001019 3300025920 Bacteria 17288
250 Ga0207649_10007103 3300025920 Bacteria 6086
251 Ga0207652_10000107 3300025921 Bacteria 90283
252 Ga0207652_10002366 3300025921 Bacteria 15942
253 Ga0207652_10008235 3300025921 Bacteria 8374
254 Ga0207681_10036961 3300025923 Bacteria 3225
255 Ga0207694_10000266 3300025924 Bacteria 49793
256 Ga0207694_10032438 3300025924 Bacteria 3998
257 Ga0207650_10001182 3300025925 Bacteria 19170
258 Ga0207650_10014755 3300025925 Bacteria 5431
259 Ga0207650_10027910 3300025925 Bacteria 4043
260 Ga0207659_10080937 3300025926 Bacteria 2400
261 Ga0207659_10423951 3300025926 Bacteria 1116
262 Ga0207644_10176480 3300025931 Bacteria 1672
263 Ga0207644_10371642 3300025931 Bacteria 1165
264 Ga0207644_10593286 3300025931 Bacteria 919
265 Ga0207690_10007187 3300025932 Bacteria 6615
266 Ga0207690_10244811 3300025932 Bacteria 1383
267 Ga0207706_10004724 3300025933 Bacteria 12756
268 Ga0207686_10537363 3300025934 Unclassified 912
269 Ga0207709_10003927 3300025935 Bacteria 8682
270 Ga0207709_10008605 3300025935 Bacteria 5635
271 Ga0207670_10124406 3300025936 Bacteria 1880
272 Ga0207704_10011711 3300025938 Bacteria 4331
273 Ga0207704_10022921 3300025938 Bacteria 3355
274 Ga0207691_10036261 3300025940 Bacteria 4568
275 Ga0207689_10024958 3300025942 Bacteria 5010
276 Ga0207689_10547782 3300025942 Bacteria 971
277 Ga0207661_10003492 3300025944 Bacteria 10914
278 Ga0207661_10011184 3300025944 Bacteria 6491
279 Ga0207661_10663973 3300025944 Unclassified 958
280 Ga0207679_10013431 3300025945 Bacteria 5370
281 Ga0207679_10378586 3300025945 Bacteria 1240
282 Ga0207679_10847885 3300025945 Bacteria 834
283 Ga0207667_10003678 3300025949 Bacteria 18903
284 Ga0207667_10014455 3300025949 Bacteria 8999
285 Ga0207667_10266868 3300025949 Bacteria 1750
286 Ga0207667_10471305 3300025949 Bacteria 1275
287 Ga0207667_10510511 3300025949 Bacteria 1218
288 Ga0207651_10125612 3300025960 Bacteria 1954
289 Ga0207712_10000486 3300025961 Bacteria 33126
290 Ga0207668_10743058 3300025972 Bacteria 865
291 Ga0207640_10001732 3300025981 Bacteria 11712
292 Ga0207640_10009036 3300025981 Bacteria 5560
293 Ga0207640_10012609 3300025981 Bacteria 4820
294 Ga0207640_10520657 3300025981 Bacteria 994
295 Ga0207658_10009306 3300025986 Bacteria 6664
296 Ga0207658_10011358 3300025986 Bacteria 6060
297 Ga0207658_10291823 3300025986 Bacteria 1402
298 Ga0207677_10021594 3300026023 Bacteria 3936
299 Ga0207703_10000701 3300026035 Bacteria 33149
300 Ga0207639_10001380 3300026041 Bacteria 16391
301 Ga0207639_10006565 3300026041 Bacteria 7911
302 Ga0207639_10008792 3300026041 Bacteria 6940
303 Ga0207639_10013647 3300026041 Bacteria 5694
304 Ga0207678_10003117 3300026067 Bacteria 15006
305 Ga0207678_10005990 3300026067 Bacteria 10818
306 Ga0207678_10008095 3300026067 Bacteria 9270
307 Ga0207702_10003035 3300026078 Bacteria 15600
308 Ga0207702_10004943 3300026078 Bacteria 11712
309 Ga0207702_10057916 3300026078 Bacteria 3295
310 Ga0207702_10060962 3300026078 Bacteria 3216
311 Ga0207702_10712488 3300026078 Bacteria 989
312 Ga0207641_10134732 3300026088 Bacteria 2222
313 Ga0207641_10607446 3300026088 Unclassified 1071
314 Ga0207641_10752632 3300026088 Bacteria 962
315 Ga0207641_10802103 3300026088 Unclassified 931
316 Ga0207648_10090096 3300026089 Bacteria 2680
317 Ga0207648_10557718 3300026089 Unclassified 1053
318 Ga0207676_10676255 3300026095 Bacteria 998
319 Ga0207676_10906006 3300026095 Bacteria 865
320 Ga0207674_10004761 3300026116 Bacteria 16271
321 Ga0207674_10019174 3300026116 Bacteria 7417
322 Ga0207674_10112992 3300026116 Bacteria 2689
323 Ga0207674_10278376 3300026116 Bacteria 1621
324 Ga0207675_100700341 3300026118 Bacteria 1022
325 Ga0207683_10015238 3300026121 Bacteria 6542
326 Ga0207683_10041793 3300026121 Unclassified 4004
327 Ga0207698_10004636 3300026142 Bacteria 8397
328 Ga0207698_10008934 3300026142 Bacteria 6356
329 Ga0207698_10024988 3300026142 Bacteria 4200
330 Ga0207698_10026079 3300026142 Bacteria 4130
331 Ga0207698_10165078 3300026142 Bacteria 1942
332 Ga0207698_11000792 3300026142 Bacteria 846
333 Ga0209371_1000011 3300027312 Bacteria 848456
334 Ga0209371_1000156 3300027312 Bacteria 106826
335 Ga0209974_10046226 3300027876 Bacteria 1455
336 Ga0268266_10000007 3300028379 Bacteria 1372921
337 Ga0268266_10148675 3300028379 Unclassified 2109
338 Ga0268266_10198143 3300028379 Bacteria 1837
339 Ga0268266_10207635 3300028379 Bacteria 1795
340 Ga0268264_10056069 3300028381 Bacteria 3293
341 Ga0265319_1003167 3300028563 Bacteria 8669
