F443281

General Info

Members Datasets Scaffolds Average Seq Length
435 270 870 207

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100278951|Ga0070699_1002789512
Length 235
Sequence MLLDWLTHQQTSLKVDQSTFASVKTGHLMSSISIIGTGNMARAIGALAVAGGNTVEILGRDQSKAADLARALGGSATTGEWGAVPAGDIVIVALLHASVVPVVAQYGDALAGKIIVDISNPFNSAADGLAHREDTSIAQEVAKAAPASASVVKAFNTIFGHVLEKGRPDVFIAGDNAQAKAAVEAFIESLGLRPLDVGGLKMAHWLEGTGLVVMGLARHGVGNWDFALGVTEFPG

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
229 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
230 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
231 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
232 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
233 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
234 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
235 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
236 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
237 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
240 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
243 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
244 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
245 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
248 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
249 2517572101 Frankia sp. DC12 Isolate Nodule
250 2558860280 Kutzneria sp. 744 Isolate Unclassified
251 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
252 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
253 2643221647 Streptomyces sp. Root369 Isolate Unclassified
254 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
255 2687453737 Frankia sp. BMG5.36 Isolate Nodule
256 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
257 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
258 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
259 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
260 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
261 2862574272 Streptomyces sp. AcE210 Isolate Nodule
262 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
263 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
264 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
265 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
266 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
267 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
268 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
269 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
270 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 0.46
Isolates 5.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 1.38
Rhizoplane 9.2
Rhizosphere 69.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100278951 3300005518 Bacteria 1497
2 JGI24740J21852_10026212 3300001979 Bacteria 1955
3 JGI24739J22299_10002752 3300001989 Bacteria 6762
4 JGI24737J22298_10027289 3300001990 Bacteria 1801
5 JGI24738J21930_10028156 3300002075 Bacteria 1150
6 JGI25404J52841_10008005 3300003659 Bacteria 2243
7 Ga0070660_100185554 3300005339 Bacteria 1684
8 Ga0070660_100767776 3300005339 Bacteria 810
9 Ga0070661_100313339 3300005344 Bacteria 1224
10 Ga0070668_100043101 3300005347 Bacteria 3460
11 Ga0070668_100848581 3300005347 Bacteria 814
12 Ga0070671_100686136 3300005355 Bacteria 888
13 Ga0070674_100260982 3300005356 Bacteria 1365
14 Ga0070709_10073514 3300005434 Bacteria 2213
15 Ga0070709_10236973 3300005434 Bacteria 1308
16 Ga0070714_100019981 3300005435 Bacteria 5465
17 Ga0070714_100063694 3300005435 Bacteria 3171
18 Ga0070714_100232678 3300005435 Bacteria 1698
19 Ga0070713_100693880 3300005436 Bacteria 971
20 Ga0070710_10009462 3300005437 Bacteria 4768
21 Ga0070710_10034932 3300005437 Bacteria 2737
22 Ga0070710_10059811 3300005437 Bacteria 2165
23 Ga0070710_10138545 3300005437 Bacteria 1490
24 Ga0070710_10298695 3300005437 Bacteria 1050
25 Ga0070711_100577077 3300005439 Bacteria 936
26 Ga0070711_100702499 3300005439 Bacteria 851
27 Ga0070681_10025424 3300005458 Bacteria 5955
28 Ga0070706_100058870 3300005467 Bacteria 3545
29 Ga0070707_100312461 3300005468 Bacteria 1527
30 Ga0070684_100563409 3300005535 Bacteria 1058
31 Ga0068853_100606702 3300005539 Bacteria 1040
32 Ga0070686_100512198 3300005544 Bacteria 933
33 Ga0070665_100179527 3300005548 Bacteria 2118
