F443284

General Info

Members Datasets Scaffolds Average Seq Length
435 259 870 112

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_101247601|Ga0070693_1012476011
Length 133
Sequence MRYVCLIYDEEKKLGTMSKEEANGFMGAYFQFTEEIKKNGNYVAGEALQPIQSATSLRHRAGKLSTTDGPFMETKEQLGGFYLIEARDLNEALQIASRIPSVKTGTIEVRPVVDFSTQQQPPRAGREAAGATT

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 1.38
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_101247601 3300005547 Bacteria 573
2 JGI26141J51220_1001229 3300003503 Bacteria 1540
3 Ga0065704_10324303 3300005289 Unclassified 848
4 Ga0065712_10205465 3300005290 Bacteria 1092
5 Ga0065712_10387188 3300005290 Bacteria 745
6 Ga0065715_10232074 3300005293 Bacteria 1230
7 Ga0065707_10250772 3300005295 Bacteria 1126
8 Ga0065707_10657255 3300005295 Bacteria 660
9 Ga0070676_10452182 3300005328 Unclassified 903
10 Ga0070690_100016014 3300005330 Bacteria 4483
11 Ga0070690_100677683 3300005330 Unclassified 790
12 Ga0070670_100013091 3300005331 Bacteria 7106
13 Ga0070670_100015373 3300005331 Bacteria 6572
14 Ga0070677_10266798 3300005333 Bacteria 857
15 Ga0068869_100244432 3300005334 Bacteria 1431
16 Ga0068869_100777916 3300005334 Bacteria 821
17 Ga0068869_100892643 3300005334 Bacteria 769
18 Ga0070666_10425990 3300005335 Unclassified 956
19 Ga0070680_100209287 3300005336 Bacteria 1645
20 Ga0070682_100363616 3300005337 Bacteria 1083
21 Ga0070682_100756537 3300005337 Bacteria 785
22 Ga0070660_100774295 3300005339 Bacteria 806
23 Ga0070689_100113732 3300005340 Bacteria 2155
24 Ga0070689_100194082 3300005340 Bacteria 1654
25 Ga0070689_101497197 3300005340 Bacteria 611
26 Ga0070687_100004414 3300005343 Bacteria 5606
27 Ga0070661_100641110 3300005344 Bacteria 862
28 Ga0070692_10702699 3300005345 Bacteria 680
29 Ga0070692_10727021 3300005345 Bacteria 671
30 Ga0070692_11207675 3300005345 Bacteria 539
31 Ga0070668_100025542 3300005347 Bacteria 4480
32 Ga0070668_100766828 3300005347 Bacteria 855
33 Ga0070669_100010329 3300005353 Bacteria 6630
34 Ga0070675_100002435 3300005354 Bacteria 13896
35 Ga0070675_100010658 3300005354 Bacteria 7186
36 Ga0070675_101094585 3300005354 Bacteria 733
37 Ga0070671_100017253 3300005355 Bacteria 5845
38 Ga0070674_100820895 3300005356 Bacteria 804
39 Ga0070674_101079068 3300005356 Bacteria 708
40 Ga0070673_100050876 3300005364 Bacteria 3241
41 Ga0070673_100058364 3300005364 Bacteria 3051
42 Ga0070673_100342506 3300005364 Bacteria 1325
43 Ga0070688_100044157 3300005365 Bacteria 2749
44 Ga0070688_100478677 3300005365 Unclassified 935
45 Ga0070659_100369018 3300005366 Bacteria 1207
46 Ga0070667_100399902 3300005367 Bacteria 1250
47 Ga0070667_101425472 3300005367 Bacteria 650
48 Ga0070703_10116851 3300005406 Unclassified 962
49 Ga0070703_10235473 3300005406 Unclassified 736
50 Ga0070709_11344836 3300005434 Bacteria 577
51 Ga0070701_10016930 3300005438 Bacteria 3400
52 Ga0070705_100143366 3300005440 Bacteria 1575
53 Ga0070705_100429460 3300005440 Bacteria 986
54 Ga0070705_101760051 3300005440 Unclassified 525
55 Ga0070700_100217120 3300005441 Bacteria 1353
56 Ga0070700_100762063 3300005441 Bacteria 776
57 Ga0070694_100004094 3300005444 Bacteria 8750
58 Ga0070694_101243749 3300005444 Bacteria 625
59 Ga0070694_101260626 3300005444 Bacteria 621
60 Ga0070663_100756993 3300005455 Unclassified 830
61 Ga0070678_100922690 3300005456 Bacteria 799
62 Ga0070678_101075115 3300005456 Unclassified 742
63 Ga0070662_100055294 3300005457 Bacteria 2879
64 Ga0070662_100159750 3300005457 Bacteria 1762
65 Ga0070662_100539847 3300005457 Bacteria 976
66 Ga0070662_101533656 3300005457 Bacteria 575
67 Ga0070681_10256797 3300005458 Bacteria 1659
68 Ga0070681_11969820 3300005458 Unclassified 512
69 Ga0068867_100023342 3300005459 Bacteria 4428
70 Ga0068867_100426211 3300005459 Bacteria 1125
71 Ga0068867_100632133 3300005459 Unclassified 937
72 Ga0070707_100549532 3300005468 Unclassified 1117
73 Ga0070707_100712223 3300005468 Bacteria 967
74 Ga0070707_101505008 3300005468 Bacteria 640
75 Ga0070698_100140309 3300005471 Bacteria 2368
76 Ga0070698_100141983 3300005471 Unclassified 2352