342 Ga0265334_10012762 3300028573 Unclassified 3525
343 Ga0265318_10006638 3300028577 Bacteria 5309
344 Ga0265338_10041559 3300028800 Bacteria 4298
345 Ga0268256_1000011 3300030500 Bacteria 848625
346 Ga0268256_1000130 3300030500 Bacteria 106825
347 Ga0265330_10001827 3300031235 Bacteria 11892
348 Ga0265332_10002417 3300031238 Bacteria 9534
349 Ga0265329_10008494 3300031242 Unclassified 3890
350 Ga0265340_10237841 3300031247 Bacteria 813
351 Ga0265331_10013116 3300031250 Bacteria 4464
352 Ga0265316_10041452 3300031344 Unclassified 3684
353 Ga0307509_10000738 3300031507 Bacteria 55991
354 Ga0307408_100432544 3300031548 Bacteria 1137
355 Ga0265313_10005094 3300031595 Bacteria 9788
356 Ga0265314_10031565 3300031711 Unclassified 3907
357 Ga0265342_10027474 3300031712 Bacteria 3555
358 Ga0307413_10382834 3300031824 Bacteria 1097
359 Ga0307416_100156777 3300032002 Bacteria 2097
360 Ga0307416_100286422 3300032002 Bacteria 1628
361 Ga0307414_10019827 3300032004 Bacteria 4177
362 Ga0307411_10055496 3300032005 Bacteria 2606
363 Ga0307415_100363850 3300032126 Bacteria 1222
364 Ga0373933_0231772 3300035724 Unclassified 1186
365 Ga0373937_0748867 3300036401 Unclassified 924
366 Ga0395900_0000064 3300037418 Bacteria 198757
367 Ga0395900_0001994 3300037418 Bacteria 23053
368 Ga0395900_1185612 3300037418 Bacteria 679
369 Ga0395898_0029882 3300037466 Bacteria 5455
370 Ga0395898_0516836 3300037466 Bacteria 1135
371 Ga0395905_0001056 3300037471 Bacteria 34822
372 Ga0395901_0028516 3300038443 Bacteria 5741
373 Ga0439436_0018573 3300041404 Bacteria 2079
374 Ga0451787_151239 3300041441 Bacteria 774
375 Ga0451837_0684292 3300041494 Bacteria 7474
376 Ga0451843_0211868 3300041509 Bacteria 4970
377 Ga0451843_0586500 3300041509 Bacteria 1880
378 Ga0451855_0185675 3300041511 Bacteria 740
379 Ga0451853_4101910 3300041512 Bacteria 1497
380 Ga0439445_0001543 3300042004 Bacteria 5011
381 Ga0466972_0000253 3300044658 Bacteria 35854
382 Ga0466970_0000329 3300044765 Bacteria 23124
383 Ga0466959_0054484 3300045049 Bacteria 2921
384 Ga0495663_0005929 3300046525 Bacteria 3384
385 Ga0495598_0016328 3300046537 Bacteria 1892
386 Ga0495633_0116365 3300046558 Bacteria 1239
387 Ga0496102_0021315 3300048905 Bacteria 5731
388 Ga0496103_0060425 3300048906 Bacteria 2356
389 Ga0496104_0034697 3300048907 Bacteria 4706
390 Ga0496109_0427345 3300048912 Unclassified 1251
391 Ga0496117_0000969 3300048920 Bacteria 43962
392 Ga0496117_0047840 3300048920 Bacteria 3062
393 Ga0496117_0095733 3300048920 Unclassified 1896
394 Ga0496118_0001504 3300048921 Bacteria 34752
395 Ga0496118_0008893 3300048921 Bacteria 10263
396 Ga0496118_0018490 3300048921 Bacteria 6286
397 Ga0496118_0039590 3300048921 Bacteria 3758
398 Ga0496118_0304310 3300048921 Bacteria 873
399 Ga0496119_0001305 3300048922 Bacteria 30794
400 Ga0496120_0000561 3300048923 Bacteria 56621
401 Ga0496122_0000874 3300048925 Bacteria 56703
402 Ga0496123_0000461 3300048926 Bacteria 71380
403 Ga0496123_0000702 3300048926 Bacteria 54737
404 Ga0496124_0002292 3300048927 Bacteria 25301
405 Ga0496125_0024292 3300048928 Bacteria 5576
406 Ga0496126_0020798 3300048929 Bacteria 6424
407 Ga0496126_0044779 3300048929 Bacteria 4072
408 Ga0501033_0037665 3300049570 Unclassified 3619
409 Ga0501036_0068720 3300049572 Bacteria 2998
410 Ga0501038_0271770 3300049574 Bacteria 1336
411 Ga0501047_0071633 3300049581 Unclassified 3336
412 Ga0501069_0007675 3300049585 Bacteria 5661
413 Ga0501070_0003311 3300049586 Bacteria 13992
414 Ga0501070_0761766 3300049586 Unclassified 762
415 Ga0501073_0026450 3300049589 Unclassified 4158
416 Ga0501074_0001867 3300049590 Bacteria 14450
417 Ga0501201_010759 3300049651 Bacteria 899
418 Ga0501239_005365 3300049672 Bacteria 1290
419 Ga0501225_0065901 3300049705 Bacteria 1024
420 Ga0501080_0003234 3300049742 Bacteria 14375
421 Ga0501269_017243 3300049766 Bacteria 893
422 Ga0501035_0005737 3300049822 Bacteria 11711
423 Ga0501044_0003319 3300049823 Bacteria 18129
424 Ga0500651_0000154 3300053093 Bacteria 43979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10387344 Ga0105239_103873442 161
2 3300009553 Ga0105249_12178909 Ga0105249_121789091 164
3 3300005614 Ga0068856_100010653 Ga0068856_1000106532 169
4 3300026078 Ga0207702_10003035 Ga0207702_100030358 169
5 3300001915 JGI24741J21665_1000632 JGI24741J21665_10006325 170
6 3300005336 Ga0070680_100002255 Ga0070680_1000022554 171
7 3300005458 Ga0070681_10001889 Ga0070681_100018897 171
8 3300005530 Ga0070679_100001282 Ga0070679_1000012828 171
9 3300025912 Ga0207707_10001164 Ga0207707_100011648 171