34 Ga0070665_100226228 3300005548 Bacteria 1871
35 Ga0068857_100235834 3300005577 Bacteria 1674
36 Ga0068858_100134485 3300005842 Bacteria 2319
37 Ga0081455_10031970 3300005937 Bacteria 4750
38 Ga0081540_1000074 3300005983 Bacteria 107172
39 Ga0070717_10079420 3300006028 Bacteria 2751
40 Ga0070717_10263741 3300006028 Bacteria 1524
41 Ga0075363_100033846 3300006048 Bacteria 2665
42 Ga0070716_100117234 3300006173 Bacteria 1661
43 Ga0068865_100469181 3300006881 Bacteria 1044
44 Ga0075436_100237839 3300006914 Bacteria 1295
45 Ga0111539_10304847 3300009094 Bacteria 1853
46 Ga0105245_10281137 3300009098 Bacteria 1626
47 Ga0105243_10630627 3300009148 Bacteria 1036
48 Ga0105238_10004346 3300009551 Bacteria 14059
49 Ga0105239_10227694 3300010375 Bacteria 2091
50 Ga0105246_10199613 3300011119 Bacteria 1554
51 Ga0157374_10974909 3300013296 Bacteria 867
52 Ga0157378_10100667 3300013297 Bacteria 2639
53 Ga0163162_10202597 3300013306 Bacteria 2113
54 Ga0157372_10120963 3300013307 Bacteria 3007
55 Ga0157375_10092289 3300013308 Bacteria 3091
56 Ga0206353_10371780 3300020082 Bacteria 1120
57 Ga0213875_10002715 3300021388 Bacteria 10449
58 Ga0213875_10090839 3300021388 Bacteria 1424
59 Ga0207426_1051589 3300025302 Bacteria 1221
60 Ga0207692_10062363 3300025898 Bacteria 1934
61 Ga0207692_10212726 3300025898 Bacteria 1142
62 Ga0207647_10033454 3300025904 Bacteria 3292
63 Ga0207699_10036172 3300025906 Bacteria 2813
64 Ga0207707_10123483 3300025912 Bacteria 2264
65 Ga0207693_10703070 3300025915 Bacteria 783
66 Ga0207663_10081704 3300025916 Bacteria 2117
67 Ga0207657_10324040 3300025919 Bacteria 1218
68 Ga0207646_10109074 3300025922 Bacteria 2484
69 Ga0207694_10010698 3300025924 Bacteria 6926
70 Ga0207694_10236965 3300025924 Bacteria 1491
71 Ga0207700_10413912 3300025928 Bacteria 1183
72 Ga0207664_10002394 3300025929 Bacteria 12407
73 Ga0207664_10117531 3300025929 Bacteria 2220
74 Ga0207664_10354965 3300025929 Bacteria 1298
75 Ga0207664_10361061 3300025929 Bacteria 1287
76 Ga0207644_10568835 3300025931 Bacteria 939
77 Ga0207665_10218684 3300025939 Bacteria 1395
78 Ga0207691_10080042 3300025940 Bacteria 2940
79 Ga0207661_10056757 3300025944 Bacteria 3145
80 Ga0207667_10264275 3300025949 Bacteria 1760
81 Ga0207668_10236138 3300025972 Bacteria 1476
82 Ga0207658_10206300 3300025986 Bacteria 1644
83 Ga0207658_10306574 3300025986 Bacteria 1370
84 Ga0207703_10364283 3300026035 Bacteria 1334
85 Ga0207708_10594796 3300026075 Bacteria 937
86 Ga0207641_10285903 3300026088 Bacteria 1553
87 Ga0207641_10726528 3300026088 Bacteria 979
88 Ga0207674_10544867 3300026116 Bacteria 1121
89 Ga0207428_10581877 3300027907 Bacteria 808
90 Ga0268264_10122807 3300028381 Bacteria 2291
91 Ga0265319_1017014 3300028563 Bacteria 2776
92 Ga0265336_10005155 3300028666 Bacteria 4856
93 Ga0307517_10113193 3300028786 Bacteria 2049
94 Ga0307515_10049581 3300028794 Bacteria 6311
95 Ga0265338_10017188 3300028800 Bacteria 7813
96 Ga0265338_10060601 3300028800 Bacteria 3323
97 Ga0265338_10107746 3300028800 Bacteria 2252
98 Ga0307511_10003090 3300030521 Bacteria 17155
99 Ga0307512_10040242 3300030522 Bacteria 3904
100 Ga0265325_10207353 3300031241 Bacteria 901
101 Ga0265339_10049880 3300031249 Bacteria 2290
102 Ga0265339_10095117 3300031249 Bacteria 1557
103 Ga0307513_10069471 3300031456 Bacteria 3686
104 Ga0307513_10180301 3300031456 Bacteria 1976
105 Ga0307509_10013229 3300031507 Bacteria 9791
106 Ga0307509_10093453 3300031507 Bacteria 3069
107 Ga0307508_10001782 3300031616 Bacteria 23942
108 Ga0307508_10009013 3300031616 Bacteria 9193
109 Ga0307514_10023311 3300031649 Bacteria 5022
110 Ga0307514_10208761 3300031649 Bacteria 1216
111 Ga0307514_10280492 3300031649 Bacteria 954
112 Ga0265342_10039802 3300031712 Bacteria 2854
113 Ga0307516_10053318 3300031730 Bacteria 3955
114 Ga0307516_10310089 3300031730 Bacteria 1251
115 Ga0307516_10332431 3300031730 Bacteria 1188
116 Ga0307518_10011034 3300031838 Bacteria 6457
117 Ga0307507_10001954 3300033179 Bacteria 44758
118 Ga0307507_10036156 3300033179 Bacteria 5055
119 Ga0307510_10232482 3300033180 Bacteria 1345
120 Ga0373926_0033563 3300035083 Bacteria 1814
121 Ga0373944_0190739 3300035089 Bacteria 738
122 Ga0373932_0084960 3300035112 Bacteria 1006
123 Ga0373936_0005116 3300035113 Bacteria 4936
