F443293

General Info

Members Datasets Scaffolds Average Seq Length
435 301 254 310

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10000126|Ga0075364_1000012616
Length 370
Sequence VGAVVEIGVHRIRESHNRKSHGNRCIRSLEKHFAHHKAFARLALNRSRQTKTVEEKHVKKHLIMAAFASFLATSASAQTIGVSMALFDDNFLTVLRNGMVDYSKGLDGVTLQIEDAQNDVGKQLSQVQNFVASGVDAIIVNPVDTDATTALSQAAAAAGIPLVYVNRQPVNVDALPEKQAFVASDEKQSGTLQTQEVCRILKEAGKKEANAVVMMGELSNQAARMRTQDIKDVIATPDCSFMKIVEEQTANWSRTQGADLMTNWLSAGVKFDAVISNNDEMAIGAIQALKSSGRAMDDVIVAGIDATQDALASMASGDLDVSVFQNAAGQGKGAVDAAIRIAKGETIEKKVYVPFELVTPANLKTYQAKN

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
3 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
4 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
5 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
6 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
7 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
8 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
9 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
10 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
11 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
12 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
13 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
14 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
15 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
16 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
17 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
18 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
19 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
20 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
21 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
22 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
23 2643221582 Rhizobium sp. Root651 Isolate Unclassified
24 2643221607 Rhizobium sp. Root73 Isolate Unclassified
25 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
26 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
27 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
28 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
29 2643221693 Rhizobium sp. Root491 Isolate Unclassified
30 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
31 2718217927 Rhizobium sp. N324 Isolate Nodule
32 2718218423 Rhizobium sp. N941 Isolate Nodule
33 2721755809 Rhizobium sp. N541 Isolate Nodule
34 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
35 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
36 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
37 2791355261 Rhizobium sp. J15 Isolate Nodule
38 2791355263 Rhizobium chutanense C5 Isolate Nodule
39 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
40 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
41 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
42 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
43 2838061910 Rhizobium phaseoli L15 Isolate Nodule
44 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
45 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
46 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
47 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
48 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
49 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
50 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
51 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
52 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
53 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
54 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
55 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
56 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
57 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
58 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
59 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
60 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
61 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
62 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
63 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
64 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
65 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
66 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
67 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
68 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
69 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
70 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
71 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
72 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
73 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
74 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
75 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
76 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
77 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
78 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
79 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
80 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
81 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
82 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
83 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
84 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
85 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
86 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
87 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
88 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
89 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
90 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
91 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
92 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
93 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
94 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
95 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
96 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
97 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
98 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
99 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
100 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
101 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