10 3300025917 Ga0207660_10000312 Ga0207660_1000031219 171
11 3300025921 Ga0207652_10000107 Ga0207652_1000010739 171
12 3300025944 Ga0207661_10663973 Ga0207661_106639732 171
13 3300037418 Ga0395900_1185612 Ga0395900_1185612_138_653 171
14 3300049574 Ga0501038_0271770 Ga0501038_0271770_751_1299 181
15 iso_pu_bacteria 2818991457 2819660767 184
16 iso_pu_bacteria 2852684882 2852686636 184
17 iso_pu_bacteria 2919130084 2919132621 184
18 iso_pu_bacteria 2929195423 2929196791 184
19 3300005336 Ga0070680_100082029 Ga0070680_1000820292 185
20 3300005339 Ga0070660_100046969 Ga0070660_1000469693 185
21 3300005366 Ga0070659_100138862 Ga0070659_1001388622 185
22 3300005458 Ga0070681_10651630 Ga0070681_106516302 185
23 3300005530 Ga0070679_100048734 Ga0070679_1000487343 185
24 3300005564 Ga0070664_100114284 Ga0070664_1001142842 185
25 3300005614 Ga0068856_100305740 Ga0068856_1003057402 185
26 3300013102 Ga0157371_10050130 Ga0157371_100501302 185
27 3300013297 Ga0157378_10384863 Ga0157378_103848632 185
28 3300013307 Ga0157372_10234790 Ga0157372_102347902 185
29 3300025932 Ga0207690_10244811 Ga0207690_102448111 185
30 3300026078 Ga0207702_10712488 Ga0207702_107124882 185
31 3300032004 Ga0307414_10019827 Ga0307414_100198273 185
32 3300032005 Ga0307411_10055496 Ga0307411_100554962 185
33 3300035724 Ga0373933_0231772 Ga0373933_0231772_213_800 185
34 3300036401 Ga0373937_0748867 Ga0373937_0748867_197_784 185
35 3300041404 Ga0439436_0018573 Ga0439436_0018573_1259_1837 185
36 3300048912 Ga0496109_0427345 Ga0496109_0427345_484_1041 185
37 3300049651 Ga0501201_010759 Ga0501201_010759_201_803 185
38 3300049705 Ga0501225_0065901 Ga0501225_0065901_259_861 185
39 3300049766 Ga0501269_017243 Ga0501269_017243_15_587 185
40 iso_pu_bacteria 2643221695 2644530346 185
41 iso_pu_bacteria 2895395659 2895397431 185
42 3300005293 Ga0065715_10019056 Ga0065715_100190562 186
43 3300005293 Ga0065715_10209302 Ga0065715_102093022 186
44 3300005293 Ga0065715_10459884 Ga0065715_104598842 186
45 3300005327 Ga0070658_10237015 Ga0070658_102370152 186
46 3300005327 Ga0070658_10449760 Ga0070658_104497602 186
47 3300005328 Ga0070676_10017708 Ga0070676_100177082 186
48 3300005330 Ga0070690_100428487 Ga0070690_1004284872 186
49 3300005331 Ga0070670_100008483 Ga0070670_1000084831 186
50 3300005331 Ga0070670_100365835 Ga0070670_1003658352 186
51 3300005334 Ga0068869_100025888 Ga0068869_1000258883 186
52 3300005335 Ga0070666_10103915 Ga0070666_101039152 186
53 3300005335 Ga0070666_10204701 Ga0070666_102047012 186
54 3300005335 Ga0070666_10241086 Ga0070666_102410862 186
55 3300005338 Ga0068868_100036512 Ga0068868_1000365123 186
56 3300005340 Ga0070689_100168655 Ga0070689_1001686552 186
57 3300005344 Ga0070661_100110674 Ga0070661_1001106742 186
58 3300005347 Ga0070668_100377354 Ga0070668_1003773542 186
59 3300005353 Ga0070669_100030901 Ga0070669_1000309013 186
60 3300005354 Ga0070675_100031955 Ga0070675_1000319553 186
61 3300005354 Ga0070675_100232495 Ga0070675_1002324952 186
62 3300005354 Ga0070675_100259810 Ga0070675_1002598102 186
63 3300005355 Ga0070671_100090168 Ga0070671_1000901681 186
64 3300005355 Ga0070671_100212821 Ga0070671_1002128212 186
65 3300005355 Ga0070671_100447270 Ga0070671_1004472702 186
66 3300005355 Ga0070671_100643450 Ga0070671_1006434501 186
67 3300005367 Ga0070667_100013113 Ga0070667_1000131132 186
68 3300005367 Ga0070667_100028625 Ga0070667_1000286252 186
69 3300005367 Ga0070667_100393734 Ga0070667_1003937342 186
70 3300005455 Ga0070663_100054125 Ga0070663_1000541252 186
71 3300005456 Ga0070678_100057190 Ga0070678_1000571902 186
72 3300005456 Ga0070678_100073656 Ga0070678_1000736562 186
73 3300005457 Ga0070662_100022746 Ga0070662_1000227464 186
74 3300005458 Ga0070681_10585092 Ga0070681_105850921 186
75 3300005530 Ga0070679_100601474 Ga0070679_1006014742 186
76 3300005535 Ga0070684_100513202 Ga0070684_1005132022 186
77 3300005539 Ga0068853_100112765 Ga0068853_1001127652 186
78 3300005539 Ga0068853_100756982 Ga0068853_1007569821 186
79 3300005543 Ga0070672_100011899 Ga0070672_1000118995 186
80 3300005543 Ga0070672_100098362 Ga0070672_1000983622 186
81 3300005547 Ga0070693_100148195 Ga0070693_1001481952 186
82 3300005548 Ga0070665_100002510 Ga0070665_1000025103 186
83 3300005548 Ga0070665_100046217 Ga0070665_1000462172 186
84 3300005563 Ga0068855_100187878 Ga0068855_1001878782 186
85 3300005563 Ga0068855_100465679 Ga0068855_1004656792 186
86 3300005563 Ga0068855_100599106 Ga0068855_1005991062 186
87 3300005564 Ga0070664_100659240 Ga0070664_1006592402 186