124 Ga0373945_0118465 3300035116 Bacteria 1051
125 Ga0373953_0057503 3300035117 Bacteria 1584
126 Ga0373954_0017921 3300035118 Bacteria 3185
127 Ga0373957_0099825 3300035120 Bacteria 1161
128 Ga0373943_0014493 3300035170 Bacteria 3570
129 Ga0373924_0043622 3300035410 Bacteria 1842
130 Ga0373924_0159887 3300035410 Bacteria 988
131 Ga0373935_0032121 3300035692 Bacteria 3261
132 Ga0373927_0077352 3300035695 Bacteria 2155
133 Ga0373933_0042918 3300035724 Bacteria 2674
134 Ga0373933_0101478 3300035724 Bacteria 1785
135 Ga0373947_0276515 3300035725 Bacteria 1115
136 Ga0373937_0080216 3300036401 Bacteria 3017
137 Ga0373937_0091066 3300036401 Bacteria 2825
138 Ga0310109_010178 3300036534 Bacteria 1264
139 Ga0373925_0000101 3300037068 Bacteria 92997
140 Ga0373925_0016708 3300037068 Bacteria 5314
141 Ga0373925_0495939 3300037068 Bacteria 1002
142 Ga0395898_0454555 3300037466 Bacteria 1219
143 Ga0436364_0105595 3300037853 Bacteria 4764
144 Ga0436364_0291434 3300037853 Bacteria 947
145 Ga0436364_1078990 3300037853 Bacteria 1259
146 Ga0436364_1562947 3300037853 Bacteria 33891
147 Ga0395901_0228565 3300038443 Bacteria 1943
148 Ga0436363_1520515 3300039450 Bacteria 774
149 Ga0436362_0960067 3300039453 Bacteria 762
150 Ga0451807_2592432 3300041486 Bacteria 806
151 Ga0495592_0009428 3300046454 Bacteria 7339
152 Ga0495592_0013657 3300046454 Bacteria 6176
153 Ga0495590_0047031 3300046457 Bacteria 1505
154 Ga0495629_0011173 3300046459 Bacteria 6519
155 Ga0495629_0018578 3300046459 Bacteria 4972
156 Ga0495629_0038965 3300046459 Bacteria 3347
157 Ga0495638_0056845 3300046460 Bacteria 2428
158 Ga0495638_0122447 3300046460 Bacteria 1535
159 Ga0495638_0153456 3300046460 Bacteria 1334
160 Ga0495651_0001042 3300046462 Bacteria 21445
161 Ga0495651_0032955 3300046462 Bacteria 4040
162 Ga0495651_0161204 3300046462 Bacteria 1606
163 Ga0495651_0261828 3300046462 Bacteria 1176
164 Ga0495653_0018390 3300046463 Bacteria 5676
165 Ga0495653_0130267 3300046463 Bacteria 1782
166 Ga0495650_0025040 3300046471 Bacteria 2807
167 Ga0495580_0079072 3300046472 Bacteria 2293
168 Ga0495582_0038905 3300046473 Bacteria 2618
169 Ga0495662_0002474 3300046476 Bacteria 9305
170 Ga0495664_0000287 3300046477 Bacteria 24123
171 Ga0495664_0011602 3300046477 Bacteria 4970
172 Ga0495664_0015673 3300046477 Bacteria 4311
173 Ga0495584_0237868 3300046491 Bacteria 926
174 Ga0495585_0085531 3300046492 Bacteria 1704
175 Ga0495585_0088937 3300046492 Bacteria 1665
176 Ga0495585_0157404 3300046492 Bacteria 1181
177 Ga0495594_0066730 3300046499 Bacteria 1996
178 Ga0495583_0024147 3300046506 Bacteria 3061
179 Ga0495583_0044957 3300046506 Bacteria 2045
180 Ga0495606_0013133 3300046507 Bacteria 6574
181 Ga0495608_0006827 3300046511 Bacteria 8092
182 Ga0495608_0205873 3300046511 Bacteria 1238
183 Ga0495608_0226776 3300046511 Bacteria 1170
184 Ga0495610_0100705 3300046512 Bacteria 1295
185 Ga0495618_0039187 3300046514 Bacteria 2979
186 Ga0495618_0040374 3300046514 Bacteria 2937
187 Ga0495618_0085925 3300046514 Bacteria 2011
188 Ga0495620_0024378 3300046515 Bacteria 2877
189 Ga0495620_0180269 3300046515 Bacteria 817
190 Ga0495628_0078892 3300046516 Bacteria 2560
191 Ga0495628_0099134 3300046516 Bacteria 2250
192 Ga0495628_0118907 3300046516 Bacteria 2028
193 Ga0495630_0108027 3300046517 Bacteria 2107
194 Ga0495632_0212537 3300046519 Bacteria 877
195 Ga0495643_0006342 3300046522 Bacteria 7809
196 Ga0495648_0021550 3300046524 Bacteria 4459
197 Ga0495666_0007678 3300046526 Bacteria 5396
198 Ga0495666_0011577 3300046526 Bacteria 4397
199 Ga0495642_0130610 3300046528 Bacteria 1081
200 Ga0495652_0008645 3300046529 Bacteria 9279
201 Ga0495652_0104349 3300046529 Bacteria 2292
202 Ga0495652_0200263 3300046529 Bacteria 1516
203 Ga0495652_0339209 3300046529 Bacteria 1080
204 Ga0495652_0425595 3300046529 Bacteria 935
205 Ga0495665_0007483 3300046531 Bacteria 5909
206 Ga0495640_0039687 3300046533 Bacteria 3301
207 Ga0495586_0108428 3300046535 Bacteria 1544
208 Ga0495587_0061967 3300046536 Bacteria 2191
209 Ga0495645_0017306 3300046543 Bacteria 5162
210 Ga0495645_0127865 3300046543 Bacteria 1784
211 Ga0495667_0082116 3300046559 Bacteria 2094
212 Ga0495667_0102979 3300046559 Bacteria 1846
213 Ga0495667_0123332 3300046559 Bacteria 1672
214 Ga0495634_0001198 3300046642 Bacteria 23916