102 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
103 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
104 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
105 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
106 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
107 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
108 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
109 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
110 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
111 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
112 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
113 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
114 2936381700 Rhizobium chutanense C16 Isolate Unclassified
115 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
116 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
117 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
118 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
119 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
120 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
121 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
122 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
123 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
124 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
125 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
126 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
127 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
128 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
129 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
130 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
131 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
132 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
133 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
134 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
135 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
136 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
137 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
138 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
139 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
140 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
141 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
142 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
143 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
144 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
145 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
146 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
147 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
148 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
149 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
150 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
151 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
152 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
153 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
154 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
155 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
156 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
159 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
160 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
161 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
162 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
163 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
164 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
165 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
166 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
167 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
168 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
169 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
172 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
173 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
181 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
182 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
183 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
184 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
187 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
232 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
280 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
281 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
282 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
286 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
289 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
290 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
296 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
297 8005275841 Rhizobium sp. N4311 Isolate Nodule
298 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
299 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
300 8018176218 Rhizobium sp. N122 Isolate Nodule
301 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 57.93
Metatranscriptomes 0.69
Isolates 41.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.92
Bulb 0
Endosphere 16.09
Nodule 22.53
Rhizoplane 2.99
Rhizosphere 34.48
Stem 0
Stem Tuber 0
Unclassified 22.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10025172 3300001990 Bacteria 1882
2 JGI25162J39368_1000207 3300002737 Bacteria 62123
3 JGI25151J46595_10010471 3300003187 Bacteria 4307
4 JGI25151J46595_10014546 3300003187 Bacteria 3502
5 JGI25165J46597_1000708 3300003214 Bacteria 26335
6 JGI25165J46597_1002799 3300003214 Bacteria 5052
7 rootH1_10022539 3300003316 Bacteria 1485
8 Ga0006562J51391_1020161 3300003578 Bacteria 2401
9 Ga0055524_1004341 3300003775 Bacteria 6560
10 Ga0055528_1000433 3300003790 Bacteria 33610
11 Ga0055528_1001141 3300003790 Bacteria 17268
12 Ga0055528_1002932 3300003790 Bacteria 8846
13 Ga0058692_1000771 3300003856 Bacteria 12866
14 Ga0058692_1007808 3300003856 Bacteria 2806
15 Ga0065704_10163536 3300005289 Bacteria 1338
16 Ga0070658_10022529 3300005327 Bacteria 5055
17 Ga0070676_10026238 3300005328 Bacteria 3298
18 Ga0070660_100007424 3300005339 Bacteria 7639
19 Ga0070668_100164544 3300005347 Bacteria 1802
20 Ga0070669_100192424 3300005353 Bacteria 1601