88 3300005577 Ga0068857_100274185 Ga0068857_1002741852 186
89 3300005577 Ga0068857_100454728 Ga0068857_1004547282 186
90 3300005578 Ga0068854_100017416 Ga0068854_1000174161 186
91 3300005578 Ga0068854_100387152 Ga0068854_1003871522 186
92 3300005614 Ga0068856_100029312 Ga0068856_1000293123 186
93 3300005616 Ga0068852_100109868 Ga0068852_1001098682 186
94 3300005616 Ga0068852_100131447 Ga0068852_1001314472 186
95 3300005616 Ga0068852_101461223 Ga0068852_1014612232 186
96 3300005617 Ga0068859_100444290 Ga0068859_1004442902 186
97 3300005617 Ga0068859_100493556 Ga0068859_1004935562 186
98 3300005617 Ga0068859_100969741 Ga0068859_1009697412 186
99 3300005618 Ga0068864_100145158 Ga0068864_1001451581 186
100 3300005718 Ga0068866_10361231 Ga0068866_103612312 186
101 3300005834 Ga0068851_10001469 Ga0068851_100014694 186
102 3300005840 Ga0068870_10108066 Ga0068870_101080662 186
103 3300005841 Ga0068863_100764969 Ga0068863_1007649691 186
104 3300005842 Ga0068858_100000552 Ga0068858_10000055226 186
105 3300005843 Ga0068860_100004492 Ga0068860_1000044928 186
106 3300005843 Ga0068860_100251343 Ga0068860_1002513432 186
107 3300006173 Ga0070716_100967727 Ga0070716_1009677271 186
108 3300006237 Ga0097621_100009209 Ga0097621_1000092094 186
109 3300006237 Ga0097621_100684483 Ga0097621_1006844831 186
110 3300006358 Ga0068871_100289213 Ga0068871_1002892132 186
111 3300006358 Ga0068871_100485756 Ga0068871_1004857562 186
112 3300006881 Ga0068865_100033682 Ga0068865_1000336822 186
113 3300006881 Ga0068865_100180157 Ga0068865_1001801572 186
114 3300006931 Ga0097620_100444340 Ga0097620_1004443402 186
115 3300006931 Ga0097620_100493503 Ga0097620_1004935032 186
116 3300006931 Ga0097620_100969795 Ga0097620_1009697952 186
117 3300009174 Ga0105241_10085045 Ga0105241_100850452 186
118 3300009174 Ga0105241_10166592 Ga0105241_101665922 186
119 3300009176 Ga0105242_10506915 Ga0105242_105069152 186
120 3300009177 Ga0105248_10188800 Ga0105248_101888002 186
121 3300009545 Ga0105237_10194541 Ga0105237_101945412 186
122 3300009551 Ga0105238_10030248 Ga0105238_100302484 186
123 3300009553 Ga0105249_10102680 Ga0105249_101026802 186
124 3300010375 Ga0105239_11677591 Ga0105239_116775911 186
125 3300011119 Ga0105246_10652219 Ga0105246_106522192 186
126 3300013100 Ga0157373_10006174 Ga0157373_100061747 186
127 3300013102 Ga0157371_10007771 Ga0157371_100077716 186
128 3300013104 Ga0157370_10146851 Ga0157370_101468512 186
129 3300013104 Ga0157370_10150961 Ga0157370_101509612 186
130 3300013105 Ga0157369_10131816 Ga0157369_101318162 186
131 3300013296 Ga0157374_10069123 Ga0157374_100691233 186
132 3300013296 Ga0157374_10207822 Ga0157374_102078222 186
133 3300013296 Ga0157374_10366370 Ga0157374_103663702 186
134 3300013306 Ga0163162_10007447 Ga0163162_100074473 186
135 3300013306 Ga0163162_10521215 Ga0163162_105212152 186
136 3300013306 Ga0163162_10787164 Ga0163162_107871642 186
137 3300013307 Ga0157372_10071758 Ga0157372_100717582 186
138 3300013308 Ga0157375_10119114 Ga0157375_101191142 186
139 3300013308 Ga0157375_10140551 Ga0157375_101405512 186
140 3300014325 Ga0163163_10156096 Ga0163163_101560962 186
141 3300014326 Ga0157380_12241240 Ga0157380_122412401 186
142 3300014968 Ga0157379_10013342 Ga0157379_100133422 186
143 3300014969 Ga0157376_10001465 Ga0157376_100014653 186
144 3300014969 Ga0157376_10525990 Ga0157376_105259902 186
145 3300014969 Ga0157376_11521668 Ga0157376_115216681 186
146 3300025321 Ga0207656_10090172 Ga0207656_100901721 186
147 3300025899 Ga0207642_10125190 Ga0207642_101251902 186
148 3300025903 Ga0207680_10047252 Ga0207680_100472522 186
149 3300025903 Ga0207680_10345446 Ga0207680_103454462 186
150 3300025904 Ga0207647_10000019 Ga0207647_1000001925 186
151 3300025907 Ga0207645_10016244 Ga0207645_100162442 186
152 3300025908 Ga0207643_10024381 Ga0207643_100243812 186
153 3300025911 Ga0207654_10041304 Ga0207654_100413042 186
154 3300025913 Ga0207695_10054886 Ga0207695_100548863 186
155 3300025914 Ga0207671_10018898 Ga0207671_100188985 186
156 3300025919 Ga0207657_10215214 Ga0207657_102152142 186
157 3300025923 Ga0207681_10036961 Ga0207681_100369613 186
158 3300025924 Ga0207694_10000266 Ga0207694_1000026632 186
159 3300025925 Ga0207650_10014755 Ga0207650_100147554 186
160 3300025925 Ga0207650_10027910 Ga0207650_100279102 186
161 3300025926 Ga0207659_10080937 Ga0207659_100809372 186
162 3300025926 Ga0207659_10423951 Ga0207659_104239512 186
163 3300025931 Ga0207644_10176480 Ga0207644_101764802 186
164 3300025931 Ga0207644_10371642 Ga0207644_103716422 186