77 Ga0070698_100579544 3300005471 Bacteria 1062
78 Ga0070699_100097653 3300005518 Unclassified 2573
79 Ga0070679_100316515 3300005530 Bacteria 1510
80 Ga0070684_100243537 3300005535 Bacteria 1643
81 Ga0070684_101427542 3300005535 Bacteria 652
82 Ga0070672_100073446 3300005543 Bacteria 2726
83 Ga0070672_100197383 3300005543 Bacteria 1682
84 Ga0070672_100230719 3300005543 Bacteria 1555
85 Ga0070672_100393485 3300005543 Bacteria 1187
86 Ga0070672_101428224 3300005543 Bacteria 619
87 Ga0070686_100290600 3300005544 Bacteria 1209
88 Ga0070695_100000877 3300005545 Bacteria 16205
89 Ga0070696_100120846 3300005546 Bacteria 1896
90 Ga0070696_101073215 3300005546 Bacteria 676
91 Ga0070696_101191609 3300005546 Bacteria 643
92 Ga0070665_100007329 3300005548 Bacteria 11222
93 Ga0070704_100008575 3300005549 Bacteria 6139
94 Ga0070704_100032275 3300005549 Bacteria 3530
95 Ga0070664_100028796 3300005564 Bacteria 4625
96 Ga0070664_100548032 3300005564 Bacteria 1069
97 Ga0070664_100726862 3300005564 Bacteria 926
98 Ga0068857_100025046 3300005577 Bacteria 5256
99 Ga0068857_100142932 3300005577 Bacteria 2164
100 Ga0068852_101713628 3300005616 Bacteria 651
101 Ga0068859_100033204 3300005617 Bacteria 5183
102 Ga0068859_100091298 3300005617 Bacteria 3096
103 Ga0068864_100197866 3300005618 Bacteria 1845
104 Ga0068864_102619793 3300005618 Bacteria 510
105 Ga0068861_100002036 3300005719 Bacteria 13092
106 Ga0068870_10010236 3300005840 Bacteria 4298
107 Ga0068870_10042991 3300005840 Bacteria 2355
108 Ga0068870_10231996 3300005840 Bacteria 1135
109 Ga0068863_100303592 3300005841 Bacteria 1549
110 Ga0068863_100475809 3300005841 Bacteria 1228
111 Ga0068858_100016232 3300005842 Bacteria 6995
112 Ga0068858_100059437 3300005842 Bacteria 3533
113 Ga0068858_100122295 3300005842 Bacteria 2435
114 Ga0068858_101407561 3300005842 Bacteria 687
115 Ga0068860_100014399 3300005843 Bacteria 7749
116 Ga0068860_100133881 3300005843 Bacteria 2380
117 Ga0068860_100779594 3300005843 Unclassified 969
118 Ga0068862_100015307 3300005844 Bacteria 6370
119 Ga0068862_102501058 3300005844 Bacteria 528
120 Ga0068862_102589213 3300005844 Bacteria 519
121 Ga0081539_10113949 3300005985 Bacteria 1355
122 Ga0081539_10194395 3300005985 Bacteria 942
123 Ga0075432_10505796 3300006058 Unclassified 539
124 Ga0097621_100350005 3300006237 Bacteria 1314
125 Ga0068871_100223958 3300006358 Bacteria 1630
126 Ga0068871_100829945 3300006358 Bacteria 853
127 Ga0075428_100013009 3300006844 Bacteria 9251
128 Ga0075428_100055112 3300006844 Bacteria 4357
129 Ga0075428_100517678 3300006844 Bacteria 1276
130 Ga0075430_100077570 3300006846 Bacteria 2785
131 Ga0075430_100294755 3300006846 Bacteria 1342
132 Ga0075431_100008077 3300006847 Bacteria 10505
133 Ga0075433_10412973 3300006852 Bacteria 1190
134 Ga0075433_10450125 3300006852 Bacteria 1135
135 Ga0075434_100122627 3300006871 Bacteria 2615
136 Ga0075434_100915626 3300006871 Bacteria 891
137 Ga0075429_100047436 3300006880 Bacteria 3737
138 Ga0075429_100176581 3300006880 Unclassified 1871
139 Ga0075429_100958908 3300006880 Unclassified 748
140 Ga0068865_100342270 3300006881 Unclassified 1209
141 Ga0068865_100516032 3300006881 Bacteria 999
142 Ga0075436_100023429 3300006914 Bacteria 4241
143 Ga0075436_100089914 3300006914 Bacteria 2134
144 Ga0097620_100033203 3300006931 Bacteria 5183
145 Ga0097620_100091301 3300006931 Bacteria 3096
146 Ga0105240_10526671 3300009093 Bacteria 1311
147 Ga0111539_10004603 3300009094 Bacteria 18020
148 Ga0111539_10219600 3300009094 Bacteria 2214
149 Ga0111539_10944338 3300009094 Bacteria 1003
150 Ga0111539_11628942 3300009094 Bacteria 748
151 Ga0111539_11717986 3300009094 Unclassified 728
152 Ga0111539_12017738 3300009094 Bacteria 669
153 Ga0111539_13019964 3300009094 Bacteria 544
154 Ga0105247_10005669 3300009101 Bacteria 7826
155 Ga0114129_10005499 3300009147 Bacteria 17911
156 Ga0114129_10017513 3300009147 Bacteria 10201
157 Ga0114129_10138609 3300009147 Bacteria 3337
158 Ga0114129_10184570 3300009147 Bacteria 2836
159 Ga0114129_10851729 3300009147 Bacteria 1159
160 Ga0114129_11064119 3300009147 Bacteria 1015