21 Ga0070674_100024976 3300005356 Bacteria 3882
22 Ga0070673_100146666 3300005364 Bacteria 1995
23 Ga0070662_100314493 3300005457 Bacteria 1275
24 Ga0068853_100184807 3300005539 Bacteria 1891
25 Ga0070672_100203077 3300005543 Bacteria 1658
26 Ga0070686_100052493 3300005544 Bacteria 2600
27 Ga0070665_100009919 3300005548 Bacteria 9633
28 Ga0070665_100010410 3300005548 Bacteria 9411
29 Ga0070665_100172678 3300005548 Bacteria 2162
30 Ga0068855_100052175 3300005563 Bacteria 4815
31 Ga0068854_100148515 3300005578 Bacteria 1805
32 Ga0068856_100027277 3300005614 Bacteria 5572
33 Ga0081540_1004077 3300005983 Bacteria 11309
34 Ga0081540_1055519 3300005983 Bacteria 1929
35 Ga0075365_10130325 3300006038 Bacteria 1740
36 Ga0075368_10026840 3300006042 Bacteria 2217
37 Ga0075368_10037305 3300006042 Bacteria 1900
38 Ga0075368_10047507 3300006042 Bacteria 1699
39 Ga0075363_100024117 3300006048 Bacteria 3090
40 Ga0075363_100026368 3300006048 Bacteria 2973
41 Ga0075363_100040160 3300006048 Bacteria 2466
42 Ga0075364_10000126 3300006051 Bacteria 31821
43 Ga0075364_10017950 3300006051 Bacteria 4425
44 Ga0075362_10008228 3300006177 Bacteria 3982
45 Ga0075367_10097285 3300006178 Bacteria 1795
46 Ga0075367_10098097 3300006178 Bacteria 1788
47 Ga0068871_100213028 3300006358 Bacteria 1671
48 Ga0099826_10000328 3300006948 Bacteria 21645
49 Ga0099826_10004678 3300006948 Bacteria 9640
50 Ga0099826_10058078 3300006948 Bacteria 2540
51 Ga0105240_10000013 3300009093 Bacteria 483458
52 Ga0105240_10040055 3300009093 Bacteria 5997
53 Ga0111539_10000167 3300009094 Bacteria 75742
54 Ga0105243_10006468 3300009148 Bacteria 9061
55 Ga0105243_10125179 3300009148 Bacteria 2173
56 Ga0105237_10004144 3300009545 Bacteria 16891
57 Ga0105239_10006528 3300010375 Bacteria 13515
58 Ga0105246_10027492 3300011119 Bacteria 3728
59 Ga0105246_10047710 3300011119 Bacteria 2926
60 Ga0157373_10003911 3300013100 Bacteria 11245
61 Ga0157373_10010979 3300013100 Bacteria 6668
62 Ga0157371_10000002 3300013102 Bacteria 665040
63 Ga0157371_10000005 3300013102 Bacteria 416456
64 Ga0157370_10000036 3300013104 Bacteria 136933
65 Ga0157370_10000269 3300013104 Bacteria 65839
66 Ga0157370_10000836 3300013104 Bacteria 39048
67 Ga0157370_10253927 3300013104 Bacteria 1626
68 Ga0157378_10115160 3300013297 Bacteria 2470
69 Ga0182008_10108424 3300014497 Bacteria 1375
70 Ga0157379_10194262 3300014968 Bacteria 1834
71 Ga0182007_10001753 3300015262 Bacteria 11410
72 Ga0182005_1003219 3300015265 Bacteria 5585
73 Ga0209672_100019 3300025228 Bacteria 432215
74 Ga0209437_100204 3300025233 Bacteria 115781
75 Ga0209646_1003871 3300025246 Bacteria 2850
76 Ga0209677_100682 3300025253 Bacteria 17454
77 Ga0209233_1000280 3300025261 Bacteria 70793
78 Ga0209233_1000388 3300025261 Bacteria 37536
79 Ga0209673_1000033 3300025273 Bacteria 335369
80 Ga0209676_1012671 3300025292 Bacteria 3290
81 Ga0209025_1000545 3300025294 Bacteria 70608
82 Ga0209025_1001212 3300025294 Bacteria 36123
83 Ga0209025_1011660 3300025294 Bacteria 5756
84 Ga0209025_1022155 3300025294 Bacteria 3384
85 Ga0209758_1024432 3300025297 Bacteria 2693
86 Ga0209256_1000563 3300025299 Bacteria 53065
87 Ga0207645_10026019 3300025907 Bacteria 3784
88 Ga0207705_10019453 3300025909 Bacteria 4856
89 Ga0207695_10000044 3300025913 Bacteria 440819
90 Ga0207695_10035204 3300025913 Bacteria 5434
91 Ga0207671_10000043 3300025914 Bacteria 206915
92 Ga0207649_10045922 3300025920 Bacteria 2680
93 Ga0207681_10080274 3300025923 Bacteria 2301
94 Ga0207690_10038375 3300025932 Bacteria 3117
95 Ga0207709_10072705 3300025935 Bacteria 2188
96 Ga0207709_10105212 3300025935 Bacteria 1875
97 Ga0207669_10101359 3300025937 Bacteria 1904
98 Ga0207667_10173831 3300025949 Bacteria 2213
99 Ga0207667_10618573 3300025949 Bacteria 1091
100 Ga0207651_10233282 3300025960 Bacteria 1495
101 Ga0207640_10009959 3300025981 Bacteria 5339
102 Ga0207640_10340892 3300025981 Bacteria 1200
103 Ga0207677_10128969 3300026023 Bacteria 1916
104 Ga0207639_10179170 3300026041 Bacteria 1801
105 Ga0207648_10058818 3300026089 Bacteria 3351
106 Ga0207674_10031245 3300026116 Bacteria 5594
107 Ga0207698_10198271 3300026142 Bacteria 1795
108 Ga0209371_1000012 3300027312 Bacteria 748304
109 Ga0209371_1004131 3300027312 Bacteria 6512
110 Ga0209282_1000131 3300027666 Bacteria 45265
111 Ga0209813_10006402 3300027866 Bacteria 2907
112 Ga0209813_10032851 3300027866 Bacteria 1540
113 Ga0207428_10000055 3300027907 Bacteria 166460
114 Ga0268266_10008439 3300028379 Bacteria 9159
115 Ga0268266_10009389 3300028379 Bacteria 8618
116 Ga0268266_10020433 3300028379 Bacteria 5644
117 Ga0307515_10000136 3300028794 Bacteria 174265
118 Ga0307515_10023797 3300028794 Bacteria 10710
119 Ga0268256_1000013 3300030500 Bacteria 752103
120 Ga0268256_1014963 3300030500 Bacteria 2281
121 Ga0307513_10000302 3300031456 Bacteria 70793
122 Ga0307509_10120006 3300031507 Bacteria 2609
123 Ga0307408_100026586 3300031548 Bacteria 3978
124 Ga0307508_10217196 3300031616 Bacteria 1512
125 Ga0307409_100174632 3300031995 Bacteria 1895
126 Ga0307414_10252724 3300032004 Bacteria 1466
127 Ga0307411_10065501 3300032005 Bacteria 2437
128 Ga0373938_0012485 3300034957 Bacteria 1595
129 Ga0373931_0131671 3300035691 Bacteria 1440
130 Ga0395900_0189803 3300037418 Bacteria 2085
131 Ga0436360_1262863 3300039438 Bacteria 1463
132 Ga0439436_0012902 3300041404 Bacteria 2532
133 Ga0439465_0005122 3300041413 Bacteria 4206
134 Ga0439465_0043336 3300041413 Bacteria 1460
135 Ga0450906_010260 3300042145 Bacteria 1773
136 Ga0450918_006762 3300042531 Bacteria 2040
137 Ga0495638_0000634 3300046460 Bacteria 38683
138 Ga0495638_0000886 3300046460 Bacteria 30777
139 Ga0495605_0003448 3300046474 Bacteria 9405
140 Ga0495585_0075260 3300046492 Bacteria 1836
141 Ga0495583_0019978 3300046506 Bacteria 3483
142 Ga0495620_0034737 3300046515 Bacteria 2275
143 Ga0495631_0003747 3300046518 Bacteria 8278
144 Ga0495609_0040659 3300046538 Bacteria 2092
145 Ga0495633_0013803 3300046558 Bacteria 4243
146 Ga0495633_0087591 3300046558 Bacteria 1448
147 Ga0495611_0020774 3300046648 Bacteria 2830
148 Ga0495625_0001429 3300046660 Bacteria 29103
149 Ga0495625_0030748 3300046660 Bacteria 4002
150 Ga0495625_0123354 3300046660 Bacteria 1761
151 Ga0495588_0003384 3300046674 Bacteria 6929