165 3300025931 Ga0207644_10593286 Ga0207644_105932862 186
166 3300025933 Ga0207706_10004724 Ga0207706_100047243 186
167 3300025934 Ga0207686_10537363 Ga0207686_105373632 186
168 3300025936 Ga0207670_10124406 Ga0207670_101244062 186
169 3300025938 Ga0207704_10011711 Ga0207704_100117112 186
170 3300025938 Ga0207704_10022921 Ga0207704_100229213 186
171 3300025940 Ga0207691_10036261 Ga0207691_100362613 186
172 3300025942 Ga0207689_10024958 Ga0207689_100249582 186
173 3300025942 Ga0207689_10547782 Ga0207689_105477822 186
174 3300025945 Ga0207679_10378586 Ga0207679_103785861 186
175 3300025945 Ga0207679_10847885 Ga0207679_108478852 186
176 3300025949 Ga0207667_10266868 Ga0207667_102668682 186
177 3300025949 Ga0207667_10471305 Ga0207667_104713052 186
178 3300025949 Ga0207667_10510511 Ga0207667_105105112 186
179 3300025960 Ga0207651_10125612 Ga0207651_101256122 186
180 3300025961 Ga0207712_10000486 Ga0207712_1000048621 186
181 3300025972 Ga0207668_10743058 Ga0207668_107430581 186
182 3300025981 Ga0207640_10012609 Ga0207640_100126095 186
183 3300025981 Ga0207640_10520657 Ga0207640_105206571 186
184 3300025986 Ga0207658_10009306 Ga0207658_100093064 186
185 3300025986 Ga0207658_10011358 Ga0207658_100113584 186
186 3300025986 Ga0207658_10291823 Ga0207658_102918232 186
187 3300026023 Ga0207677_10021594 Ga0207677_100215943 186
188 3300026035 Ga0207703_10000701 Ga0207703_1000070123 186
189 3300026041 Ga0207639_10001380 Ga0207639_100013805 186
190 3300026067 Ga0207678_10008095 Ga0207678_100080958 186
191 3300026078 Ga0207702_10057916 Ga0207702_100579163 186
192 3300026088 Ga0207641_10607446 Ga0207641_106074461 186
193 3300026088 Ga0207641_10752632 Ga0207641_107526321 186
194 3300026088 Ga0207641_10802103 Ga0207641_108021032 186
195 3300026089 Ga0207648_10090096 Ga0207648_100900962 186
196 3300026089 Ga0207648_10557718 Ga0207648_105577182 186
197 3300026095 Ga0207676_10906006 Ga0207676_109060061 186
198 3300026116 Ga0207674_10112992 Ga0207674_101129924 186
199 3300026116 Ga0207674_10278376 Ga0207674_102783762 186
200 3300026118 Ga0207675_100700341 Ga0207675_1007003412 186
201 3300026121 Ga0207683_10015238 Ga0207683_100152383 186
202 3300026121 Ga0207683_10041793 Ga0207683_100417932 186
203 3300026142 Ga0207698_10165078 Ga0207698_101650782 186
204 3300026142 Ga0207698_11000792 Ga0207698_110007921 186
205 3300027876 Ga0209974_10046226 Ga0209974_100462262 186
206 3300028379 Ga0268266_10000007 Ga0268266_10000007543 186
207 3300028379 Ga0268266_10148675 Ga0268266_101486752 186
208 3300028379 Ga0268266_10198143 Ga0268266_101981432 186
209 3300028379 Ga0268266_10207635 Ga0268266_102076352 186
210 3300028381 Ga0268264_10056069 Ga0268264_100560692 186
211 3300031507 Ga0307509_10000738 Ga0307509_1000073823 186
212 3300031548 Ga0307408_100432544 Ga0307408_1004325442 186
213 3300031824 Ga0307413_10382834 Ga0307413_103828342 186
214 3300032002 Ga0307416_100156777 Ga0307416_1001567771 186
215 3300032002 Ga0307416_100286422 Ga0307416_1002864222 186
216 3300032126 Ga0307415_100363850 Ga0307415_1003638502 186
217 3300037466 Ga0395898_0516836 Ga0395898_0516836_166_729 186
218 3300037471 Ga0395905_0001056 Ga0395905_0001056_27946_28509 186
219 3300038443 Ga0395901_0028516 Ga0395901_0028516_3433_3996 186
220 3300041441 Ga0451787_151239 Ga0451787_151239_55_660 186
221 3300044658 Ga0466972_0000253 Ga0466972_0000253_28847_29467 186
222 3300044765 Ga0466970_0000329 Ga0466970_0000329_2748_3368 186
223 3300045049 Ga0466959_0054484 Ga0466959_0054484_1885_2505 186
224 3300046537 Ga0495598_0016328 Ga0495598_0016328_56_616 186
225 3300048905 Ga0496102_0021315 Ga0496102_0021315_315_914 186
226 3300048906 Ga0496103_0060425 Ga0496103_0060425_197_796 186
227 3300048920 Ga0496117_0047840 Ga0496117_0047840_1647_2270 186
228 3300048920 Ga0496117_0095733 Ga0496117_0095733_904_1503 186
229 3300048921 Ga0496118_0001504 Ga0496118_0001504_27607_28230 186
230 3300048921 Ga0496118_0008893 Ga0496118_0008893_1961_2560 186
231 3300049672 Ga0501239_005365 Ga0501239_005365_251_886 186
232 iso_pu_bacteria 2852684882 2852688512 186
233 iso_pu_bacteria 2919130084 2919133856 186
234 iso_pu_bacteria 2929195423 2929199855 186
235 iso_pu_bacteria 2987605356 2987607991 186
236 3300005539 Ga0068853_100271689 Ga0068853_1002716892 187
237 3300005616 Ga0068852_100002174 Ga0068852_10000217410 187
238 3300026142 Ga0207698_10026079 Ga0207698_100260795 187
239 3300041509 Ga0451843_0211868 Ga0451843_0211868_3221_3838 187
240 3300041509 Ga0451843_0586500 Ga0451843_0586500_405_1046 187
