F443156

General Info

Members Datasets Scaffolds Average Seq Length
434 259 868 245

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0103122|Ga0495629_0103122_289_1143
Length 284
Sequence VTTESGTKESGGKAPRSIQPGAPRASESLLALKRRARRINRALAEQYPYAHAELDFRSPFELVVATVLSAQTTDVLVNQITPLLFARYPDARRMAEAEPAELEAIIKPTGFFRAKTRNLLALCNRLVDEYDGEVPGRLEDLVTLPGVGRKTANVVLGNAFGIPGITVDTHFGRLARRFGWTDSDDPVRIESDVAELFEPRDWTMLSHRVVFHGRRVCHARKPACGACAVANWCPSYGAGETDPEKARKLLKYELAPGQEALLARLLAETHRAAEIRMESQRKQP

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
253 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
254 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
255 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
256 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
257 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
258 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
259 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0.46
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 12.44
Rhizosphere 81.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0103122 3300046459 Bacteria 1990
2 JGI25152J39213_1000595 3300002773 Bacteria 19438
3 Ga0065714_10127041 3300005288 Bacteria 1286
4 Ga0070676_10031981 3300005328 Bacteria 3011
5 Ga0070683_100162712 3300005329 Bacteria 2117
6 Ga0070677_10006080 3300005333 Bacteria 4003
7 Ga0068869_100043777 3300005334 Bacteria 3217
8 Ga0070680_100010160 3300005336 Bacteria 7258
9 Ga0070682_100187500 3300005337 Bacteria 1450
10 Ga0070660_100159085 3300005339 Bacteria 1819
11 Ga0070661_100267918 3300005344 Bacteria 1322
12 Ga0070675_100029061 3300005354 Bacteria 4455
13 Ga0070671_100099166 3300005355 Bacteria 2443
14 Ga0070709_10130027 3300005434 Bacteria 1718
15 Ga0070714_100079806 3300005435 Bacteria 2846
16 Ga0070714_100213301 3300005435 Bacteria 1770
17 Ga0070713_100551500 3300005436 Bacteria 1091
18 Ga0070710_10048319 3300005437 Bacteria 2376
19 Ga0070710_10120682 3300005437 Bacteria 1587
20 Ga0070710_10222832 3300005437 Bacteria 1201
21 Ga0070711_100045633 3300005439 Bacteria 2982
22 Ga0070711_100699279 3300005439 Bacteria 853
23 Ga0070708_100030773 3300005445 Bacteria 4641
24 Ga0070708_100413118 3300005445 Bacteria 1273
25 Ga0070681_10043052 3300005458 Bacteria 4524
26 Ga0070681_10101642 3300005458 Bacteria 2820
27 Ga0070706_100015918 3300005467 Bacteria 6944
28 Ga0070707_100005631 3300005468 Bacteria 11706
29 Ga0070707_100372800 3300005468 Bacteria 1387
30 Ga0070698_100015282 3300005471 Bacteria 8116
31 Ga0070698_100100406 3300005471 Bacteria 2866
32 Ga0070699_100080476 3300005518 Bacteria 2839
33 Ga0070699_100288186 3300005518 Bacteria 1472
34 Ga0070679_100059117 3300005530 Bacteria 3820
35 Ga0070665_100130265 3300005548 Bacteria 2518
36 Ga0068856_100590334 3300005614 Bacteria 1132
37 Ga0068870_10497199 3300005840 Bacteria 812
38 Ga0068858_100000001 3300005842 Bacteria 417735