152 Ga0495670_0068552 3300046691 Bacteria 1793
153 Ga0495660_0167644 3300046810 Bacteria 1072
154 Ga0495636_0089483 3300047318 Bacteria 1335
155 Ga0495672_0077069 3300047320 Bacteria 1870
156 Ga0495686_0040322 3300047472 Bacteria 2978
157 Ga0496104_0036453 3300048907 Bacteria 4599
158 Ga0496106_0068248 3300048909 Bacteria 2712
159 Ga0496107_0072786 3300048910 Bacteria 2499
160 Ga0496113_0027099 3300048916 Bacteria 4104
161 Ga0496113_0160820 3300048916 Bacteria 1775
162 Ga0496116_0016249 3300048919 Bacteria 5835
163 Ga0496116_0057712 3300048919 Bacteria 2536
164 Ga0496117_0000016 3300048920 Bacteria 523642
165 Ga0496117_0000030 3300048920 Bacteria 389141
166 Ga0496117_0000277 3300048920 Bacteria 95538
167 Ga0496117_0002721 3300048920 Bacteria 21729
168 Ga0496117_0003754 3300048920 Bacteria 17393
169 Ga0496117_0005071 3300048920 Bacteria 14102
170 Ga0496118_0001242 3300048921 Bacteria 39180
171 Ga0496118_0003364 3300048921 Bacteria 20214
172 Ga0496118_0003748 3300048921 Bacteria 18793
173 Ga0496118_0019920 3300048921 Bacteria 5972
174 Ga0496118_0050791 3300048921 Bacteria 3178
175 Ga0496119_0137538 3300048922 Bacteria 1323
176 Ga0496120_0000772 3300048923 Bacteria 46288
177 Ga0496120_0003367 3300048923 Bacteria 14658
178 Ga0496121_0000005 3300048924 Bacteria 1034486
179 Ga0496121_0003679 3300048924 Bacteria 21530
180 Ga0496121_0196855 3300048924 Bacteria 1440
181 Ga0496122_0000002 3300048925 Bacteria 905834
182 Ga0496122_0000050 3300048925 Bacteria 267874
183 Ga0496122_0000072 3300048925 Bacteria 222436
184 Ga0496122_0000193 3300048925 Bacteria 139724
185 Ga0496122_0000414 3300048925 Bacteria 90664
186 Ga0496122_0000809 3300048925 Bacteria 60004
187 Ga0496122_0113995 3300048925 Bacteria 1764
188 Ga0496123_0000002 3300048926 Bacteria 1811682
189 Ga0496123_0000023 3300048926 Bacteria 346894
190 Ga0496123_0000035 3300048926 Bacteria 267288
191 Ga0496123_0000154 3300048926 Bacteria 139724
192 Ga0496123_0000587 3300048926 Bacteria 62043
193 Ga0496123_0000839 3300048926 Bacteria 49128
194 Ga0496124_0000500 3300048927 Bacteria 67401
195 Ga0496124_0002797 3300048927 Bacteria 22104
196 Ga0496124_0004816 3300048927 Bacteria 15536
197 Ga0496124_0008171 3300048927 Bacteria 10979
198 Ga0496124_0019003 3300048927 Bacteria 6414
199 Ga0496124_0049158 3300048927 Bacteria 3599
200 Ga0496124_0090608 3300048927 Bacteria 2494
201 Ga0496125_0000417 3300048928 Bacteria 79282
202 Ga0496125_0002982 3300048928 Bacteria 21249
203 Ga0496125_0003920 3300048928 Bacteria 17561
204 Ga0496125_0022980 3300048928 Bacteria 5775
205 Ga0496125_0048013 3300048928 Bacteria 3564
206 Ga0496125_0246419 3300048928 Bacteria 1130
207 Ga0496126_0000188 3300048929 Bacteria 139625
208 Ga0496126_0000574 3300048929 Bacteria 70089
209 Ga0496126_0001037 3300048929 Bacteria 46997
210 Ga0496126_0118045 3300048929 Bacteria 2303
211 Ga0496126_0121049 3300048929 Bacteria 2269
212 Ga0495682_0051786 3300049460 Bacteria 1493
213 Ga0501034_0085484 3300049571 Bacteria 3156
214 Ga0501039_0071955 3300049575 Bacteria 2687
215 Ga0501039_0319029 3300049575 Bacteria 1222
216 Ga0501069_0175205 3300049585 Bacteria 1239
217 Ga0501044_0175122 3300049823 Bacteria 2115
218 nmdc:mga03683_12203_c1 3300050489 Bacteria 3133
219 nmdc:mga03683_129981_c1 3300050489 Bacteria 1126
220 nmdc:mga03n38_141312_c1 3300050490 Bacteria 1203
221 nmdc:mga00v17_168_c1 3300050491 Bacteria 38334
222 nmdc:mga00v17_34_c1 3300050491 Bacteria 85919
223 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
224 nmdc:mga0yw44_19672_c1 3300050492 Bacteria 3729
225 nmdc:mga0yw44_23546_c1 3300050492 Bacteria 3472
226 nmdc:mga0k408_56128_c1 3300050493 Bacteria 2285
227 nmdc:mga06z11_48091_c1 3300050494 Bacteria 2170
228 nmdc:mga06z11_87551_c1 3300050494 Bacteria 1685
229 nmdc:mga04h51_17847_c1 3300050495 Bacteria 2082
230 nmdc:mga08y16_37_c1 3300050511 Bacteria 150340
231 nmdc:mga0sz30_213_c1 3300050516 Bacteria 21919
232 nmdc:mga0sz30_5540_c1 3300050516 Bacteria 4638
233 Ga0500610_0072706 3300053079 Bacteria 1793
234 Ga0500557_019811 3300053105 Bacteria 1902
235 Ga0500560_002637 3300053107 Bacteria 3474
236 Ga0500572_006065 3300053111 Bacteria 2757
237 Ga0500595_015258 3300053119 Bacteria 2888
238 Ga0500658_0094217 3300053134 Bacteria 1299
239 Ga0500559_0028934 3300053136 Bacteria 2369
240 Ga0500561_0000067 3300053137 Bacteria 20534
241 Ga0500561_0000086 3300053137 Bacteria 18553
242 Ga0500568_0000543 3300053139 Bacteria 27846
243 Ga0500568_0006569 3300053139 Bacteria 5819
244 Ga0500616_0003759 3300053153 Bacteria 11303
245 Ga0500624_000238 3300053157 Bacteria 19610
246 Ga0500624_000964 3300053157 Bacteria 5910
247 Ga0500627_0025352 3300053158 Bacteria 2436
248 Ga0500634_0091328 3300053161 Bacteria 1544
249 Ga0500634_0143397 3300053161 Bacteria 1127
250 Ga0500636_0000205 3300053177 Bacteria 31862
251 Ga0500636_0106029 3300053177 Bacteria 1593
252 Ga0500645_015272 3300053730 Unclassified 2435
253 Ga0587076_025058 3300059645 Bacteria 1017
254 Ga0587111_0007275 3300060346 Bacteria 1793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2984601300 2984605647 259
2 3300049823 Ga0501044_0175122 Ga0501044_0175122_405_1367 268
3 3300048924 Ga0496121_0196855 Ga0496121_0196855_306_1157 274
4 3300035691 Ga0373931_0131671 Ga0373931_0131671_17_880 279
5 3300039438 Ga0436360_1262863 Ga0436360_1262863_57_932 282
6 3300005544 Ga0070686_100052493 Ga0070686_1000524932 284
7 3300014968 Ga0157379_10194262 Ga0157379_101942622 287
8 3300047472 Ga0495686_0040322 Ga0495686_0040322_1047_1940 288
9 3300048920 Ga0496117_0003754 Ga0496117_0003754_4254_5156 291
10 3300048922 Ga0496119_0137538 Ga0496119_0137538_20_922 291
11 3300049585 Ga0501069_0175205 Ga0501069_0175205_318_1223 292
12 3300053157 Ga0500624_000964 Ga0500624_000964_1548_2453 292
13 3300048927 Ga0496124_0002797 Ga0496124_0002797_20054_20998 293
14 3300005328 Ga0070676_10026238 Ga0070676_100262382 294
15 3300005353 Ga0070669_100192424 Ga0070669_1001924241 294
16 3300005548 Ga0070665_100009919 Ga0070665_1000099193 294
17 3300006042 Ga0075368_10026840 Ga0075368_100268402 294
18 3300011119 Ga0105246_10027492 Ga0105246_100274923 294
19 3300013100 Ga0157373_10010979 Ga0157373_100109794 294
20 3300013102 Ga0157371_10000005 Ga0157371_10000005283 294