161 Ga0105243_10074573 3300009148 Bacteria 2752
162 Ga0105241_10808186 3300009174 Bacteria 864
163 Ga0105242_12117518 3300009176 Bacteria 607
164 Ga0105242_12992658 3300009176 Bacteria 523
165 Ga0105248_10100286 3300009177 Unclassified 3263
166 Ga0105238_10937102 3300009551 Bacteria 885
167 Ga0105249_10002720 3300009553 Bacteria 15285
168 Ga0105246_10955309 3300011119 Bacteria 773
169 Ga0157371_10045930 3300013102 Bacteria 3107
170 Ga0157374_10293058 3300013296 Unclassified 1609
171 Ga0157374_11114373 3300013296 Bacteria 810
172 Ga0157378_10712128 3300013297 Unclassified 1024
173 Ga0163162_10235679 3300013306 Unclassified 1961
174 Ga0163162_12579233 3300013306 Bacteria 585
175 Ga0157372_10061735 3300013307 Bacteria 4197
176 Ga0157375_10125116 3300013308 Bacteria 2685
177 Ga0157375_10254312 3300013308 Bacteria 1918
178 Ga0157375_10553245 3300013308 Bacteria 1312
179 Ga0157375_12069111 3300013308 Bacteria 677
180 Ga0157380_10172009 3300014326 Bacteria 1894
181 Ga0157380_11054641 3300014326 Bacteria 849
182 Ga0157377_10073892 3300014745 Bacteria 1977
183 Ga0157377_10624274 3300014745 Unclassified 772
184 Ga0157379_10017793 3300014968 Bacteria 6260
185 Ga0157379_10037620 3300014968 Bacteria 4316
186 Ga0157376_10167647 3300014969 Bacteria 1997
187 Ga0157376_10510839 3300014969 Bacteria 1183
188 Ga0213874_10226051 3300021377 Unclassified 682
189 Ga0207666_1054225 3300025271 Unclassified 638
190 Ga0207697_10184569 3300025315 Bacteria 915
191 Ga0207697_10308031 3300025315 Bacteria 703
192 Ga0207653_10192273 3300025885 Unclassified 767
193 Ga0207682_10159007 3300025893 Bacteria 1023
194 Ga0207710_10195656 3300025900 Bacteria 997
195 Ga0207688_10045351 3300025901 Bacteria 2452
196 Ga0207688_10344382 3300025901 Bacteria 917
197 Ga0207645_11138778 3300025907 Bacteria 525
198 Ga0207643_10002617 3300025908 Bacteria 9743
199 Ga0207643_10048192 3300025908 Bacteria 2413
200 Ga0207660_10280139 3300025917 Bacteria 1323
201 Ga0207662_10004260 3300025918 Bacteria 7505
202 Ga0207657_10081086 3300025919 Bacteria 2726
203 Ga0207657_11247724 3300025919 Bacteria 563
204 Ga0207646_10130987 3300025922 Bacteria 2257
205 Ga0207646_10392320 3300025922 Bacteria 1254
206 Ga0207681_10023676 3300025923 Bacteria 3931
207 Ga0207650_10105281 3300025925 Bacteria 2177
208 Ga0207659_10002232 3300025926 Bacteria 11537
209 Ga0207659_10051204 3300025926 Bacteria 2936
210 Ga0207706_10022095 3300025933 Bacteria 5709
211 Ga0207706_10173366 3300025933 Bacteria 1895
212 Ga0207706_10808615 3300025933 Bacteria 796
213 Ga0207709_10041662 3300025935 Bacteria 2757
214 Ga0207670_10029889 3300025936 Bacteria 3475
215 Ga0207670_10054870 3300025936 Bacteria 2690
216 Ga0207669_11425675 3300025937 Unclassified 590
217 Ga0207704_10308293 3300025938 Unclassified 1216
218 Ga0207704_10984964 3300025938 Bacteria 712
219 Ga0207691_10133391 3300025940 Bacteria 2192
220 Ga0207691_10202165 3300025940 Bacteria 1729
221 Ga0207691_10227251 3300025940 Bacteria 1617
222 Ga0207711_10041043 3300025941 Bacteria 3939
223 Ga0207711_10136774 3300025941 Bacteria 2201
224 Ga0207711_10906379 3300025941 Unclassified 819
225 Ga0207689_10180034 3300025942 Bacteria 1743
226 Ga0207689_10198425 3300025942 Bacteria 1656
227 Ga0207689_10272812 3300025942 Bacteria 1400
228 Ga0207689_10372201 3300025942 Bacteria 1189
229 Ga0207679_10014980 3300025945 Bacteria 5110
230 Ga0207679_11220905 3300025945 Bacteria 690
231 Ga0207651_10037135 3300025960 Bacteria 3189
232 Ga0207651_10096640 3300025960 Bacteria 2179
233 Ga0207712_10004553 3300025961 Bacteria 8747
234 Ga0207668_10031801 3300025972 Bacteria 3481
235 Ga0207668_10667744 3300025972 Bacteria 911
236 Ga0207640_10483135 3300025981 Unclassified 1028
237 Ga0207658_10113049 3300025986 Bacteria 2151
238 Ga0207703_10044054 3300026035 Bacteria 3584
239 Ga0207703_10050779 3300026035 Bacteria 3358
240 Ga0207703_12244438 3300026035 Unclassified 522
241 Ga0207708_10050120 3300026075 Bacteria 3179
242 Ga0207708_10215322 3300026075 Bacteria 1537
243 Ga0207708_10366046 3300026075 Bacteria 1186
244 Ga0207641_11712770 3300026088 Bacteria 630