241 3300042004 Ga0439445_0001543 Ga0439445_0001543_884_1471 187
242 3300046525 Ga0495663_0005929 Ga0495663_0005929_717_1400 187
243 3300046558 Ga0495633_0116365 Ga0495633_0116365_86_769 187
244 3300048926 Ga0496123_0000702 Ga0496123_0000702_19656_20339 187
245 2162886007 SwRhRL2b_contig_3442042 SwRhRL2b_0807.00005180 188
246 3300001904 JGI24736J21556_1009121 JGI24736J21556_10091212 188
247 3300001915 JGI24741J21665_1002161 JGI24741J21665_10021612 188
248 3300001979 JGI24740J21852_10001167 JGI24740J21852_100011678 188
249 3300003322 rootL2_10240384 rootL2_102403842 188
250 3300003856 Ga0058692_1000015 Ga0058692_1000015183 188
251 3300005289 Ga0065704_10070532 Ga0065704_1007053212 188
252 3300005327 Ga0070658_10047083 Ga0070658_100470833 188
253 3300005327 Ga0070658_10556109 Ga0070658_105561091 188
254 3300005329 Ga0070683_100005475 Ga0070683_1000054753 188
255 3300005329 Ga0070683_100032471 Ga0070683_1000324713 188
256 3300005331 Ga0070670_100001333 Ga0070670_1000013335 188
257 3300005336 Ga0070680_100005213 Ga0070680_1000052135 188
258 3300005336 Ga0070680_100488850 Ga0070680_1004888501 188
259 3300005337 Ga0070682_100008925 Ga0070682_1000089252 188
260 3300005337 Ga0070682_100630443 Ga0070682_1006304431 188
261 3300005339 Ga0070660_100003577 Ga0070660_1000035778 188
262 3300005339 Ga0070660_100029373 Ga0070660_1000293732 188
263 3300005341 Ga0070691_10007485 Ga0070691_100074855 188
264 3300005341 Ga0070691_10013243 Ga0070691_100132432 188
265 3300005344 Ga0070661_100001391 Ga0070661_1000013916 188
266 3300005344 Ga0070661_100022084 Ga0070661_1000220842 188
267 3300005345 Ga0070692_10000071 Ga0070692_100000718 188
268 3300005345 Ga0070692_10020071 Ga0070692_100200712 188
269 3300005366 Ga0070659_100006738 Ga0070659_1000067383 188
270 3300005366 Ga0070659_100011558 Ga0070659_1000115583 188
271 3300005455 Ga0070663_100003048 Ga0070663_1000030487 188
272 3300005455 Ga0070663_100043559 Ga0070663_1000435592 188
273 3300005458 Ga0070681_10014339 Ga0070681_100143395 188
274 3300005530 Ga0070679_100009649 Ga0070679_1000096493 188
275 3300005535 Ga0070684_100002977 Ga0070684_1000029774 188
276 3300005535 Ga0070684_100015785 Ga0070684_1000157853 188
277 3300005539 Ga0068853_100003823 Ga0068853_1000038234 188
278 3300005539 Ga0068853_100018524 Ga0068853_1000185242 188
279 3300005539 Ga0068853_100110050 Ga0068853_1001100502 188
280 3300005546 Ga0070696_100000453 Ga0070696_1000004533 188
281 3300005546 Ga0070696_100010672 Ga0070696_1000106722 188
282 3300005546 Ga0070696_100191970 Ga0070696_1001919702 188
283 3300005546 Ga0070696_100270525 Ga0070696_1002705252 188
284 3300005548 Ga0070665_100297326 Ga0070665_1002973262 188
285 3300005563 Ga0068855_100005848 Ga0068855_1000058485 188
286 3300005563 Ga0068855_100021119 Ga0068855_1000211193 188
287 3300005564 Ga0070664_100017857 Ga0070664_1000178572 188
288 3300005577 Ga0068857_100012544 Ga0068857_1000125445 188
289 3300005577 Ga0068857_100014953 Ga0068857_1000149532 188
290 3300005578 Ga0068854_100005083 Ga0068854_1000050836 188
291 3300005614 Ga0068856_100040993 Ga0068856_1000409932 188
292 3300005614 Ga0068856_100084345 Ga0068856_1000843453 188
293 3300005616 Ga0068852_100002947 Ga0068852_1000029476 188
294 3300005616 Ga0068852_100033354 Ga0068852_1000333543 188
295 3300005616 Ga0068852_100035680 Ga0068852_1000356804 188
296 3300005617 Ga0068859_100057571 Ga0068859_1000575712 188
297 3300005618 Ga0068864_100879986 Ga0068864_1008799862 188
298 3300005834 Ga0068851_10015366 Ga0068851_100153662 188
299 3300005841 Ga0068863_100019924 Ga0068863_1000199242 188
300 3300005937 Ga0081455_10535998 Ga0081455_105359981 188
301 3300006237 Ga0097621_100065782 Ga0097621_1000657822 188
302 3300006237 Ga0097621_100347879 Ga0097621_1003478792 188
303 3300006358 Ga0068871_100013138 Ga0068871_1000131384 188
304 3300006358 Ga0068871_100053448 Ga0068871_1000534483 188
305 3300006931 Ga0097620_100057572 Ga0097620_1000575722 188
306 3300007265 Ga0099794_10135049 Ga0099794_101350492 188
307 3300009011 Ga0105251_10000536 Ga0105251_1000053625 188
308 3300009093 Ga0105240_10068734 Ga0105240_100687343 188
309 3300009093 Ga0105240_10097907 Ga0105240_100979072 188
310 3300009148 Ga0105243_10002553 Ga0105243_100025533 188
311 3300009174 Ga0105241_10446338 Ga0105241_104463382 188
312 3300009551 Ga0105238_10072049 Ga0105238_100720492 188
313 3300009551 Ga0105238_10197203 Ga0105238_101972032 188
314 3300013100 Ga0157373_10003813 Ga0157373_100038134 188
315 3300013100 Ga0157373_10058160 Ga0157373_100581602 188
316 3300013102 Ga0157371_10004842 Ga0157371_100048428 188