215 Ga0495634_0002799 3300046642 Bacteria 14330
216 Ga0495634_0015769 3300046642 Bacteria 5417
217 Ga0495634_0144291 3300046642 Bacteria 1509
218 Ga0495625_0159822 3300046660 Bacteria 1510
219 Ga0495635_0018136 3300046663 Bacteria 4914
220 Ga0495635_0028962 3300046663 Bacteria 3850
221 Ga0495635_0043084 3300046663 Bacteria 3115
222 Ga0495588_0079174 3300046674 Bacteria 1715
223 Ga0495657_0003480 3300046675 Bacteria 12840
224 Ga0495657_0024349 3300046675 Bacteria 4314
225 Ga0495657_0441560 3300046675 Bacteria 762
226 Ga0495599_0047225 3300046678 Bacteria 2698
227 Ga0495599_0052346 3300046678 Bacteria 2557
228 Ga0495623_0087437 3300046679 Bacteria 1920
229 Ga0495623_0097877 3300046679 Bacteria 1791
230 Ga0495646_0189527 3300046680 Bacteria 1124
231 Ga0495658_0164149 3300046683 Bacteria 1371
232 Ga0495613_0004110 3300046689 Bacteria 10885
233 Ga0495613_0021396 3300046689 Bacteria 4821
234 Ga0495613_0479149 3300046689 Bacteria 840
235 Ga0495624_0010785 3300046690 Bacteria 6298
236 Ga0495624_0131644 3300046690 Bacteria 1533
237 Ga0495671_0079334 3300046692 Bacteria 1609
238 Ga0495649_0070671 3300046694 Bacteria 1871
239 Ga0495589_0015740 3300046794 Bacteria 3888
240 Ga0495589_0059236 3300046794 Bacteria 1882
241 Ga0495600_0010883 3300046809 Bacteria 5658
242 Ga0495600_0273643 3300046809 Bacteria 1070
243 Ga0495581_0007085 3300047315 Bacteria 6492
244 Ga0495604_0000545 3300047317 Bacteria 33154
245 Ga0495604_0005331 3300047317 Bacteria 10194
246 Ga0495604_0362085 3300047317 Bacteria 961
247 Ga0495636_0001518 3300047318 Bacteria 8809
248 Ga0495636_0065503 3300047318 Bacteria 1543
249 Ga0495636_0156638 3300047318 Bacteria 1024
250 Ga0495674_0079786 3300047319 Bacteria 2809
251 Ga0495674_0143441 3300047319 Bacteria 2006
252 Ga0495676_0000488 3300047321 Bacteria 32524
253 Ga0495676_0000537 3300047321 Bacteria 31037
254 Ga0495676_0115771 3300047321 Bacteria 1959
255 Ga0495676_0244669 3300047321 Bacteria 1226
256 Ga0495676_0298214 3300047321 Bacteria 1087
257 Ga0495680_0032710 3300047322 Bacteria 4218
258 Ga0495680_0042923 3300047322 Bacteria 3584
259 Ga0495683_0092272 3300047323 Bacteria 1465
260 Ga0495687_002019 3300047443 Bacteria 17185
261 Ga0495687_011328 3300047443 Bacteria 4806
262 Ga0495687_015680 3300047443 Bacteria 3843
263 Ga0495687_073595 3300047443 Bacteria 1361
264 Ga0495679_014492 3300047446 Bacteria 2919
265 Ga0495685_002536 3300047447 Bacteria 5738
266 Ga0495685_054476 3300047447 Bacteria 1353
267 Ga0495681_0016827 3300047470 Bacteria 4080
268 Ga0495684_0046297 3300047471 Bacteria 3327
269 Ga0495684_0063413 3300047471 Bacteria 2809
270 Ga0495593_0000258 3300047673 Bacteria 28592
271 Ga0495593_0024057 3300047673 Bacteria 3379
272 Ga0495614_0001653 3300048089 Bacteria 9726
273 Ga0495614_0002843 3300048089 Bacteria 7703
274 Ga0496100_0015103 3300048903 Bacteria 4504
275 Ga0496101_0028521 3300048904 Bacteria 3897
276 Ga0496101_0490559 3300048904 Bacteria 970
277 Ga0496102_0000014 3300048905 Bacteria 310241
278 Ga0496102_0345243 3300048905 Bacteria 1401
279 Ga0496102_0678617 3300048905 Bacteria 953
280 Ga0496103_0000004 3300048906 Bacteria 510080
281 Ga0496103_0003660 3300048906 Bacteria 9358
282 Ga0496105_0525969 3300048908 Bacteria 926
283 Ga0496106_0005582 3300048909 Bacteria 9315
284 Ga0496107_0012225 3300048910 Bacteria 5989
285 Ga0496107_0019547 3300048910 Bacteria 4779
286 Ga0496108_0140686 3300048911 Bacteria 2079
287 Ga0496108_0477347 3300048911 Bacteria 1089
288 Ga0496109_0053072 3300048912 Bacteria 3696
289 Ga0496109_0169771 3300048912 Bacteria 2046
290 Ga0496109_0376243 3300048912 Bacteria 1341
291 Ga0496109_0626918 3300048912 Bacteria 1012
292 Ga0496109_0742715 3300048912 Bacteria 919
293 Ga0496109_0829574 3300048912 Bacteria 862
294 Ga0496110_0010392 3300048913 Bacteria 7567
295 Ga0496110_0030054 3300048913 Bacteria 4681
296 Ga0496110_0164153 3300048913 Bacteria 2014
297 Ga0496110_1065986 3300048913 Bacteria 716
298 Ga0496111_0020584 3300048914 Bacteria 4593
299 Ga0496111_0069152 3300048914 Bacteria 2567
300 Ga0496111_0461815 3300048914 Bacteria 936
301 Ga0496112_0032348 3300048915 Bacteria 5079
302 Ga0496112_0112890 3300048915 Bacteria 2688
303 Ga0496112_0158609 3300048915 Bacteria 2229
304 Ga0496112_1039865 3300048915 Bacteria 738
305 Ga0496112_1177681 3300048915 Bacteria 683
306 Ga0496113_0181722 3300048916 Bacteria 1667