39 Ga0081455_10242064 3300005937 Bacteria 1325
40 Ga0070717_10056042 3300006028 Bacteria 3254
41 Ga0070717_10117412 3300006028 Bacteria 2276
42 Ga0075365_10100249 3300006038 Bacteria 1982
43 Ga0075363_100032456 3300006048 Bacteria 2712
44 Ga0075364_10107324 3300006051 Bacteria 1861
45 Ga0075364_10117437 3300006051 Bacteria 1779
46 Ga0070716_100007376 3300006173 Bacteria 5409
47 Ga0070712_100102418 3300006175 Bacteria 2120
48 Ga0075367_10004544 3300006178 Bacteria 6788
49 Ga0075367_10253055 3300006178 Bacteria 1105
50 Ga0097621_100273184 3300006237 Bacteria 1486
51 Ga0075370_10058327 3300006353 Bacteria 2195
52 Ga0068865_100306409 3300006881 Bacteria 1273
53 Ga0075435_100592883 3300007076 Bacteria 961
54 Ga0099794_10032085 3300007265 Bacteria 2464
55 Ga0105240_10232127 3300009093 Bacteria 2144
56 Ga0105245_10021016 3300009098 Bacteria 5725
57 Ga0105245_10099402 3300009098 Bacteria 2690
58 Ga0105245_10325117 3300009098 Bacteria 1516
59 Ga0105248_10001012 3300009177 Bacteria 31032
60 Ga0105248_10048439 3300009177 Bacteria 4767
61 Ga0105238_10585549 3300009551 Bacteria 1122
62 Ga0105246_10002459 3300011119 Bacteria 11185
63 Ga0105246_10019117 3300011119 Bacteria 4372
64 Ga0157373_10058939 3300013100 Bacteria 2721
65 Ga0157371_10259228 3300013102 Bacteria 1253
66 Ga0157370_10064733 3300013104 Bacteria 3460
67 Ga0157369_10076177 3300013105 Bacteria 3596
68 Ga0157369_10395787 3300013105 Bacteria 1433
69 Ga0157378_10455218 3300013297 Bacteria 1271
70 Ga0163162_10532804 3300013306 Bacteria 1303
71 Ga0163162_11004101 3300013306 Bacteria 943
72 Ga0163163_10221503 3300014325 Bacteria 1941
73 Ga0157377_10260915 3300014745 Bacteria 1127
74 Ga0157377_10319231 3300014745 Bacteria 1031
75 Ga0157379_10000010 3300014968 Bacteria 124601
76 Ga0163161_10070702 3300017792 Bacteria 2552
77 Ga0206353_10205279 3300020082 Bacteria 1812
78 Ga0206353_11350053 3300020082 Bacteria 5150
79 Ga0213875_10159896 3300021388 Bacteria 1057
80 Ga0209129_1000060 3300025258 Bacteria 248262
81 Ga0209025_1000805 3300025294 Bacteria 50620
82 Ga0209051_1023577 3300025303 Bacteria 2554
83 Ga0207697_10007621 3300025315 Bacteria 4807
84 Ga0207655_1005824 3300025728 Bacteria 8278
85 Ga0207682_10002847 3300025893 Bacteria 7629
86 Ga0207692_10012003 3300025898 Bacteria 3709
87 Ga0207647_10099037 3300025904 Bacteria 1732
88 Ga0207685_10000244 3300025905 Bacteria 8514
89 Ga0207645_10000753 3300025907 Bacteria 26943
90 Ga0207705_10027045 3300025909 Bacteria 4089
91 Ga0207684_10019473 3300025910 Bacteria 5805
92 Ga0207684_10028473 3300025910 Bacteria 4760
93 Ga0207684_10143766 3300025910 Bacteria 2052
94 Ga0207707_10017886 3300025912 Bacteria 6180
95 Ga0207707_10096936 3300025912 Bacteria 2577
96 Ga0207695_10180732 3300025913 Bacteria 2030
97 Ga0207693_10019673 3300025915 Bacteria 5369
98 Ga0207693_10049320 3300025915 Bacteria 3306