21 3300013104 Ga0157370_10000036 Ga0157370_1000003699 294
22 3300025907 Ga0207645_10026019 Ga0207645_100260191 294
23 3300025923 Ga0207681_10080274 Ga0207681_100802742 294
24 3300025981 Ga0207640_10340892 Ga0207640_103408921 294
25 3300027866 Ga0209813_10032851 Ga0209813_100328512 294
26 3300028379 Ga0268266_10009389 Ga0268266_100093897 294
27 3300048916 Ga0496113_0027099 Ga0496113_0027099_2744_3685 294
28 3300048919 Ga0496116_0057712 Ga0496116_0057712_834_1775 294
29 3300048920 Ga0496117_0000030 Ga0496117_0000030_54991_55932 294
30 3300048921 Ga0496118_0019920 Ga0496118_0019920_1018_1959 294
31 3300048925 Ga0496122_0000050 Ga0496122_0000050_114916_115857 294
32 3300048926 Ga0496123_0000023 Ga0496123_0000023_12475_13416 294
33 3300048927 Ga0496124_0019003 Ga0496124_0019003_165_1106 294
34 3300048928 Ga0496125_0246419 Ga0496125_0246419_153_1094 294
35 3300050491 nmdc:mga00v17_34_c1 nmdc:mga00v17_34_c1_79622_80563 294
36 3300050492 nmdc:mga0yw44_23546_c1 nmdc:mga0yw44_23546_c1_1895_2836 294
37 3300050494 nmdc:mga06z11_87551_c1 nmdc:mga06z11_87551_c1_222_1163 294
38 3300050495 nmdc:mga04h51_17847_c1 nmdc:mga04h51_17847_c1_221_1162 294
39 3300050516 nmdc:mga0sz30_5540_c1 nmdc:mga0sz30_5540_c1_3508_4449 294
40 3300053137 Ga0500561_0000067 Ga0500561_0000067_4847_5788 294
41 iso_pu_bacteria 2791355263 2793344650 294
42 3300049575 Ga0501039_0319029 Ga0501039_0319029_174_1118 295
43 iso_pu_bacteria 2791355261 2793331575 295
44 iso_pu_bacteria 2838061910 2838064575 295
45 iso_pu_bacteria 2838729681 2838735659 295
46 iso_pu_bacteria 2838742623 2838748561 295
47 iso_pu_bacteria 2841851746 2841854319 295
48 iso_pu_bacteria 2842229732 2842232829 295
49 iso_pu_bacteria 2842243621 2842246928 295
50 iso_pu_bacteria 2842257432 2842259386 295
51 iso_pu_bacteria 2842264693 2842270071 295
52 iso_pu_bacteria 2842428310 2842433860 295
53 iso_pu_bacteria 2842434925 2842440236 295
54 iso_pu_bacteria 2842441272 2842446975 295
55 iso_pu_bacteria 2842469257 2842474830 295
56 iso_pu_bacteria 2844454524 2844460768 295
57 iso_pu_bacteria 2936381700 2936388372 295
58 iso_pu_bacteria 8005430974 8005435905 295
59 iso_pu_bacteria 8005626139 8005629013 295
60 iso_pu_bacteria 2511231027 2511390262 296
61 iso_pu_bacteria 2513237159 2513999029 296
62 iso_pu_bacteria 2537561587 2537877428 296
63 iso_pu_bacteria 2554235003 2554245524 296
64 iso_pu_bacteria 2558860242 2559296646 296
65 iso_pu_bacteria 2582581283 2585169906 296
66 iso_pu_bacteria 2582581306 2585268754 296
67 iso_pu_bacteria 2582581308 2585279719 296
68 iso_pu_bacteria 2582581315 2585327555 296
69 iso_pu_bacteria 2582581316 2585333903 296
70 iso_pu_bacteria 2582581865 2585389399 296
71 iso_pu_bacteria 2585427527 2585531878 296
72 iso_pu_bacteria 2585427530 2585551175 296
73 iso_pu_bacteria 2599185210 2599602865 296
74 iso_pu_bacteria 2600255279 2601610472 296
75 iso_pu_bacteria 2600255308 2601747198 296
76 iso_pu_bacteria 2615840626 2616306508 296
77 iso_pu_bacteria 2643221582 2643917384 296
78 iso_pu_bacteria 2643221607 2644051377 296
79 iso_pu_bacteria 2643221636 2644201048 296
80 iso_pu_bacteria 2643221686 2644484281 296
81 iso_pu_bacteria 2643221689 2644497614 296
82 iso_pu_bacteria 2643221693 2644520774 296
83 iso_pu_bacteria 2690316117 2692319306 296
84 iso_pu_bacteria 2751185821 2753458976 296
85 iso_pu_bacteria 2775507266 2778179118 296
86 iso_pu_bacteria 2808606387 2808987099 296
87 iso_pu_bacteria 2818991439 2819560599 296
88 iso_pu_bacteria 2818991453 2819638606 296
89 iso_pu_bacteria 2838074704 2838075733 296
90 iso_pu_bacteria 2838675328 2838677908 296
91 iso_pu_bacteria 2838714209 2838717186 296
92 iso_pu_bacteria 2838719591 2838722203 296
93 iso_pu_bacteria 2838724970 2838727935 296
94 iso_pu_bacteria 2841846520 2841849593 296
95 iso_pu_bacteria 2841859092 2841861367 296
96 iso_pu_bacteria 2842124991 2842127659 296
97 iso_pu_bacteria 2842130223 2842132801 296
98 iso_pu_bacteria 2842152218 2842154794 296
99 iso_pu_bacteria 2842170452 2842173293 296
100 iso_pu_bacteria 2842175837 2842178415 296
101 iso_pu_bacteria 2842187318 2842190294 296
102 iso_pu_bacteria 2842211629 2842214608 296
103 iso_pu_bacteria 2842224351 2842227327 296
104 iso_pu_bacteria 2842509118 2842511467 296
105 iso_pu_bacteria 2842515876 2842518366 296
106 iso_pu_bacteria 2842521101 2842524773 296
107 iso_pu_bacteria 2842871566 2842872229 296
108 iso_pu_bacteria 2847417321 2847422187 296
109 iso_pu_bacteria 2848992105 2848998314 296
110 iso_pu_bacteria 2855872281 2855875630 296
111 iso_pu_bacteria 2891373044 2891373656 296
112 iso_pu_bacteria 2896384573 2896388186 296
113 iso_pu_bacteria 2899792073 2899796410 296
114 iso_pu_bacteria 2899845264 2899849953 296
115 iso_pu_bacteria 2919114240 2919117444 296
116 iso_pu_bacteria 2920760137 2920764297 296
117 iso_pu_bacteria 2923556063 2923560005 296
118 iso_pu_bacteria 2926754445 2926758891 296
119 iso_pu_bacteria 2926760298 2926763599 296
120 iso_pu_bacteria 2928521798 2928524158 296
121 iso_pu_bacteria 2933006813 2933009823 296
122 iso_pu_bacteria 2933011516 2933013993 296
123 iso_pu_bacteria 2933594066 2933595779 296
124 iso_pu_bacteria 2954011201 2954013105 296
125 iso_pu_bacteria 2979089926 2979091362 296
126 iso_pu_bacteria 2979095461 2979096886 296
127 iso_pu_bacteria 2979100975 2979101446 296
128 iso_pu_bacteria 2984509177 2984510604 296
129 iso_pu_bacteria 2984518228 2984518693 296
130 iso_pu_bacteria 2984537506 2984538953 296
131 iso_pu_bacteria 650716007 650843068 296
132 iso_pu_bacteria 8003570095 8003574227 296
133 3300041404 Ga0439436_0012902 Ga0439436_0012902_1411_2334 297
134 3300041413 Ga0439465_0043336 Ga0439465_0043336_396_1319 297
135 3300042145 Ga0450906_010260 Ga0450906_010260_129_1052 297
136 3300042531 Ga0450918_006762 Ga0450918_006762_650_1573 297
137 3300046660 Ga0495625_0123354 Ga0495625_0123354_701_1639 297
138 3300006948 Ga0099826_10058078 Ga0099826_100580782 298
139 iso_pu_bacteria 2513237146 2513924916 298
140 iso_pu_bacteria 2599185170 2599416477 298
141 iso_pu_bacteria 2838035591 2838036593 298
142 3300005289 Ga0065704_10163536 Ga0065704_101635361 299
143 3300025294 Ga0209025_1011660 Ga0209025_10116606 299
144 3300031616 Ga0307508_10217196 Ga0307508_102171961 299
145 3300031995 Ga0307409_100174632 Ga0307409_1001746321 299