245 Ga0207648_10001634 3300026089 Bacteria 24557
246 Ga0207648_10208667 3300026089 Bacteria 1733
247 Ga0207648_10568578 3300026089 Bacteria 1043
248 Ga0207676_10117089 3300026095 Unclassified 2240
249 Ga0207676_10262797 3300026095 Unclassified 1559
250 Ga0207676_11979601 3300026095 Bacteria 581
251 Ga0207674_10122456 3300026116 Bacteria 2567
252 Ga0207674_10160616 3300026116 Bacteria 2202
253 Ga0207674_10233445 3300026116 Bacteria 1787
254 Ga0207674_11957473 3300026116 Bacteria 552
255 Ga0207675_100008997 3300026118 Bacteria 9370
256 Ga0207675_100150712 3300026118 Bacteria 2213
257 Ga0207683_10961055 3300026121 Bacteria 793
258 Ga0207698_11050214 3300026142 Bacteria 826
259 Ga0207698_11690036 3300026142 Unclassified 648
260 Ga0209973_1077416 3300027252 Bacteria 526
261 Ga0209969_1008293 3300027360 Bacteria 1472
262 Ga0209967_1002019 3300027364 Bacteria 2618
263 Ga0209996_1005171 3300027395 Bacteria 1671
264 Ga0210000_1002183 3300027462 Bacteria 2776
265 Ga0209995_1003068 3300027471 Bacteria 2652
266 Ga0209968_1003380 3300027526 Bacteria 2397
267 Ga0209999_1024122 3300027543 Bacteria 1122
268 Ga0209982_1037926 3300027552 Bacteria 766
269 Ga0210002_1019160 3300027617 Bacteria 1097
270 Ga0210002_1020541 3300027617 Bacteria 1064
271 Ga0209971_1000004 3300027682 Bacteria 110041
272 Ga0209966_1000230 3300027695 Bacteria 21304
273 Ga0209998_10000022 3300027717 Bacteria 70281
274 Ga0209974_10006713 3300027876 Bacteria 3996
275 Ga0209974_10420137 3300027876 Bacteria 527
276 Ga0207428_10010852 3300027907 Bacteria 8118
277 Ga0207428_10301741 3300027907 Bacteria 1185
278 Ga0268266_10011453 3300028379 Bacteria 7711
279 Ga0268266_10660299 3300028379 Bacteria 1007
280 Ga0268265_10000545 3300028380 Bacteria 38390
281 Ga0268265_10733871 3300028380 Bacteria 957
282 Ga0268264_10012043 3300028381 Bacteria 7120
283 Ga0268264_10709437 3300028381 Unclassified 1000
284 Ga0307408_100872235 3300031548 Bacteria 822
285 Ga0307405_10487055 3300031731 Bacteria 986
286 Ga0307405_11426836 3300031731 Bacteria 606
287 Ga0307405_11904095 3300031731 Bacteria 530
288 Ga0307413_10532783 3300031824 Bacteria 949
289 Ga0307413_11562183 3300031824 Bacteria 585
290 Ga0307410_10226286 3300031852 Bacteria 1442
291 Ga0326468_10002484 3300031889 Bacteria 1539
292 Ga0307407_10860757 3300031903 Bacteria 693
293 Ga0307409_101016222 3300031995 Bacteria 848
294 Ga0307409_102107274 3300031995 Bacteria 594
295 Ga0307416_100588587 3300032002 Bacteria 1191
296 Ga0307416_101771919 3300032002 Bacteria 722
297 Ga0307416_102950523 3300032002 Bacteria 569
298 Ga0307414_10765005 3300032004 Bacteria 879
299 Ga0307414_11144024 3300032004 Bacteria 720
300 Ga0307411_10263796 3300032005 Bacteria 1362
301 Ga0373949_0010153 3300035090 Bacteria 2062
302 Ga0373952_0190289 3300035092 Bacteria 596
303 Ga0373953_0197645 3300035117 Bacteria 869
304 Ga0373957_0035123 3300035120 Bacteria 1861
305 Ga0373943_0118256 3300035170 Bacteria 1406
306 Ga0373955_0169404 3300035172 Bacteria 1292
307 Ga0373955_0661483 3300035172 Bacteria 641
308 Ga0373961_0027135 3300035241 Bacteria 1570
309 Ga0373962_0033291 3300035242 Bacteria 1422
310 Ga0373931_0171691 3300035691 Bacteria 1278
311 Ga0373935_0451216 3300035692 Bacteria 929
312 Ga0373933_0263342 3300035724 Bacteria 1112
313 Ga0373947_0272497 3300035725 Unclassified 1124
314 Ga0373947_0466497 3300035725 Bacteria 856
315 Ga0373937_0169221 3300036401 Bacteria 2050
316 Ga0436363_1333010 3300039450 Unclassified 729
317 Ga0439453_0055093 3300041408 Bacteria 812
318 Ga0450902_040374 3300042137 Bacteria 794
319 Ga0439435_0015658 3300042436 Bacteria 1890
320 Ga0439435_0106192 3300042436 Bacteria 867
321 Ga0439444_0040274 3300042437 Bacteria 915
322 Ga0439460_0074798 3300042461 Bacteria 1055
323 Ga0453683_0201744 3300044673 Bacteria 1263
324 Ga0466965_0007025 3300044683 Bacteria 5153
325 Ga0466960_0013639 3300044901 Bacteria 3458
326 Ga0451576_0067982 3300045051 Bacteria 3708
327 Ga0451576_1027168 3300045051 Bacteria 864
328 Ga0466967_0524384 3300045976 Bacteria 1164
329 Ga0495629_0471290 3300046459 Bacteria 849