99 Ga0207663_10365659 3300025916 Bacteria 1095
100 Ga0207657_10024444 3300025919 Bacteria 5591
101 Ga0207649_10185797 3300025920 Bacteria 1458
102 Ga0207652_10029091 3300025921 Bacteria 4616
103 Ga0207646_10010027 3300025922 Bacteria 9301
104 Ga0207646_10063418 3300025922 Bacteria 3299
105 Ga0207646_10282617 3300025922 Bacteria 1500
106 Ga0207650_10055848 3300025925 Bacteria 2932
107 Ga0207687_10050271 3300025927 Bacteria 2901
108 Ga0207687_10070559 3300025927 Bacteria 2494
109 Ga0207700_10049111 3300025928 Bacteria 3137
110 Ga0207700_10467649 3300025928 Bacteria 1113
111 Ga0207664_10338950 3300025929 Bacteria 1329
112 Ga0207664_10536285 3300025929 Bacteria 1049
113 Ga0207644_10061785 3300025931 Bacteria 2715
114 Ga0207644_10151577 3300025931 Bacteria 1794
115 Ga0207704_10211426 3300025938 Bacteria 1428
116 Ga0207665_10014029 3300025939 Bacteria 5271
117 Ga0207665_10021432 3300025939 Bacteria 4249
118 Ga0207665_10150219 3300025939 Bacteria 1668
119 Ga0207691_10004792 3300025940 Bacteria 13094
120 Ga0207711_10285782 3300025941 Bacteria 1520
121 Ga0207661_10039841 3300025944 Bacteria 3690
122 Ga0207661_10409927 3300025944 Bacteria 1230
123 Ga0207658_10438465 3300025986 Bacteria 1154
124 Ga0207677_10326868 3300026023 Bacteria 1277
125 Ga0207703_10000007 3300026035 Bacteria 418220
126 Ga0207702_10195523 3300026078 Bacteria 1872
127 Ga0207702_10224576 3300026078 Bacteria 1752
128 Ga0207698_10085875 3300026142 Bacteria 2557
129 Ga0207698_10289767 3300026142 Bacteria 1519
130 Ga0207698_11176512 3300026142 Bacteria 780
131 Ga0265337_1001685 3300028556 Bacteria 10720
132 Ga0265326_10001256 3300028558 Bacteria 9024
133 Ga0265319_1002714 3300028563 Bacteria 9498
134 Ga0265334_10000618 3300028573 Bacteria 17860
135 Ga0265318_10008746 3300028577 Bacteria 4487
136 Ga0265322_10010065 3300028654 Bacteria 2743
137 Ga0265336_10003353 3300028666 Bacteria 6294
138 Ga0265338_10001346 3300028800 Bacteria 40029
139 Ga0265338_10271736 3300028800 Bacteria 1242
140 Ga0265332_10000905 3300031238 Bacteria 17790
141 Ga0265320_10006967 3300031240 Bacteria 7051
142 Ga0265340_10002575 3300031247 Bacteria 10302
143 Ga0265313_10008137 3300031595 Bacteria 7013
144 Ga0265314_10020769 3300031711 Bacteria 5066
145 Ga0265342_10017620 3300031712 Bacteria 4641
146 Ga0307405_10117844 3300031731 Bacteria 1811
147 Ga0307405_10141240 3300031731 Bacteria 1679
148 Ga0307405_10570608 3300031731 Bacteria 919
149 Ga0307413_10021726 3300031824 Bacteria 3443
150 Ga0307413_10056019 3300031824 Bacteria 2402
151 Ga0307410_10025579 3300031852 Bacteria 3706
152 Ga0307410_10659496 3300031852 Bacteria 878
153 Ga0307410_10774737 3300031852 Bacteria 814
154 Ga0307407_10004579 3300031903 Bacteria 5889
155 Ga0307407_10061793 3300031903 Bacteria 2191
156 Ga0307412_10007993 3300031911 Bacteria 6030
157 Ga0307412_10038452 3300031911 Bacteria 3082