146 3300048925 Ga0496122_0000072 Ga0496122_0000072_174288_175214 299
147 3300048926 Ga0496123_0000035 Ga0496123_0000035_219140_220066 299
148 3300048927 Ga0496124_0049158 Ga0496124_0049158_2646_3572 299
149 3300053136 Ga0500559_0028934 Ga0500559_0028934_615_1559 299
150 iso_pu_bacteria 2643221623 2644133147 299
151 iso_pu_bacteria 2718217927 2719389267 299
152 iso_pu_bacteria 2718218423 2721402032 299
153 iso_pu_bacteria 2721755809 2724035865 299
154 iso_pu_bacteria 8005275841 8005277608 299
155 iso_pu_bacteria 8018176218 8018182139 299
156 3300002737 JGI25162J39368_1000207 JGI25162J39368_100020726 300
157 3300003187 JGI25151J46595_10010471 JGI25151J46595_100104713 300
158 3300003187 JGI25151J46595_10014546 JGI25151J46595_100145464 300
159 3300003214 JGI25165J46597_1000708 JGI25165J46597_100070817 300
160 3300003214 JGI25165J46597_1002799 JGI25165J46597_10027991 300
161 3300003316 rootH1_10022539 rootH1_100225391 300
162 3300003578 Ga0006562J51391_1020161 Ga0006562J51391_10201611 300
163 3300003775 Ga0055524_1004341 Ga0055524_10043412 300
164 3300003790 Ga0055528_1000433 Ga0055528_10004337 300
165 3300003790 Ga0055528_1001141 Ga0055528_10011413 300
166 3300003790 Ga0055528_1002932 Ga0055528_10029325 300
167 3300003856 Ga0058692_1000771 Ga0058692_10007718 300
168 3300003856 Ga0058692_1007808 Ga0058692_10078082 300
169 3300005548 Ga0070665_100010410 Ga0070665_1000104104 300
170 3300005563 Ga0068855_100052175 Ga0068855_1000521752 300
171 3300006038 Ga0075365_10130325 Ga0075365_101303251 300
172 3300006042 Ga0075368_10047507 Ga0075368_100475071 300
173 3300006048 Ga0075363_100024117 Ga0075363_1000241173 300
174 3300006051 Ga0075364_10017950 Ga0075364_100179502 300
175 3300006177 Ga0075362_10008228 Ga0075362_100082282 300
176 3300006948 Ga0099826_10000328 Ga0099826_1000032814 300
177 3300006948 Ga0099826_10004678 Ga0099826_100046786 300
178 3300009093 Ga0105240_10000013 Ga0105240_10000013440 300
179 3300009094 Ga0111539_10000167 Ga0111539_1000016712 300
180 3300009148 Ga0105243_10006468 Ga0105243_100064685 300
181 3300009148 Ga0105243_10125179 Ga0105243_101251793 300
182 3300009545 Ga0105237_10004144 Ga0105237_100041442 300
183 3300010375 Ga0105239_10006528 Ga0105239_1000652811 300
184 3300013100 Ga0157373_10003911 Ga0157373_100039115 300
185 3300013102 Ga0157371_10000002 Ga0157371_10000002402 300
186 3300013104 Ga0157370_10000269 Ga0157370_1000026939 300
187 3300013104 Ga0157370_10000836 Ga0157370_1000083615 300
188 3300013104 Ga0157370_10253927 Ga0157370_102539272 300
189 3300015262 Ga0182007_10001753 Ga0182007_100017536 300
190 3300015265 Ga0182005_1003219 Ga0182005_10032192 300
191 3300025228 Ga0209672_100019 Ga0209672_10001944 300
192 3300025233 Ga0209437_100204 Ga0209437_10020465 300
193 3300025246 Ga0209646_1003871 Ga0209646_10038712 300
194 3300025253 Ga0209677_100682 Ga0209677_10068215 300
195 3300025261 Ga0209233_1000280 Ga0209233_100028026 300
196 3300025261 Ga0209233_1000388 Ga0209233_100038815 300
197 3300025273 Ga0209673_1000033 Ga0209673_1000033133 300
198 3300025292 Ga0209676_1012671 Ga0209676_10126713 300
199 3300025294 Ga0209025_1000545 Ga0209025_100054532 300
200 3300025294 Ga0209025_1001212 Ga0209025_100121223 300
201 3300025294 Ga0209025_1022155 Ga0209025_10221552 300
202 3300025297 Ga0209758_1024432 Ga0209758_10244321 300
203 3300025299 Ga0209256_1000563 Ga0209256_100056336 300
204 3300025913 Ga0207695_10000044 Ga0207695_10000044397 300
205 3300025914 Ga0207671_10000043 Ga0207671_1000004391 300
206 3300025935 Ga0207709_10072705 Ga0207709_100727053 300
207 3300025935 Ga0207709_10105212 Ga0207709_101052121 300
208 3300025949 Ga0207667_10618573 Ga0207667_106185731 300
209 3300027312 Ga0209371_1000012 Ga0209371_1000012148 300
210 3300027312 Ga0209371_1004131 Ga0209371_10041315 300
211 3300027666 Ga0209282_1000131 Ga0209282_100013125 300
212 3300027866 Ga0209813_10006402 Ga0209813_100064022 300
213 3300027907 Ga0207428_10000055 Ga0207428_10000055130 300
214 3300028379 Ga0268266_10008439 Ga0268266_100084394 300
215 3300028794 Ga0307515_10000136 Ga0307515_1000013666 300
216 3300030500 Ga0268256_1000013 Ga0268256_1000013148 300
217 3300030500 Ga0268256_1014963 Ga0268256_10149631 300
218 3300031456 Ga0307513_10000302 Ga0307513_1000030230 300
219 3300032004 Ga0307414_10252724 Ga0307414_102527242 300
220 3300041413 Ga0439465_0005122 Ga0439465_0005122_2775_3860 300
221 3300046460 Ga0495638_0000634 Ga0495638_0000634_24583_25512 300
222 3300046460 Ga0495638_0000886 Ga0495638_0000886_14401_15333 300
223 3300046474 Ga0495605_0003448 Ga0495605_0003448_8409_9341 300
224 3300046492 Ga0495585_0075260 Ga0495585_0075260_30_962 300
225 3300046506 Ga0495583_0019978 Ga0495583_0019978_1289_2218 300
226 3300046515 Ga0495620_0034737 Ga0495620_0034737_1128_2060 300
227 3300046518 Ga0495631_0003747 Ga0495631_0003747_4853_5785 300
228 3300046538 Ga0495609_0040659 Ga0495609_0040659_298_1227 300
229 3300046558 Ga0495633_0013803 Ga0495633_0013803_1638_2597 300
230 3300046648 Ga0495611_0020774 Ga0495611_0020774_1777_2709 300
231 3300046660 Ga0495625_0001429 Ga0495625_0001429_16377_17309 300
232 3300046660 Ga0495625_0030748 Ga0495625_0030748_970_1899 300
233 3300046674 Ga0495588_0003384 Ga0495588_0003384_5099_6058 300
234 3300046691 Ga0495670_0068552 Ga0495670_0068552_835_1764 300
235 3300046810 Ga0495660_0167644 Ga0495660_0167644_25_954 300
236 3300047318 Ga0495636_0089483 Ga0495636_0089483_158_1090 300
237 3300047320 Ga0495672_0077069 Ga0495672_0077069_821_1750 300
238 3300048909 Ga0496106_0068248 Ga0496106_0068248_1123_2052 300
239 3300048910 Ga0496107_0072786 Ga0496107_0072786_1267_2196 300
240 3300048916 Ga0496113_0160820 Ga0496113_0160820_276_1235 300
241 3300048920 Ga0496117_0000016 Ga0496117_0000016_279493_280452 300
242 3300048920 Ga0496117_0002721 Ga0496117_0002721_14693_15622 300
243 3300048920 Ga0496117_0005071 Ga0496117_0005071_1188_2117 300
244 3300048921 Ga0496118_0001242 Ga0496118_0001242_28292_29251 300
245 3300048921 Ga0496118_0050791 Ga0496118_0050791_1323_2252 300
246 3300048923 Ga0496120_0000772 Ga0496120_0000772_30555_31514 300
247 3300048924 Ga0496121_0003679 Ga0496121_0003679_14682_15611 300
248 3300048925 Ga0496122_0000002 Ga0496122_0000002_280154_281113 300