307 Ga0496113_0639208 3300048916 Bacteria 851
308 Ga0496114_0014112 3300048917 Bacteria 6405
309 Ga0496114_0512349 3300048917 Bacteria 1061
310 Ga0496115_0093526 3300048918 Bacteria 2458
311 Ga0496115_0458175 3300048918 Bacteria 1029
312 Ga0496115_0484608 3300048918 Bacteria 995
313 Ga0496116_0000069 3300048919 Bacteria 252643
314 Ga0496117_0000003 3300048920 Bacteria 1881097
315 Ga0496117_0052280 3300048920 Bacteria 2879
316 Ga0496118_0000001 3300048921 Bacteria 1881100
317 Ga0496118_0108858 3300048921 Bacteria 1846
318 Ga0496119_0000267 3300048922 Bacteria 74039
319 Ga0496119_0017049 3300048922 Bacteria 5490
320 Ga0496119_0038081 3300048922 Bacteria 3113
321 Ga0496120_0004527 3300048923 Bacteria 11616
322 Ga0496121_0046983 3300048924 Bacteria 3688
323 Ga0496121_0131095 3300048924 Bacteria 1876
324 Ga0496122_0000305 3300048925 Bacteria 108235
325 Ga0496123_0000284 3300048926 Bacteria 99532
326 Ga0496125_0448088 3300048928 Bacteria 740
327 Ga0496126_0000006 3300048929 Bacteria 798804
328 Ga0496126_0000067 3300048929 Bacteria 249091
329 Ga0496126_0025895 3300048929 Bacteria 5634
330 Ga0496126_0111425 3300048929 Bacteria 2383
331 Ga0496126_0143568 3300048929 Bacteria 2052
332 Ga0496126_0158763 3300048929 Bacteria 1933
333 Ga0496126_0319966 3300048929 Bacteria 1275
334 Ga0501031_0166986 3300049568 Bacteria 1438
335 Ga0501032_0003786 3300049569 Bacteria 11478
336 Ga0501032_0070417 3300049569 Bacteria 2332
337 Ga0501032_0326565 3300049569 Bacteria 990
338 Ga0501033_0044526 3300049570 Bacteria 3304
339 Ga0501034_0005213 3300049571 Bacteria 14259
340 Ga0501034_0280850 3300049571 Bacteria 1604
341 Ga0501034_0386209 3300049571 Bacteria 1324
342 Ga0501034_0566212 3300049571 Bacteria 1044
343 Ga0501036_0011299 3300049572 Bacteria 7386
344 Ga0501036_0285331 3300049572 Bacteria 1381
345 Ga0501036_0541790 3300049572 Bacteria 967
346 Ga0501037_0056835 3300049573 Bacteria 2857
347 Ga0501037_0192066 3300049573 Bacteria 1445
348 Ga0501038_0024746 3300049574 Bacteria 5352
349 Ga0501038_0051420 3300049574 Bacteria 3555
350 Ga0501038_0103810 3300049574 Bacteria 2363
351 Ga0501038_0178966 3300049574 Bacteria 1712
352 Ga0501038_0209019 3300049574 Bacteria 1562
353 Ga0501039_0315799 3300049575 Bacteria 1228
354 Ga0501042_0001445 3300049578 Bacteria 13978
355 Ga0501043_0067766 3300049579 Bacteria 2802
356 Ga0501043_0139158 3300049579 Bacteria 1901
357 Ga0501043_0339698 3300049579 Bacteria 1142
358 Ga0501046_0058674 3300049580 Bacteria 3016
359 Ga0501047_0003526 3300049581 Bacteria 14766
360 Ga0501047_0004553 3300049581 Bacteria 13036
361 Ga0501047_0013474 3300049581 Bacteria 7749
362 Ga0501047_0285180 3300049581 Bacteria 1495
363 Ga0501048_0008014 3300049582 Bacteria 7997
364 Ga0501048_0031140 3300049582 Bacteria 3859
365 Ga0501069_0057041 3300049585 Bacteria 2177
366 Ga0501069_0238091 3300049585 Bacteria 1060
367 Ga0501070_0061016 3300049586 Bacteria 3125
368 Ga0501070_0387267 3300049586 Bacteria 1132
369 Ga0501073_0029923 3300049589 Bacteria 3889
370 Ga0501074_0033129 3300049590 Bacteria 3744
371 Ga0501035_0003898 3300049822 Bacteria 14232
372 Ga0501035_0057376 3300049822 Bacteria 3471
373 Ga0501044_0004950 3300049823 Bacteria 14901
374 Ga0501044_0006686 3300049823 Bacteria 12711
375 Ga0501044_0049494 3300049823 Bacteria 4338
376 Ga0501044_0477493 3300049823 Bacteria 1150
377 Ga0501044_0755236 3300049823 Bacteria 854
378 nmdc:mga03n38_215061_c1 3300050490 Bacteria 1001
379 nmdc:mga0yw44_692795_c1 3300050492 Bacteria 692
380 nmdc:mga04h51_214757_c1 3300050495 Bacteria 760
381 nmdc:mga08y16_332288_c1 3300050511 Bacteria 1563
382 nmdc:mga0n895_239858_c1 3300050512 Bacteria 1839
383 nmdc:mga0rr50_610934_c1 3300050513 Bacteria 930
384 Ga0495601_0000519 3300053077 Bacteria 20315
385 Ga0495601_0026027 3300053077 Bacteria 3610
386 Ga0495612_0142142 3300053078 Bacteria 1041
387 Ga0495612_0155160 3300053078 Bacteria 998
388 Ga0495595_0081765 3300053084 Bacteria 1540
389 Ga0500643_004136 3300053087 Bacteria 6664
390 Ga0500643_068085 3300053087 Bacteria 990
391 Ga0500646_0026907 3300053090 Bacteria 1562
392 Ga0500640_007318 3300053095 Bacteria 4286
393 Ga0500641_0039505 3300053096 Bacteria 1902
394 Ga0500553_030046 3300053101 Bacteria 2720
395 Ga0500569_012505 3300053109 Bacteria 2055