158 Ga0307412_10053463 3300031911 Bacteria 2677
159 Ga0307412_10119632 3300031911 Bacteria 1894
160 Ga0307409_100002887 3300031995 Bacteria 9108
161 Ga0307409_100007897 3300031995 Bacteria 6408
162 Ga0307409_100239350 3300031995 Bacteria 1651
163 Ga0307416_100114778 3300032002 Bacteria 2383
164 Ga0307416_100408102 3300032002 Bacteria 1398
165 Ga0307414_10110388 3300032004 Bacteria 2092
166 Ga0307411_10027640 3300032005 Bacteria 3436
167 Ga0307415_100021160 3300032126 Bacteria 3991
168 Ga0307415_100027759 3300032126 Bacteria 3591
169 Ga0373958_0006861 3300034819 Bacteria 1792
170 Ga0373926_0007115 3300035083 Bacteria 3724
171 Ga0373934_0032509 3300035086 Bacteria 2046
172 Ga0373923_0039761 3300035111 Bacteria 1933
173 Ga0373932_0086960 3300035112 Bacteria 997
174 Ga0373936_0003643 3300035113 Bacteria 5783
175 Ga0373936_0030557 3300035113 Bacteria 2125
176 Ga0373945_0000701 3300035116 Bacteria 9705
177 Ga0373945_0025131 3300035116 Bacteria 2068
178 Ga0373953_0032603 3300035117 Bacteria 2033
179 Ga0373954_0137552 3300035118 Bacteria 1191
180 Ga0373943_0011877 3300035170 Bacteria 3919
181 Ga0373943_0201852 3300035170 Bacteria 1101
182 Ga0373946_0001378 3300035171 Bacteria 8418
183 Ga0373955_0011725 3300035172 Bacteria 4189
184 Ga0373924_0054242 3300035410 Bacteria 1666
185 Ga0373935_0015980 3300035692 Bacteria 4541
186 Ga0373935_0188231 3300035692 Bacteria 1420
187 Ga0373935_0538351 3300035692 Bacteria 850
188 Ga0373927_0086833 3300035695 Bacteria 2031
189 Ga0373927_0203623 3300035695 Bacteria 1299
190 Ga0373933_0005444 3300035724 Bacteria 6929
191 Ga0373933_0059758 3300035724 Bacteria 2296
192 Ga0373933_0289343 3300035724 Bacteria 1059
193 Ga0373937_0096775 3300036401 Bacteria 2737
194 Ga0373925_0006508 3300037068 Bacteria 8589
195 Ga0395899_0262486 3300037312 Bacteria 1181
196 Ga0395900_0097125 3300037418 Bacteria 3027
197 Ga0395898_0040691 3300037466 Bacteria 4594
198 Ga0395898_0391083 3300037466 Bacteria 1326
199 Ga0436364_0682537 3300037853 Bacteria 2288
200 Ga0436364_1213767 3300037853 Bacteria 852
201 Ga0395901_0328381 3300038443 Bacteria 1582
202 Ga0242420_030326 3300038996 Bacteria 1001
203 Ga0436365_1068602 3300039437 Bacteria 1420
204 Ga0436365_1914973 3300039437 Bacteria 862
205 Ga0436363_0583494 3300039450 Bacteria 3521
206 Ga0439442_000378 3300042002 Bacteria 10445
207 Ga0439449_0047549 3300042007 Bacteria 1588
208 Ga0466963_0058031 3300044694 Bacteria 2579
209 Ga0466957_0315851 3300044842 Bacteria 1053
210 Ga0466960_0044912 3300044901 Bacteria 2108
211 Ga0466960_0121623 3300044901 Bacteria 1368
212 Ga0466960_0162875 3300044901 Bacteria 1199
213 Ga0466959_0011187 3300045049 Bacteria 6436
214 Ga0466958_0000222 3300045836 Bacteria 21572
215 Ga0466967_0013783 3300045976 Bacteria 6265
216 Ga0466967_0147052 3300045976 Bacteria 2199
217 Ga0466967_0367153 3300045976 Bacteria 1395