249 3300048925 Ga0496122_0000414 Ga0496122_0000414_82719_83648 300
250 3300048925 Ga0496122_0113995 Ga0496122_0113995_364_1293 300
251 3300048926 Ga0496123_0000002 Ga0496123_0000002_1530570_1531529 300
252 3300048926 Ga0496123_0000002 Ga0496123_0000002_280154_281113 300
253 3300048926 Ga0496123_0000839 Ga0496123_0000839_15188_16117 300
254 3300048927 Ga0496124_0004816 Ga0496124_0004816_12835_13794 300
255 3300048927 Ga0496124_0008171 Ga0496124_0008171_5635_6564 300
256 3300048928 Ga0496125_0002982 Ga0496125_0002982_9936_10865 300
257 3300048928 Ga0496125_0022980 Ga0496125_0022980_1546_2475 300
258 3300048929 Ga0496126_0000188 Ga0496126_0000188_46047_46976 300
259 3300048929 Ga0496126_0118045 Ga0496126_0118045_254_1213 300
260 3300048929 Ga0496126_0121049 Ga0496126_0121049_76_1005 300
261 3300049460 Ga0495682_0051786 Ga0495682_0051786_115_1047 300
262 3300050490 nmdc:mga03n38_141312_c1 nmdc:mga03n38_141312_c1_91_1050 300
263 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_59363_60322 300
264 3300050492 nmdc:mga0yw44_19672_c1 nmdc:mga0yw44_19672_c1_2338_3297 300
265 3300050493 nmdc:mga0k408_56128_c1 nmdc:mga0k408_56128_c1_382_1341 300
266 3300050494 nmdc:mga06z11_48091_c1 nmdc:mga06z11_48091_c1_484_1443 300
267 3300050511 nmdc:mga08y16_37_c1 nmdc:mga08y16_37_c1_32546_33475 300
268 3300050516 nmdc:mga0sz30_213_c1 nmdc:mga0sz30_213_c1_11884_12843 300
269 3300053079 Ga0500610_0072706 Ga0500610_0072706_581_1513 300
270 3300053105 Ga0500557_019811 Ga0500557_019811_383_1315 300
271 3300053107 Ga0500560_002637 Ga0500560_002637_1751_2710 300
272 3300053111 Ga0500572_006065 Ga0500572_006065_1171_2109 300
273 3300053134 Ga0500658_0094217 Ga0500658_0094217_195_1127 300
274 3300053137 Ga0500561_0000086 Ga0500561_0000086_15173_16132 300
275 3300053139 Ga0500568_0000543 Ga0500568_0000543_12263_13192 300
276 3300053139 Ga0500568_0006569 Ga0500568_0006569_274_1206 300
277 3300053153 Ga0500616_0003759 Ga0500616_0003759_8089_9018 300
278 3300053157 Ga0500624_000238 Ga0500624_000238_17565_18524 300
279 3300053158 Ga0500627_0025352 Ga0500627_0025352_569_1501 300
280 3300053161 Ga0500634_0143397 Ga0500634_0143397_72_1097 300
281 3300053177 Ga0500636_0000205 Ga0500636_0000205_30500_31438 300
282 3300053730 Ga0500645_015272 Ga0500645_015272_243_1175 300
283 iso_pu_bacteria 2537561587 2537873120 300
284 iso_pu_bacteria 2554235003 2554244466 300
285 iso_pu_bacteria 2558860242 2559297688 300
286 iso_pu_bacteria 2597489875 2597810393 300
287 iso_pu_bacteria 2599185156 2599336447 300
288 iso_pu_bacteria 2599185210 2599603753 300
289 iso_pu_bacteria 2600255279 2601612482 300
290 iso_pu_bacteria 2600255308 2601749023 300
291 iso_pu_bacteria 2643221582 2643917483 300
292 iso_pu_bacteria 2643221693 2644522657 300
293 iso_pu_bacteria 2775507049 2776910355 300
294 iso_pu_bacteria 2808606387 2808989199 300
295 iso_pu_bacteria 2838661181 2838662409 300
296 iso_pu_bacteria 2838675328 2838679878 300
297 iso_pu_bacteria 2838714209 2838717675 300
298 iso_pu_bacteria 2838719591 2838724449 300
299 iso_pu_bacteria 2838724970 2838729609 300
300 iso_pu_bacteria 2841846520 2841850048 300
301 iso_pu_bacteria 2841859092 2841861167 300
302 iso_pu_bacteria 2842124991 2842128520 300
303 iso_pu_bacteria 2842130223 2842134560 300
304 iso_pu_bacteria 2842152218 2842156608 300
305 iso_pu_bacteria 2842170452 2842173920 300
306 iso_pu_bacteria 2842175837 2842180229 300
307 iso_pu_bacteria 2842187318 2842192228 300
308 iso_pu_bacteria 2842211629 2842216492 300
309 iso_pu_bacteria 2842224351 2842229264 300
310 iso_pu_bacteria 2842515876 2842518566 300
311 iso_pu_bacteria 2842922631 2842927470 300
312 iso_pu_bacteria 2847670302 2847673362 300
313 iso_pu_bacteria 2854896431 2854898972 300
314 iso_pu_bacteria 2856314179 2856319169 300
315 iso_pu_bacteria 2856342000 2856342840 300
316 iso_pu_bacteria 2856349417 2856354870 300
317 iso_pu_bacteria 2871495908 2871502299 300
318 iso_pu_bacteria 2878035449 2878039558 300
319 iso_pu_bacteria 2878760144 2878766190 300
320 iso_pu_bacteria 2878767105 2878773391 300
321 iso_pu_bacteria 2881155292 2881159190 300
322 iso_pu_bacteria 2885342637 2885344605 300
323 iso_pu_bacteria 2885350715 2885355665 300
324 iso_pu_bacteria 2888343758 2888344180 300
325 iso_pu_bacteria 2889790730 2889792029 300
326 iso_pu_bacteria 2889914905 2889918342 300
327 iso_pu_bacteria 2894817345 2894817636 300
328 iso_pu_bacteria 2898795034 2898796595 300
329 iso_pu_bacteria 2899792073 2899793073 300
330 iso_pu_bacteria 2899845264 2899849725 300
331 iso_pu_bacteria 2903540706 2903547236 300
332 iso_pu_bacteria 2906414383 2906419241 300
333 iso_pu_bacteria 2919114240 2919117955 300
334 iso_pu_bacteria 2924754689 2924756971 300
335 iso_pu_bacteria 2926754445 2926757724 300
336 iso_pu_bacteria 2926760298 2926764651 300
337 iso_pu_bacteria 2933006813 2933010339 300
338 iso_pu_bacteria 2933011516 2933014192 300
339 iso_pu_bacteria 2933016740 2933021237 300
340 iso_pu_bacteria 2937994558 2938001099 300
341 iso_pu_bacteria 2958165035 2958171365 300
342 iso_pu_bacteria 2961127735 2961131469 300
343 iso_pu_bacteria 2961163497 2961169806 300
344 iso_pu_bacteria 2965018300 2965024566 300
345 iso_pu_bacteria 2968171901 2968178198 300
346 iso_pu_bacteria 2970524798 2970525891 300
347 iso_pu_bacteria 2970540015 2970544448 300
348 iso_pu_bacteria 2970554993 2970561044 300
349 iso_pu_bacteria 2977864932 2977870234 300
350 iso_pu_bacteria 2979089926 2979090238 300
351 iso_pu_bacteria 2979095461 2979095768 300
352 iso_pu_bacteria 2987659509 2987666030 300
353 iso_pu_bacteria 3004188549 3004195053 300
354 iso_pu_bacteria 3005416602 3005421411 300
355 iso_pu_bacteria 650716007 650844133 300
356 iso_pu_bacteria 8003570095 8003573321 300
357 3300028794 Ga0307515_10023797 Ga0307515_100237973 301
358 3300031507 Ga0307509_10120006 Ga0307509_101200062 301
359 3300053177 Ga0500636_0106029 Ga0500636_0106029_560_1489 301
360 iso_pu_bacteria 2558860983 2561467503 301
361 iso_pu_bacteria 8056875544 8056877600 301
362 3300005983 Ga0081540_1055519 Ga0081540_10555192 303
363 3300049575 Ga0501039_0071955 Ga0501039_0071955_455_1396 303
364 3300053119 Ga0500595_015258 Ga0500595_015258_1910_2866 303
365 3300005347 Ga0070668_100164544 Ga0070668_1001645442 304