317 3300013102 Ga0157371_10007372 Ga0157371_100073725 188
318 3300013104 Ga0157370_10006886 Ga0157370_100068865 188
319 3300013104 Ga0157370_10011762 Ga0157370_100117623 188
320 3300013104 Ga0157370_10066326 Ga0157370_100663262 188
321 3300013105 Ga0157369_10021635 Ga0157369_100216354 188
322 3300013105 Ga0157369_10036622 Ga0157369_100366223 188
323 3300013296 Ga0157374_10290887 Ga0157374_102908872 188
324 3300013297 Ga0157378_10000233 Ga0157378_1000023323 188
325 3300013297 Ga0157378_10151700 Ga0157378_101517002 188
326 3300013307 Ga0157372_10007463 Ga0157372_100074638 188
327 3300013307 Ga0157372_10031785 Ga0157372_100317854 188
328 3300013307 Ga0157372_10107380 Ga0157372_101073802 188
329 3300013307 Ga0157372_10662469 Ga0157372_106624692 188
330 3300013308 Ga0157375_10156827 Ga0157375_101568272 188
331 3300014969 Ga0157376_10034260 Ga0157376_100342603 188
332 3300015265 Ga0182005_1001760 Ga0182005_10017605 188
333 3300020070 Ga0206356_11613719 Ga0206356_116137195 188
334 3300020077 Ga0206351_10308234 Ga0206351_103082341 188
335 3300020081 Ga0206354_10072639 Ga0206354_100726395 188
336 3300020082 Ga0206353_11599220 Ga0206353_115992202 188
337 3300020610 Ga0154015_1251617 Ga0154015_12516178 188
338 3300022467 Ga0224712_10001382 Ga0224712_100013822 188
339 3300025321 Ga0207656_10118540 Ga0207656_101185402 188
340 3300025735 Ga0207713_1000324 Ga0207713_100032425 188
341 3300025904 Ga0207647_10000442 Ga0207647_100004429 188
342 3300025904 Ga0207647_10011322 Ga0207647_100113223 188
343 3300025909 Ga0207705_10002186 Ga0207705_100021866 188
344 3300025909 Ga0207705_10003179 Ga0207705_100031794 188
345 3300025909 Ga0207705_10161214 Ga0207705_101612142 188
346 3300025911 Ga0207654_10520813 Ga0207654_105208132 188
347 3300025912 Ga0207707_10003566 Ga0207707_100035663 188
348 3300025912 Ga0207707_10004352 Ga0207707_100043524 188
349 3300025913 Ga0207695_10011397 Ga0207695_100113973 188
350 3300025913 Ga0207695_10014515 Ga0207695_100145155 188
351 3300025913 Ga0207695_10077857 Ga0207695_100778573 188
352 3300025917 Ga0207660_10002295 Ga0207660_100022953 188
353 3300025917 Ga0207660_10002581 Ga0207660_100025813 188
354 3300025917 Ga0207660_10083502 Ga0207660_100835021 188
355 3300025919 Ga0207657_10004965 Ga0207657_100049654 188
356 3300025919 Ga0207657_10008129 Ga0207657_100081293 188
357 3300025920 Ga0207649_10001019 Ga0207649_100010194 188
358 3300025920 Ga0207649_10007103 Ga0207649_100071032 188
359 3300025921 Ga0207652_10002366 Ga0207652_100023664 188
360 3300025921 Ga0207652_10008235 Ga0207652_100082353 188
361 3300025924 Ga0207694_10032438 Ga0207694_100324383 188
362 3300025925 Ga0207650_10001182 Ga0207650_100011828 188
363 3300025932 Ga0207690_10007187 Ga0207690_100071876 188
364 3300025935 Ga0207709_10003927 Ga0207709_100039274 188
365 3300025935 Ga0207709_10008605 Ga0207709_100086053 188
366 3300025944 Ga0207661_10003492 Ga0207661_100034928 188
367 3300025944 Ga0207661_10011184 Ga0207661_100111842 188
368 3300025945 Ga0207679_10013431 Ga0207679_100134314 188
369 3300025949 Ga0207667_10003678 Ga0207667_100036787 188
370 3300025949 Ga0207667_10014455 Ga0207667_100144555 188
371 3300025981 Ga0207640_10001732 Ga0207640_100017328 188
372 3300025981 Ga0207640_10009036 Ga0207640_100090363 188
373 3300026041 Ga0207639_10006565 Ga0207639_100065655 188
374 3300026041 Ga0207639_10008792 Ga0207639_100087925 188
375 3300026041 Ga0207639_10013647 Ga0207639_100136475 188
376 3300026067 Ga0207678_10003117 Ga0207678_100031176 188
377 3300026067 Ga0207678_10005990 Ga0207678_100059908 188
378 3300026078 Ga0207702_10004943 Ga0207702_100049434 188
379 3300026078 Ga0207702_10060962 Ga0207702_100609623 188
380 3300026088 Ga0207641_10134732 Ga0207641_101347322 188
381 3300026095 Ga0207676_10676255 Ga0207676_106762552 188
382 3300026116 Ga0207674_10004761 Ga0207674_100047616 188
383 3300026116 Ga0207674_10019174 Ga0207674_100191744 188
384 3300026142 Ga0207698_10004636 Ga0207698_100046364 188
385 3300026142 Ga0207698_10008934 Ga0207698_100089342 188
386 3300026142 Ga0207698_10024988 Ga0207698_100249884 188
387 3300027312 Ga0209371_1000011 Ga0209371_1000011667 188
388 3300027312 Ga0209371_1000156 Ga0209371_100015673 188
389 3300028563 Ga0265319_1003167 Ga0265319_10031673 188
390 3300028573 Ga0265334_10012762 Ga0265334_100127622 188
391 3300028577 Ga0265318_10006638 Ga0265318_100066381 188
392 3300028800 Ga0265338_10041559 Ga0265338_100415593 188
393 3300030500 Ga0268256_1000011 Ga0268256_1000011667 188