396 Ga0500618_036008 3300053125 Bacteria 1148
397 Ga0500628_004523 3300053129 Bacteria 2303
398 Ga0500652_000336 3300053131 Bacteria 16864
399 Ga0500652_017290 3300053131 Bacteria 2641
400 Ga0500561_0013747 3300053137 Bacteria 1761
401 Ga0500573_0186150 3300053140 Bacteria 1112
402 Ga0500579_048915 3300053143 Bacteria 2599
403 Ga0500600_0029597 3300053149 Bacteria 3230
404 Ga0500616_0035701 3300053153 Bacteria 2702
405 Ga0500627_0030192 3300053158 Bacteria 2267
406 Ga0500633_0020650 3300053160 Bacteria 1990
407 Ga0500633_0190278 3300053160 Bacteria 769
408 Ga0500634_0024326 3300053161 Bacteria 3293
409 Ga0500636_0154015 3300053177 Bacteria 1260
410 Ga0500645_000017 3300053730 Bacteria 146045
411 Ga0500645_017847 3300053730 Bacteria 2220
412 Ga0500656_000122 3300053732 Bacteria 4545
413 Ga0500587_002769 3300053739 Bacteria 2477
414 2517760076 2517572101 Bacteria 6884336
415 2559432357 2558860280 Bacteria 11429938
416 2585315204 2582581314 Bacteria 11452267
417 2616701630 2616644814 Bacteria 11555299
418 2644262428 2643221647 Bacteria 10741251
419 2676204081 2675902999 Bacteria 9438463
420 2689963723 2687453737 Bacteria 11203906
421 2689992797 2687453743 Bacteria 8361025
422 2760624489 2758568621 Bacteria 5967089
423 2774848657 2773857921 Bacteria 9435764
424 2816507449 2816332139 Bacteria 9138787
425 2858901502 2858895516 Bacteria 7378898
426 2862582215 2862574272 Bacteria 10567477
427 2870725418 2870721527 Bacteria 9689237
428 2880491126 2880489317 Bacteria 7096270
429 2945945105 2945941187 Bacteria 4682474
430 2954694692 2954691527 Bacteria 10720516
431 2954709895 2954701450 Bacteria 10834262
432 8001786277 8001781756 Bacteria 9586736
433 8047717868 8047710418 Bacteria 11023148
434 8048136041 8048127548 Bacteria 11053136
435 8055068610 8055066027 Bacteria 9479577
436 Ga0070699_100278951
437 JGI24740J21852_10026212
438 JGI24739J22299_10002752
439 JGI24737J22298_10027289
440 JGI24738J21930_10028156
441 JGI25404J52841_10008005
442 Ga0070660_100185554
443 Ga0070660_100767776
444 Ga0070661_100313339
445 Ga0070668_100043101
446 Ga0070668_100848581
447 Ga0070671_100686136
448 Ga0070674_100260982
449 Ga0070709_10073514
450 Ga0070709_10236973
451 Ga0070714_100019981
452 Ga0070714_100063694
453 Ga0070714_100232678
454 Ga0070713_100693880
455 Ga0070710_10009462
456 Ga0070710_10034932
457 Ga0070710_10059811
458 Ga0070710_10138545
459 Ga0070710_10298695
460 Ga0070711_100577077
461 Ga0070711_100702499
462 Ga0070681_10025424
463 Ga0070706_100058870
464 Ga0070707_100312461
465 Ga0070684_100563409
466 Ga0068853_100606702
467 Ga0070686_100512198
468 Ga0070665_100179527
469 Ga0070665_100226228
470 Ga0068857_100235834
471 Ga0068858_100134485
472 Ga0081455_10031970
473 Ga0081540_1000074
474 Ga0070717_10079420
475 Ga0070717_10263741
476 Ga0075363_100033846
477 Ga0070716_100117234
478 Ga0068865_100469181
479 Ga0075436_100237839
480 Ga0111539_10304847
481 Ga0105245_10281137
482 Ga0105243_10630627
483 Ga0105238_10004346
484 Ga0105239_10227694
485 Ga0105246_10199613
486 Ga0157374_10974909
487 Ga0157378_10100667
488 Ga0163162_10202597
489 Ga0157372_10120963
490 Ga0157375_10092289
491 Ga0206353_10371780
492 Ga0213875_10002715
493 Ga0213875_10090839
494 Ga0207426_1051589
495 Ga0207692_10062363
496 Ga0207692_10212726
497 Ga0207647_10033454
498 Ga0207699_10036172
499 Ga0207707_10123483
500 Ga0207693_10703070
501 Ga0207663_10081704
502 Ga0207657_10324040
503 Ga0207646_10109074
504 Ga0207694_10010698
505 Ga0207694_10236965
506 Ga0207700_10413912
507 Ga0207664_10002394
508 Ga0207664_10117531
509 Ga0207664_10354965
510 Ga0207664_10361061
511 Ga0207644_10568835
512 Ga0207665_10218684
513 Ga0207691_10080042
514 Ga0207661_10056757
515 Ga0207667_10264275
516 Ga0207668_10236138
517 Ga0207658_10206300
518 Ga0207658_10306574
519 Ga0207703_10364283
520 Ga0207708_10594796
521 Ga0207641_10285903
522 Ga0207641_10726528
523 Ga0207674_10544867
524 Ga0207428_10581877
525 Ga0268264_10122807
526 Ga0265319_1017014
527 Ga0265336_10005155
528 Ga0307517_10113193
529 Ga0307515_10049581
530 Ga0265338_10017188
531 Ga0265338_10060601
532 Ga0265338_10107746
533 Ga0307511_10003090
534 Ga0307512_10040242
535 Ga0265325_10207353
536 Ga0265339_10049880
537 Ga0265339_10095117
538 Ga0307513_10069471
539 Ga0307513_10180301
540 Ga0307509_10013229
541 Ga0307509_10093453