330 Ga0495651_0568552 3300046462 Bacteria 718
331 Ga0495639_0749295 3300046475 Bacteria 505
332 Ga0495662_0133729 3300046476 Bacteria 1220
333 Ga0495585_0144692 3300046492 Bacteria 1243
334 Ga0495630_0203779 3300046517 Bacteria 1510
335 Ga0495642_0104281 3300046528 Bacteria 1209
336 Ga0495640_0071568 3300046533 Bacteria 2327
337 Ga0495586_0097918 3300046535 Bacteria 1625
338 Ga0495587_0156408 3300046536 Bacteria 1298
339 Ga0495587_0714197 3300046536 Bacteria 549
340 Ga0495621_0025113 3300046539 Bacteria 1999
341 Ga0495645_0001662 3300046543 Bacteria 15098
342 Ga0495633_0274771 3300046558 Bacteria 767
343 Ga0495667_0166682 3300046559 Bacteria 1416
344 Ga0495635_0902131 3300046663 Bacteria 566
345 Ga0495659_0014806 3300046664 Bacteria 2558
346 Ga0495659_0016072 3300046664 Bacteria 2466
347 Ga0495659_0089961 3300046664 Bacteria 1177
348 Ga0495659_0196356 3300046664 Bacteria 826
349 Ga0495657_0475359 3300046675 Bacteria 730
350 Ga0495658_0041255 3300046683 Bacteria 2570
351 Ga0495658_0399871 3300046683 Unclassified 876
352 Ga0495658_0490769 3300046683 Bacteria 785
353 Ga0495613_0120066 3300046689 Bacteria 1888
354 Ga0495670_0027259 3300046691 Bacteria 2830
355 Ga0495670_0200031 3300046691 Bacteria 1058
356 Ga0495600_0124133 3300046809 Bacteria 1679
357 Ga0495600_0659948 3300046809 Bacteria 632
358 Ga0495636_0263002 3300047318 Bacteria 800
359 Ga0495680_0061812 3300047322 Bacteria 2880
360 Ga0495677_0186417 3300047445 Bacteria 805
361 Ga0495684_0094039 3300047471 Bacteria 2270
362 Ga0495602_0856605 3300048088 Bacteria 607
363 Ga0496100_0978049 3300048903 Bacteria 666
364 Ga0496104_0275940 3300048907 Bacteria 1594
365 Ga0496106_0194792 3300048909 Bacteria 1612
366 Ga0496107_0731254 3300048910 Bacteria 727
367 Ga0496112_0224919 3300048915 Bacteria 1832
368 Ga0496114_1018421 3300048917 Bacteria 712
369 Ga0501031_0186159 3300049568 Bacteria 1356
370 Ga0501033_0467079 3300049570 Bacteria 875
371 Ga0501034_0146441 3300049571 Bacteria 2339
372 Ga0501036_0866385 3300049572 Bacteria 742
373 Ga0501038_0161081 3300049574 Bacteria 1823
374 Ga0501039_0064457 3300049575 Bacteria 2840
375 Ga0501040_0033517 3300049576 Bacteria 3479
376 Ga0501040_1412297 3300049576 Bacteria 505
377 Ga0501040_1429059 3300049576 Bacteria 502
378 Ga0501041_0381309 3300049577 Bacteria 892
379 Ga0501042_0053284 3300049578 Bacteria 2886
380 Ga0501043_0029652 3300049579 Bacteria 4300
381 Ga0501046_0002578 3300049580 Bacteria 16953
382 Ga0501047_0281736 3300049581 Bacteria 1507
383 Ga0501048_1045647 3300049582 Bacteria 587
384 Ga0501067_0117770 3300049583 Bacteria 1477
385 Ga0501068_0081547 3300049584 Bacteria 1986
386 Ga0501071_0048492 3300049587 Bacteria 3055
387 Ga0501072_0164281 3300049588 Bacteria 1771
388 Ga0501072_0915626 3300049588 Bacteria 685
389 Ga0501073_0153496 3300049589 Bacteria 1596
390 Ga0501074_0013238 3300049590 Bacteria 5998
391 Ga0501074_0285519 3300049590 Bacteria 1173
392 Ga0501076_0126246 3300049592 Bacteria 2073
393 Ga0501077_0052880 3300049593 Bacteria 2578
394 Ga0501224_057540 3300049664 Bacteria 603
395 Ga0501079_0005134 3300049741 Bacteria 9733
396 Ga0501079_0503870 3300049741 Bacteria 952
397 Ga0501080_0136373 3300049742 Bacteria 2271
398 Ga0501080_1117650 3300049742 Bacteria 680
399 Ga0501081_0166459 3300049743 Bacteria 1590
400 Ga0501081_0216890 3300049743 Bacteria 1391
401 Ga0501083_0079790 3300049744 Bacteria 2170
402 Ga0501045_0003036 3300049824 Bacteria 11479
403 nmdc:mga05p37_112984_c1 3300050507 Bacteria 3340
404 nmdc:mga05p37_179107_c1 3300050507 Bacteria 2580
405 nmdc:mga05p37_2275580_c1 3300050507 Bacteria 500
406 nmdc:mga05p37_43533_c1 3300050507 Bacteria 5523
407 nmdc:mga05p37_898405_c1 3300050507 Unclassified 955
408 nmdc:mga05p37_955_c1 3300050507 Bacteria 32691
409 nmdc:mga09592_132677_c1 3300050508 Bacteria 2144
410 nmdc:mga09592_132834_c1 3300050508 Bacteria 2143
411 nmdc:mga09592_263408_c1 3300050508 Bacteria 1495
412 nmdc:mga0qj67_28001_c1 3300050509 Bacteria 2875
413 nmdc:mga0qj67_57566_c1 3300050509 Bacteria 3081
414 nmdc:mga06r32_44562_c1 3300050510 Bacteria 4225
415 nmdc:mga08y16_1027944_c1 3300050511 Bacteria 803