394 3300030500 Ga0268256_1000130 Ga0268256_10001302 188
395 3300030500 Ga0268256_1000130 Ga0268256_10001303 188
396 3300031235 Ga0265330_10001827 Ga0265330_100018273 188
397 3300031238 Ga0265332_10002417 Ga0265332_100024177 188
398 3300031242 Ga0265329_10008494 Ga0265329_100084942 188
399 3300031247 Ga0265340_10237841 Ga0265340_102378412 188
400 3300031250 Ga0265331_10013116 Ga0265331_100131162 188
401 3300031344 Ga0265316_10041452 Ga0265316_100414523 188
402 3300031595 Ga0265313_10005094 Ga0265313_100050943 188
403 3300031711 Ga0265314_10031565 Ga0265314_100315652 188
404 3300031712 Ga0265342_10027474 Ga0265342_100274743 188
405 3300037418 Ga0395900_0000064 Ga0395900_0000064_107518_108120 188
406 3300037418 Ga0395900_0001994 Ga0395900_0001994_16530_17135 188
407 3300037466 Ga0395898_0029882 Ga0395898_0029882_4267_4869 188
408 3300041494 Ga0451837_0684292 Ga0451837_0684292_3262_3972 188
409 3300041511 Ga0451855_0185675 Ga0451855_0185675_100_672 188
410 3300041512 Ga0451853_4101910 Ga0451853_4101910_395_1000 188
411 3300048907 Ga0496104_0034697 Ga0496104_0034697_1038_1634 188
412 3300048920 Ga0496117_0000969 Ga0496117_0000969_29811_30377 188
413 3300048921 Ga0496118_0018490 Ga0496118_0018490_3606_4172 188
414 3300048921 Ga0496118_0039590 Ga0496118_0039590_1582_2175 188
415 3300048921 Ga0496118_0304310 Ga0496118_0304310_212_778 188
416 3300048922 Ga0496119_0001305 Ga0496119_0001305_3828_4394 188
417 3300048923 Ga0496120_0000561 Ga0496120_0000561_26195_26761 188
418 3300048925 Ga0496122_0000874 Ga0496122_0000874_26136_26702 188
419 3300048926 Ga0496123_0000461 Ga0496123_0000461_40843_41409 188
420 3300048927 Ga0496124_0002292 Ga0496124_0002292_11723_12289 188
421 3300048928 Ga0496125_0024292 Ga0496125_0024292_190_873 188
422 3300048929 Ga0496126_0020798 Ga0496126_0020798_5144_5710 188
423 3300048929 Ga0496126_0044779 Ga0496126_0044779_2242_2835 188
424 3300049570 Ga0501033_0037665 Ga0501033_0037665_1675_2259 188
425 3300049572 Ga0501036_0068720 Ga0501036_0068720_1375_1959 188
426 3300049581 Ga0501047_0071633 Ga0501047_0071633_1234_1848 188
427 3300049585 Ga0501069_0007675 Ga0501069_0007675_1678_2262 188
428 3300049586 Ga0501070_0003311 Ga0501070_0003311_5864_6448 188
429 3300049586 Ga0501070_0761766 Ga0501070_0761766_82_678 188
430 3300049589 Ga0501073_0026450 Ga0501073_0026450_234_818 188
431 3300049590 Ga0501074_0001867 Ga0501074_0001867_8440_9024 188
432 3300049742 Ga0501080_0003234 Ga0501080_0003234_6050_6634 188
433 3300049822 Ga0501035_0005737 Ga0501035_0005737_3262_3846 188
434 3300049823 Ga0501044_0003319 Ga0501044_0003319_10022_10606 188
435 3300053093 Ga0500651_0000154 Ga0500651_0000154_19272_19907 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

131

219

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5apa-assembly1.cif.gz_A crystal structure of human aspartate beta-hydroxylase isoform a 0.8305 95 185
3cew-assembly1.cif.gz_A crystal structure of a cupin protein (bf4112) from bacteroides fragilis. northeast structural genomics consortium target bfr205 0.8305 96 185
6fxk-assembly1.cif.gz_A-2 crystal structure of full-length human lysyl hydroxylase lh3 0.8138 1 186
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.7998 88 184
6fxm-assembly1.cif.gz_A-2 crystal structure of full-length human lysyl hydroxylase lh3 - cocrystal with mn2+ 0.788 15 186
ID Description Score Start End Superfamily
af_I1M4N3_280_453_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7893 94 188 2.60.120.10
af_Q94JF3_29_224_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7773 94 183 2.60.120.10
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7754 94 183 2.60.120.10
3cewA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7729 79 185 2.60.120.10
af_Q20679_557_729_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7726 9 183 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A543DC78-F1-model_v4 2-oxoglutarate-Fe(II)-dependent oxygenase superfamily protein 0.9885 4 188 GO:0005506
GO:0016705
GO:0031418
GO:0051213
AF-A0A2P5Z8R1-F1-model_v4 2OG-Fe(II) oxygenase 0.9882 1 188 GO:0005506
GO:0016705
GO:0031418
GO:0051213
AF-A0A1H9L7A2-F1-model_v4 Prolyl 4-hydroxylase alpha subunit domain-containing protein 0.987 1 186 GO:0005506
GO:0016705
GO:0031418
GO:0051213
AF-A0A0R0A9L7-F1-model_v4 2OG-Fe(II) oxygenase 0.9865 7 188 GO:0005506
GO:0016705
GO:0031418
GO:0051213
AF-A0A0Q5JFH8-F1-model_v4 2OG-Fe(II) oxygenase 0.9849 9 188 GO:0004656
GO:0005506
GO:0031418

Feature Viewer

pLDDT pTM Quality
92.51 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map