542 Ga0307508_10001782
543 Ga0307508_10009013
544 Ga0307514_10023311
545 Ga0307514_10208761
546 Ga0307514_10280492
547 Ga0265342_10039802
548 Ga0307516_10053318
549 Ga0307516_10310089
550 Ga0307516_10332431
551 Ga0307518_10011034
552 Ga0307507_10001954
553 Ga0307507_10036156
554 Ga0307510_10232482
555 Ga0373926_0033563
556 Ga0373944_0190739
557 Ga0373932_0084960
558 Ga0373936_0005116
559 Ga0373945_0118465
560 Ga0373953_0057503
561 Ga0373954_0017921
562 Ga0373957_0099825
563 Ga0373943_0014493
564 Ga0373924_0043622
565 Ga0373924_0159887
566 Ga0373935_0032121
567 Ga0373927_0077352
568 Ga0373933_0042918
569 Ga0373933_0101478
570 Ga0373947_0276515
571 Ga0373937_0080216
572 Ga0373937_0091066
573 Ga0310109_010178
574 Ga0373925_0000101
575 Ga0373925_0016708
576 Ga0373925_0495939
577 Ga0395898_0454555
578 Ga0436364_0105595
579 Ga0436364_0291434
580 Ga0436364_1078990
581 Ga0436364_1562947
582 Ga0395901_0228565
583 Ga0436363_1520515
584 Ga0436362_0960067
585 Ga0451807_2592432
586 Ga0495592_0009428
587 Ga0495592_0013657
588 Ga0495590_0047031
589 Ga0495629_0011173
590 Ga0495629_0018578
591 Ga0495629_0038965
592 Ga0495638_0056845
593 Ga0495638_0122447
594 Ga0495638_0153456
595 Ga0495651_0001042
596 Ga0495651_0032955
597 Ga0495651_0161204
598 Ga0495651_0261828
599 Ga0495653_0018390
600 Ga0495653_0130267
601 Ga0495650_0025040
602 Ga0495580_0079072
603 Ga0495582_0038905
604 Ga0495662_0002474
605 Ga0495664_0000287
606 Ga0495664_0011602
607 Ga0495664_0015673
608 Ga0495584_0237868
609 Ga0495585_0085531
610 Ga0495585_0088937
611 Ga0495585_0157404
612 Ga0495594_0066730
613 Ga0495583_0024147
614 Ga0495583_0044957
615 Ga0495606_0013133
616 Ga0495608_0006827
617 Ga0495608_0205873
618 Ga0495608_0226776
619 Ga0495610_0100705
620 Ga0495618_0039187
621 Ga0495618_0040374
622 Ga0495618_0085925
623 Ga0495620_0024378
624 Ga0495620_0180269
625 Ga0495628_0078892
626 Ga0495628_0099134
627 Ga0495628_0118907
628 Ga0495630_0108027
629 Ga0495632_0212537
630 Ga0495643_0006342
631 Ga0495648_0021550
632 Ga0495666_0007678
633 Ga0495666_0011577
634 Ga0495642_0130610
635 Ga0495652_0008645
636 Ga0495652_0104349
637 Ga0495652_0200263
638 Ga0495652_0339209
639 Ga0495652_0425595
640 Ga0495665_0007483
641 Ga0495640_0039687
642 Ga0495586_0108428
643 Ga0495587_0061967
644 Ga0495645_0017306
645 Ga0495645_0127865
646 Ga0495667_0082116
647 Ga0495667_0102979
648 Ga0495667_0123332
649 Ga0495634_0001198
650 Ga0495634_0002799
651 Ga0495634_0015769
652 Ga0495634_0144291
653 Ga0495625_0159822
654 Ga0495635_0018136
655 Ga0495635_0028962
656 Ga0495635_0043084
657 Ga0495588_0079174
658 Ga0495657_0003480
659 Ga0495657_0024349
660 Ga0495657_0441560
661 Ga0495599_0047225
662 Ga0495599_0052346
663 Ga0495623_0087437
664 Ga0495623_0097877
665 Ga0495646_0189527
666 Ga0495658_0164149
667 Ga0495613_0004110
668 Ga0495613_0021396
669 Ga0495613_0479149
670 Ga0495624_0010785
671 Ga0495624_0131644
672 Ga0495671_0079334
673 Ga0495649_0070671
674 Ga0495589_0015740
675 Ga0495589_0059236
676 Ga0495600_0010883
677 Ga0495600_0273643
678 Ga0495581_0007085
679 Ga0495604_0000545
680 Ga0495604_0005331
681 Ga0495604_0362085
682 Ga0495636_0001518
683 Ga0495636_0065503
684 Ga0495636_0156638
685 Ga0495674_0079786
686 Ga0495674_0143441
687 Ga0495676_0000488
688 Ga0495676_0000537
689 Ga0495676_0115771
690 Ga0495676_0244669
691 Ga0495676_0298214
692 Ga0495680_0032710
693 Ga0495680_0042923
694 Ga0495683_0092272
695 Ga0495687_002019
696 Ga0495687_011328
697 Ga0495687_015680
698 Ga0495687_073595
699 Ga0495679_014492
700 Ga0495685_002536
701 Ga0495685_054476
702 Ga0495681_0016827
703 Ga0495684_0046297
704 Ga0495684_0063413
705 Ga0495593_0000258
706 Ga0495593_0024057
707 Ga0495614_0001653
708 Ga0495614_0002843
709 Ga0496100_0015103
710 Ga0496101_0028521
711 Ga0496101_0490559
712 Ga0496102_0000014
713 Ga0496102_0345243
714 Ga0496102_0678617
715 Ga0496103_0000004
716 Ga0496103_0003660
717 Ga0496105_0525969
718 Ga0496106_0005582
719 Ga0496107_0012225
720 Ga0496107_0019547
721 Ga0496108_0140686
722 Ga0496108_0477347
723 Ga0496109_0053072
724 Ga0496109_0169771
725 Ga0496109_0376243
726 Ga0496109_0626918
727 Ga0496109_0742715
728 Ga0496109_0829574
729 Ga0496110_0010392
730 Ga0496110_0030054
731 Ga0496110_0164153
732 Ga0496110_1065986
733 Ga0496111_0020584
734 Ga0496111_0069152
735 Ga0496111_0461815
736 Ga0496112_0032348