416 nmdc:mga08y16_1945103_c1 3300050511 Bacteria 538
417 nmdc:mga08y16_258692_c1 3300050511 Bacteria 1798
418 nmdc:mga08y16_83271_c1 3300050511 Bacteria 3334
419 nmdc:mga0n895_100808_c1 3300050512 Bacteria 2897
420 nmdc:mga0n895_1089290_c1 3300050512 Bacteria 777
421 nmdc:mga0n895_1864016_c1 3300050512 Bacteria 561
422 nmdc:mga08x19_14097_c1 3300050514 Bacteria 4844
423 nmdc:mga08x19_249637_c1 3300050514 Bacteria 1225
424 nmdc:mga08x19_319640_c1 3300050514 Bacteria 1080
425 nmdc:mga0a205_59063_c1 3300050515 Bacteria 3705
426 Ga0495595_0036792 3300053084 Bacteria 2223
427 Ga0495619_0173773 3300053085 Bacteria 1490
428 Ga0495619_0265741 3300053085 Bacteria 1189
429 Ga0495619_0561912 3300053085 Bacteria 782
430 Ga0500637_0017328 3300053178 Bacteria 3854
431 Ga0501084_0001571 3300054114 Bacteria 18087
432 Ga0501082_0002951 3300060353 Bacteria 14839
433 Ga0501082_0490101 3300060353 Bacteria 1074
434 Ga0530510_0947770 3300061734 Bacteria 658
435 Ga0530510_1105788 3300061734 Bacteria 607
436 Ga0070693_101247601
437 JGI26141J51220_1001229
438 Ga0065704_10324303
439 Ga0065712_10205465
440 Ga0065712_10387188
441 Ga0065715_10232074
442 Ga0065707_10250772
443 Ga0065707_10657255
444 Ga0070676_10452182
445 Ga0070690_100016014
446 Ga0070690_100677683
447 Ga0070670_100013091
448 Ga0070670_100015373
449 Ga0070677_10266798
450 Ga0068869_100244432
451 Ga0068869_100777916
452 Ga0068869_100892643
453 Ga0070666_10425990
454 Ga0070680_100209287
455 Ga0070682_100363616
456 Ga0070682_100756537
457 Ga0070660_100774295
458 Ga0070689_100113732
459 Ga0070689_100194082
460 Ga0070689_101497197
461 Ga0070687_100004414
462 Ga0070661_100641110
463 Ga0070692_10702699
464 Ga0070692_10727021
465 Ga0070692_11207675
466 Ga0070668_100025542
467 Ga0070668_100766828
468 Ga0070669_100010329
469 Ga0070675_100002435
470 Ga0070675_100010658
471 Ga0070675_101094585
472 Ga0070671_100017253
473 Ga0070674_100820895
474 Ga0070674_101079068
475 Ga0070673_100050876
476 Ga0070673_100058364
477 Ga0070673_100342506
478 Ga0070688_100044157
479 Ga0070688_100478677
480 Ga0070659_100369018
481 Ga0070667_100399902
482 Ga0070667_101425472
483 Ga0070703_10116851
484 Ga0070703_10235473
485 Ga0070709_11344836
486 Ga0070701_10016930
487 Ga0070705_100143366
488 Ga0070705_100429460
489 Ga0070705_101760051
490 Ga0070700_100217120
491 Ga0070700_100762063
492 Ga0070694_100004094
493 Ga0070694_101243749
494 Ga0070694_101260626
495 Ga0070663_100756993
496 Ga0070678_100922690
497 Ga0070678_101075115
498 Ga0070662_100055294
499 Ga0070662_100159750
500 Ga0070662_100539847
501 Ga0070662_101533656
502 Ga0070681_10256797
503 Ga0070681_11969820
504 Ga0068867_100023342
505 Ga0068867_100426211
506 Ga0068867_100632133
507 Ga0070707_100549532
508 Ga0070707_100712223
509 Ga0070707_101505008
510 Ga0070698_100140309
511 Ga0070698_100141983
512 Ga0070698_100579544
513 Ga0070699_100097653
514 Ga0070679_100316515
515 Ga0070684_100243537
516 Ga0070684_101427542
517 Ga0070672_100073446
518 Ga0070672_100197383
519 Ga0070672_100230719
520 Ga0070672_100393485
521 Ga0070672_101428224
522 Ga0070686_100290600
523 Ga0070695_100000877
524 Ga0070696_100120846
525 Ga0070696_101073215
526 Ga0070696_101191609
527 Ga0070665_100007329
528 Ga0070704_100008575
529 Ga0070704_100032275
530 Ga0070664_100028796
531 Ga0070664_100548032
532 Ga0070664_100726862
533 Ga0068857_100025046
534 Ga0068857_100142932
535 Ga0068852_101713628
536 Ga0068859_100033204
537 Ga0068859_100091298
538 Ga0068864_100197866
539 Ga0068864_102619793
540 Ga0068861_100002036
541 Ga0068870_10010236
542 Ga0068870_10042991
543 Ga0068870_10231996
544 Ga0068863_100303592
545 Ga0068863_100475809
546 Ga0068858_100016232
547 Ga0068858_100059437
548 Ga0068858_100122295
549 Ga0068858_101407561
550 Ga0068860_100014399
551 Ga0068860_100133881
552 Ga0068860_100779594
553 Ga0068862_100015307
554 Ga0068862_102501058
555 Ga0068862_102589213
556 Ga0081539_10113949
557 Ga0081539_10194395
558 Ga0075432_10505796
559 Ga0097621_100350005
560 Ga0068871_100223958
561 Ga0068871_100829945
562 Ga0075428_100013009
563 Ga0075428_100055112