366 3300005983 Ga0081540_1004077 Ga0081540_10040777 304
367 3300006042 Ga0075368_10037305 Ga0075368_100373051 304
368 3300006051 Ga0075364_10000126 Ga0075364_1000012616 304
369 3300006178 Ga0075367_10098097 Ga0075367_100980971 304
370 3300009093 Ga0105240_10040055 Ga0105240_100400555 304
371 3300025913 Ga0207695_10035204 Ga0207695_100352041 304
372 3300028379 Ga0268266_10020433 Ga0268266_100204334 304
373 3300032005 Ga0307411_10065501 Ga0307411_100655012 304
374 3300037418 Ga0395900_0189803 Ga0395900_0189803_265_1206 304
375 3300046558 Ga0495633_0087591 Ga0495633_0087591_449_1390 304
376 3300048907 Ga0496104_0036453 Ga0496104_0036453_2039_2983 304
377 3300048919 Ga0496116_0016249 Ga0496116_0016249_1300_2244 304
378 3300048920 Ga0496117_0000277 Ga0496117_0000277_11609_12553 304
379 3300048921 Ga0496118_0003364 Ga0496118_0003364_8302_9246 304
380 3300048921 Ga0496118_0003748 Ga0496118_0003748_3734_4690 304
381 3300048923 Ga0496120_0003367 Ga0496120_0003367_11035_11979 304
382 3300048924 Ga0496121_0000005 Ga0496121_0000005_409073_410185 304
383 3300048925 Ga0496122_0000193 Ga0496122_0000193_127172_128116 304
384 3300048925 Ga0496122_0000809 Ga0496122_0000809_8452_9396 304
385 3300048926 Ga0496123_0000154 Ga0496123_0000154_127172_128116 304
386 3300048926 Ga0496123_0000587 Ga0496123_0000587_8452_9396 304
387 3300048927 Ga0496124_0000500 Ga0496124_0000500_54861_55805 304
388 3300048927 Ga0496124_0090608 Ga0496124_0090608_338_1282 304
389 3300048928 Ga0496125_0000417 Ga0496125_0000417_70080_71024 304
390 3300048928 Ga0496125_0003920 Ga0496125_0003920_11042_11986 304
391 3300048928 Ga0496125_0048013 Ga0496125_0048013_471_1427 304
392 3300048929 Ga0496126_0000574 Ga0496126_0000574_13566_14510 304
393 3300048929 Ga0496126_0001037 Ga0496126_0001037_11194_12138 304
394 3300050491 nmdc:mga00v17_168_c1 nmdc:mga00v17_168_c1_18238_19350 304
395 3300053161 Ga0500634_0091328 Ga0500634_0091328_87_1028 304
396 iso_pu_bacteria 2841859092 2841862948 304
397 iso_pu_bacteria 2842515876 2842519535 304
398 iso_pu_bacteria 2933011516 2933011858 304
399 3300006048 Ga0075363_100026368 Ga0075363_1000263683 305
400 3300006048 Ga0075363_100040160 Ga0075363_1000401602 305
401 3300006178 Ga0075367_10097285 Ga0075367_100972852 305
402 3300031548 Ga0307408_100026586 Ga0307408_1000265863 305
403 3300049571 Ga0501034_0085484 Ga0501034_0085484_184_1125 305
404 3300050489 nmdc:mga03683_12203_c1 nmdc:mga03683_12203_c1_2051_3040 305
405 3300050489 nmdc:mga03683_129981_c1 nmdc:mga03683_129981_c1_164_1105 305
406 3300060346 Ga0587111_0007275 Ga0587111_0007275_184_1131 305
407 3300001990 JGI24737J22298_10025172 JGI24737J22298_100251722 309
408 3300005327 Ga0070658_10022529 Ga0070658_100225294 309
409 3300005339 Ga0070660_100007424 Ga0070660_1000074246 309
410 3300005356 Ga0070674_100024976 Ga0070674_1000249763 309
411 3300005364 Ga0070673_100146666 Ga0070673_1001466662 309
412 3300005457 Ga0070662_100314493 Ga0070662_1003144931 309
413 3300005539 Ga0068853_100184807 Ga0068853_1001848072 309
414 3300005543 Ga0070672_100203077 Ga0070672_1002030771 309
415 3300005548 Ga0070665_100172678 Ga0070665_1001726782 309
416 3300005578 Ga0068854_100148515 Ga0068854_1001485152 309
417 3300005614 Ga0068856_100027277 Ga0068856_1000272773 309
418 3300006358 Ga0068871_100213028 Ga0068871_1002130282 309
419 3300011119 Ga0105246_10047710 Ga0105246_100477103 309
420 3300013297 Ga0157378_10115160 Ga0157378_101151601 309
421 3300014497 Ga0182008_10108424 Ga0182008_101084241 309
422 3300025909 Ga0207705_10019453 Ga0207705_100194534 309
423 3300025920 Ga0207649_10045922 Ga0207649_100459222 309
424 3300025932 Ga0207690_10038375 Ga0207690_100383752 309
425 3300025937 Ga0207669_10101359 Ga0207669_101013592 309
426 3300025949 Ga0207667_10173831 Ga0207667_101738312 309
427 3300025960 Ga0207651_10233282 Ga0207651_102332822 309
428 3300025981 Ga0207640_10009959 Ga0207640_100099594 309
429 3300026023 Ga0207677_10128969 Ga0207677_101289692 309
430 3300026041 Ga0207639_10179170 Ga0207639_101791702 309
431 3300026089 Ga0207648_10058818 Ga0207648_100588183 309
432 3300026116 Ga0207674_10031245 Ga0207674_100312453 309
433 3300026142 Ga0207698_10198271 Ga0207698_101982712 309
434 3300034957 Ga0373938_0012485 Ga0373938_0012485_14_967 309
435 3300059645 Ga0587076_025058 Ga0587076_025058_10_963 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

80

346

0.95

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

77

360

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsq-assembly2.cif.gz_B permutated n-terminal lobe of the ribose binding protein from thermotoga maritima 0.9212 25 114
2fn9-assembly2.cif.gz_B thermotoga maritima ribose binding protein unliganded form 0.907 26 299
5dte-assembly3.cif.gz_C crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose 0.8903 25 305
8fxt-assembly1.cif.gz_A escherichia coli periplasmic glucose-binding protein glucose complex: acrylodan conjugate attached at w183c 0.8897 24 304
4yo7-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi-511484) with bound myo-inositol 0.8864 25 309
ID Description Score Start End Superfamily
af_P02925_28_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9564 27 116 3.40.50.2300
4irxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9424 26 115 3.40.50.2300
af_P39325_23_126_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9313 25 115 3.30.420.40
4rxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9223 27 113 3.40.50.2300
4yv7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9096 24 127 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3HBY6-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9302 24 112 GO:0030246
GO:0030313
AF-A0A382UZY7-F1-model_v4 Periplasmic binding protein domain-containing protein 0.9279 23 108 GO:0030246
GO:0030288
AF-A0A358APE1-F1-model_v4 D-galactose/methyl-galactoside binding periplasmic protein MglB 0.9095 30 305 GO:0030246
GO:0030288
GO:0046872
AF-A0A7V2UJU1-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9064 21 309 GO:0030246
GO:0030313
AF-A0A2E3KDK1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8969 24 307 GO:0000155
GO:0003700
GO:0016020
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.28 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map