737 Ga0496112_0112890
738 Ga0496112_0158609
739 Ga0496112_1039865
740 Ga0496112_1177681
741 Ga0496113_0181722
742 Ga0496113_0639208
743 Ga0496114_0014112
744 Ga0496114_0512349
745 Ga0496115_0093526
746 Ga0496115_0458175
747 Ga0496115_0484608
748 Ga0496116_0000069
749 Ga0496117_0000003
750 Ga0496117_0052280
751 Ga0496118_0000001
752 Ga0496118_0108858
753 Ga0496119_0000267
754 Ga0496119_0017049
755 Ga0496119_0038081
756 Ga0496120_0004527
757 Ga0496121_0046983
758 Ga0496121_0131095
759 Ga0496122_0000305
760 Ga0496123_0000284
761 Ga0496125_0448088
762 Ga0496126_0000006
763 Ga0496126_0000067
764 Ga0496126_0025895
765 Ga0496126_0111425
766 Ga0496126_0143568
767 Ga0496126_0158763
768 Ga0496126_0319966
769 Ga0501031_0166986
770 Ga0501032_0003786
771 Ga0501032_0070417
772 Ga0501032_0326565
773 Ga0501033_0044526
774 Ga0501034_0005213
775 Ga0501034_0280850
776 Ga0501034_0386209
777 Ga0501034_0566212
778 Ga0501036_0011299
779 Ga0501036_0285331
780 Ga0501036_0541790
781 Ga0501037_0056835
782 Ga0501037_0192066
783 Ga0501038_0024746
784 Ga0501038_0051420
785 Ga0501038_0103810
786 Ga0501038_0178966
787 Ga0501038_0209019
788 Ga0501039_0315799
789 Ga0501042_0001445
790 Ga0501043_0067766
791 Ga0501043_0139158
792 Ga0501043_0339698
793 Ga0501046_0058674
794 Ga0501047_0003526
795 Ga0501047_0004553
796 Ga0501047_0013474
797 Ga0501047_0285180
798 Ga0501048_0008014
799 Ga0501048_0031140
800 Ga0501069_0057041
801 Ga0501069_0238091
802 Ga0501070_0061016
803 Ga0501070_0387267
804 Ga0501073_0029923
805 Ga0501074_0033129
806 Ga0501035_0003898
807 Ga0501035_0057376
808 Ga0501044_0004950
809 Ga0501044_0006686
810 Ga0501044_0049494
811 Ga0501044_0477493
812 Ga0501044_0755236
813 nmdc:mga03n38_215061_c1
814 nmdc:mga0yw44_692795_c1
815 nmdc:mga04h51_214757_c1
816 nmdc:mga08y16_332288_c1
817 nmdc:mga0n895_239858_c1
818 nmdc:mga0rr50_610934_c1
819 Ga0495601_0000519
820 Ga0495601_0026027
821 Ga0495612_0142142
822 Ga0495612_0155160
823 Ga0495595_0081765
824 Ga0500643_004136
825 Ga0500643_068085
826 Ga0500646_0026907
827 Ga0500640_007318
828 Ga0500641_0039505
829 Ga0500553_030046
830 Ga0500569_012505
831 Ga0500618_036008
832 Ga0500628_004523
833 Ga0500652_000336
834 Ga0500652_017290
835 Ga0500561_0013747
836 Ga0500573_0186150
837 Ga0500579_048915
838 Ga0500600_0029597
839 Ga0500616_0035701
840 Ga0500627_0030192
841 Ga0500633_0020650
842 Ga0500633_0190278
843 Ga0500634_0024326
844 Ga0500636_0154015
845 Ga0500645_000017
846 Ga0500645_017847
847 Ga0500656_000122
848 Ga0500587_002769
849 2517760076
850 2559432357
851 2585315204
852 2616701630
853 2644262428
854 2676204081
855 2689963723
856 2689992797
857 2760624489
858 2774848657
859 2816507449
860 2858901502
861 2862582215
862 2870725418
863 2880491126
864 2945945105
865 2954694692
866 2954709895
867 8001786277
868 8047717868
869 8048136041
870 8055068610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

31

121

0.93

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

19

139

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrn-assembly1.cif.gz_A crystal structure of pf1083 protein from pyrococcus furiosus, northeast structural genomics consortium target pfr223 0.9439 3 30
6fp1-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1 0.9369 3 30
3awi-assembly2.cif.gz_B bifunctional trna modification enzyme mnmc from escherichia coli 0.9336 2 34
6fp1-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1 0.9335 3 30
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9331 3 32
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9675 2 30 3.50.50.60
af_Q4CT13_9_352_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9451 4 34 3.50.50.60
3sglA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9398 4 33 3.50.50.60
af_I1LIA8_18_345_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9396 4 31 3.50.50.60
af_K7K8P2_5_195_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9332 4 34 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A1G8RT82-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9786 12 205
AF-A0A7K1FP19-F1-model_v4 NADP oxidoreductase 0.9768 1 204
AF-A0A4R6J5V7-F1-model_v4 NADP oxidoreductase 0.9748 73 205
AF-A0A1G8RT82-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9639 12 205
AF-A0A7K1FP19-F1-model_v4 NADP oxidoreductase 0.9627 1 204

Map