564 Ga0075428_100517678
565 Ga0075430_100077570
566 Ga0075430_100294755
567 Ga0075431_100008077
568 Ga0075433_10412973
569 Ga0075433_10450125
570 Ga0075434_100122627
571 Ga0075434_100915626
572 Ga0075429_100047436
573 Ga0075429_100176581
574 Ga0075429_100958908
575 Ga0068865_100342270
576 Ga0068865_100516032
577 Ga0075436_100023429
578 Ga0075436_100089914
579 Ga0097620_100033203
580 Ga0097620_100091301
581 Ga0105240_10526671
582 Ga0111539_10004603
583 Ga0111539_10219600
584 Ga0111539_10944338
585 Ga0111539_11628942
586 Ga0111539_11717986
587 Ga0111539_12017738
588 Ga0111539_13019964
589 Ga0105247_10005669
590 Ga0114129_10005499
591 Ga0114129_10017513
592 Ga0114129_10138609
593 Ga0114129_10184570
594 Ga0114129_10851729
595 Ga0114129_11064119
596 Ga0105243_10074573
597 Ga0105241_10808186
598 Ga0105242_12117518
599 Ga0105242_12992658
600 Ga0105248_10100286
601 Ga0105238_10937102
602 Ga0105249_10002720
603 Ga0105246_10955309
604 Ga0157371_10045930
605 Ga0157374_10293058
606 Ga0157374_11114373
607 Ga0157378_10712128
608 Ga0163162_10235679
609 Ga0163162_12579233
610 Ga0157372_10061735
611 Ga0157375_10125116
612 Ga0157375_10254312
613 Ga0157375_10553245
614 Ga0157375_12069111
615 Ga0157380_10172009
616 Ga0157380_11054641
617 Ga0157377_10073892
618 Ga0157377_10624274
619 Ga0157379_10017793
620 Ga0157379_10037620
621 Ga0157376_10167647
622 Ga0157376_10510839
623 Ga0213874_10226051
624 Ga0207666_1054225
625 Ga0207697_10184569
626 Ga0207697_10308031
627 Ga0207653_10192273
628 Ga0207682_10159007
629 Ga0207710_10195656
630 Ga0207688_10045351
631 Ga0207688_10344382
632 Ga0207645_11138778
633 Ga0207643_10002617
634 Ga0207643_10048192
635 Ga0207660_10280139
636 Ga0207662_10004260
637 Ga0207657_10081086
638 Ga0207657_11247724
639 Ga0207646_10130987
640 Ga0207646_10392320
641 Ga0207681_10023676
642 Ga0207650_10105281
643 Ga0207659_10002232
644 Ga0207659_10051204
645 Ga0207706_10022095
646 Ga0207706_10173366
647 Ga0207706_10808615
648 Ga0207709_10041662
649 Ga0207670_10029889
650 Ga0207670_10054870
651 Ga0207669_11425675
652 Ga0207704_10308293
653 Ga0207704_10984964
654 Ga0207691_10133391
655 Ga0207691_10202165
656 Ga0207691_10227251
657 Ga0207711_10041043
658 Ga0207711_10136774
659 Ga0207711_10906379
660 Ga0207689_10180034
661 Ga0207689_10198425
662 Ga0207689_10272812
663 Ga0207689_10372201
664 Ga0207679_10014980
665 Ga0207679_11220905
666 Ga0207651_10037135
667 Ga0207651_10096640
668 Ga0207712_10004553
669 Ga0207668_10031801
670 Ga0207668_10667744
671 Ga0207640_10483135
672 Ga0207658_10113049
673 Ga0207703_10044054
674 Ga0207703_10050779
675 Ga0207703_12244438
676 Ga0207708_10050120
677 Ga0207708_10215322
678 Ga0207708_10366046
679 Ga0207641_11712770
680 Ga0207648_10001634
681 Ga0207648_10208667
682 Ga0207648_10568578
683 Ga0207676_10117089
684 Ga0207676_10262797
685 Ga0207676_11979601
686 Ga0207674_10122456
687 Ga0207674_10160616
688 Ga0207674_10233445
689 Ga0207674_11957473
690 Ga0207675_100008997
691 Ga0207675_100150712
692 Ga0207683_10961055
693 Ga0207698_11050214
694 Ga0207698_11690036
695 Ga0209973_1077416
696 Ga0209969_1008293
697 Ga0209967_1002019
698 Ga0209996_1005171
699 Ga0210000_1002183
700 Ga0209995_1003068
701 Ga0209968_1003380
702 Ga0209999_1024122
703 Ga0209982_1037926
704 Ga0210002_1019160
705 Ga0210002_1020541
706 Ga0209971_1000004
707 Ga0209966_1000230
708 Ga0209998_10000022
709 Ga0209974_10006713
710 Ga0209974_10420137
711 Ga0207428_10010852
712 Ga0207428_10301741
713 Ga0268266_10011453
714 Ga0268266_10660299
715 Ga0268265_10000545
716 Ga0268265_10733871
717 Ga0268264_10012043
718 Ga0268264_10709437
719 Ga0307408_100872235
720 Ga0307405_10487055
721 Ga0307405_11426836
722 Ga0307405_11904095
723 Ga0307413_10532783
724 Ga0307413_11562183
725 Ga0307410_10226286
726 Ga0326468_10002484
727 Ga0307407_10860757
728 Ga0307409_101016222
729 Ga0307409_102107274
730 Ga0307416_100588587
731 Ga0307416_101771919
732 Ga0307416_102950523
733 Ga0307414_10765005
734 Ga0307414_11144024
735 Ga0307411_10263796
736 Ga0373949_0010153
737 Ga0373952_0190289
738 Ga0373953_0197645
739 Ga0373957_0035123
740 Ga0373943_0118256
741 Ga0373955_0169404
742 Ga0373955_0661483
743 Ga0373961_0027135
744 Ga0373962_0033291
745 Ga0373931_0171691
746 Ga0373935_0451216
747 Ga0373933_0263342
748 Ga0373947_0272497
749 Ga0373947_0466497
750 Ga0373937_0169221
751 Ga0436363_1333010
752 Ga0439453_0055093
753 Ga0450902_040374
754 Ga0439435_0015658
755 Ga0439435_0106192
756 Ga0439444_0040274
757 Ga0439460_0074798
758 Ga0453683_0201744
759 Ga0466965_0007025
760 Ga0466960_0013639
761 Ga0451576_0067982
762 Ga0451576_1027168
763 Ga0466967_0524384
764 Ga0495629_0471290
765 Ga0495651_0568552
766 Ga0495639_0749295
767 Ga0495662_0133729
768 Ga0495585_0144692
769 Ga0495630_0203779
770 Ga0495642_0104281
771 Ga0495640_0071568
772 Ga0495586_0097918
773 Ga0495587_0156408
774 Ga0495587_0714197
775 Ga0495621_0025113
776 Ga0495645_0001662
777 Ga0495633_0274771
778 Ga0495667_0166682
779 Ga0495635_0902131
780 Ga0495659_0014806
781 Ga0495659_0016072
782 Ga0495659_0089961
783 Ga0495659_0196356
784 Ga0495657_0475359
785 Ga0495658_0041255
786 Ga0495658_0399871
787 Ga0495658_0490769
788 Ga0495613_0120066
789 Ga0495670_0027259
790 Ga0495670_0200031
791 Ga0495600_0124133
792 Ga0495600_0659948
793 Ga0495636_0263002
794 Ga0495680_0061812
795 Ga0495677_0186417
796 Ga0495684_0094039
797 Ga0495602_0856605
798 Ga0496100_0978049
799 Ga0496104_0275940
800 Ga0496106_0194792
801 Ga0496107_0731254
802 Ga0496112_0224919
803 Ga0496114_1018421
804 Ga0501031_0186159
805 Ga0501033_0467079
806 Ga0501034_0146441
807 Ga0501036_0866385
808 Ga0501038_0161081
809 Ga0501039_0064457
810 Ga0501040_0033517
811 Ga0501040_1412297
812 Ga0501040_1429059
813 Ga0501041_0381309
814 Ga0501042_0053284
815 Ga0501043_0029652
816 Ga0501046_0002578
817 Ga0501047_0281736
818 Ga0501048_1045647
819 Ga0501067_0117770
820 Ga0501068_0081547
821 Ga0501071_0048492
822 Ga0501072_0164281
823 Ga0501072_0915626
824 Ga0501073_0153496
825 Ga0501074_0013238
826 Ga0501074_0285519
827 Ga0501076_0126246
828 Ga0501077_0052880
829 Ga0501224_057540
830 Ga0501079_0005134
831 Ga0501079_0503870
832 Ga0501080_0136373
833 Ga0501080_1117650
834 Ga0501081_0166459
835 Ga0501081_0216890
836 Ga0501083_0079790
837 Ga0501045_0003036
838 nmdc:mga05p37_112984_c1
839 nmdc:mga05p37_179107_c1
840 nmdc:mga05p37_2275580_c1
841 nmdc:mga05p37_43533_c1
842 nmdc:mga05p37_898405_c1
843 nmdc:mga05p37_955_c1
844 nmdc:mga09592_132677_c1
845 nmdc:mga09592_132834_c1
846 nmdc:mga09592_263408_c1
847 nmdc:mga0qj67_28001_c1
848 nmdc:mga0qj67_57566_c1
849 nmdc:mga06r32_44562_c1
850 nmdc:mga08y16_1027944_c1
851 nmdc:mga08y16_1945103_c1
852 nmdc:mga08y16_258692_c1
853 nmdc:mga08y16_83271_c1
854 nmdc:mga0n895_100808_c1
855 nmdc:mga0n895_1089290_c1
856 nmdc:mga0n895_1864016_c1
857 nmdc:mga08x19_14097_c1
858 nmdc:mga08x19_249637_c1
859 nmdc:mga08x19_319640_c1
860 nmdc:mga0a205_59063_c1
861 Ga0495595_0036792
862 Ga0495619_0173773
863 Ga0495619_0265741
864 Ga0495619_0561912
865 Ga0500637_0017328
866 Ga0501084_0001571
867 Ga0501082_0002951
868 Ga0501082_0490101
869 Ga0530510_0947770
870 Ga0530510_1105788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

116

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9652 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9334 1 114
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.7679 1 115
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7582 1 115
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7369 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9652 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9334 1 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8137 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7606 1 115 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7497 1 115 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A839F0G6-F1-model_v4 YCII-related domain-containing protein 0.9945 1 115
AF-A0A1I4LL40-F1-model_v4 Uncharacterized conserved protein 0.9942 1 117
AF-A0A839EQ41-F1-model_v4 YCII-related domain-containing protein 0.9926 2 115
AF-A0A2K8YQV3-F1-model_v4 deleted 0.9925 1 117
AF-A0A7G6SSK5-F1-model_v4 YciI family protein 0.992 1 115

Map