218 Ga0466967_0593050 3300045976 Bacteria 1093
219 Ga0466967_0739275 3300045976 Bacteria 975
220 Ga0495592_0031864 3300046454 Bacteria 3981
221 Ga0495592_0054849 3300046454 Bacteria 2951
222 Ga0495592_0083854 3300046454 Bacteria 2301
223 Ga0495603_0029493 3300046455 Bacteria 3307
224 Ga0495629_0017316 3300046459 Bacteria 5167
225 Ga0495629_0024703 3300046459 Bacteria 4277
226 Ga0495629_0311396 3300046459 Bacteria 1077
227 Ga0495651_0108705 3300046462 Bacteria 2053
228 Ga0495653_0133065 3300046463 Bacteria 1757
229 Ga0495580_0004442 3300046472 Bacteria 11785
230 Ga0495580_0086047 3300046472 Bacteria 2189
231 Ga0495580_0184918 3300046472 Bacteria 1438
232 Ga0495582_0001907 3300046473 Bacteria 11716
233 Ga0495639_0000863 3300046475 Bacteria 13737
234 Ga0495639_0024673 3300046475 Bacteria 2647
235 Ga0495662_0001177 3300046476 Bacteria 12906
236 Ga0495664_0003240 3300046477 Bacteria 8843
237 Ga0495664_0046053 3300046477 Bacteria 2587
238 Ga0495664_0068602 3300046477 Bacteria 2116
239 Ga0495594_0310533 3300046499 Bacteria 898
240 Ga0495608_0097793 3300046511 Bacteria 1894
241 Ga0495610_0051033 3300046512 Bacteria 2016
242 Ga0495618_0013548 3300046514 Bacteria 4960
243 Ga0495618_0016673 3300046514 Bacteria 4498
244 Ga0495618_0074447 3300046514 Bacteria 2162
245 Ga0495628_0130909 3300046516 Bacteria 1919
246 Ga0495628_0145268 3300046516 Bacteria 1808
247 Ga0495630_0021275 3300046517 Bacteria 4789
248 Ga0495630_0071491 3300046517 Bacteria 2611
249 Ga0495630_0226299 3300046517 Bacteria 1428
250 Ga0495631_0021731 3300046518 Bacteria 2987
251 Ga0495643_0059149 3300046522 Bacteria 2038
252 Ga0495666_0009643 3300046526 Bacteria 4827
253 Ga0495652_0054058 3300046529 Bacteria 3420
254 Ga0495652_0063094 3300046529 Bacteria 3121
255 Ga0495652_0209168 3300046529 Bacteria 1474
256 Ga0495652_0234360 3300046529 Bacteria 1370
257 Ga0495665_0001341 3300046531 Bacteria 13142
258 Ga0495665_0002702 3300046531 Bacteria 9562
259 Ga0495665_0009372 3300046531 Bacteria 5302
260 Ga0495640_0014463 3300046533 Bacteria 5971
261 Ga0495640_0061796 3300046533 Bacteria 2543
262 Ga0495586_0004889 3300046535 Bacteria 7167
263 Ga0495586_0016000 3300046535 Bacteria 3990
264 Ga0495586_0155323 3300046535 Bacteria 1289
265 Ga0495587_0022980 3300046536 Bacteria 3834
266 Ga0495587_0047590 3300046536 Bacteria 2542
267 Ga0495587_0050453 3300046536 Bacteria 2462
268 Ga0495587_0074695 3300046536 Bacteria 1968
269 Ga0495645_0006257 3300046543 Bacteria 8249
270 Ga0495645_0018361 3300046543 Bacteria 5021
271 Ga0495645_0048565 3300046543 Bacteria 3091
272 Ga0495645_0189777 3300046543 Bacteria 1401
273 Ga0495667_0002148 3300046559 Bacteria 13143
274 Ga0495667_0011230 3300046559 Bacteria 6064
275 Ga0495667_0054723 3300046559 Bacteria 2625
276 Ga0495656_0001944 3300046615 Bacteria 6813
277 Ga0495668_0076169 3300046616 Bacteria 1842
278 Ga0495634_0012442 3300046642 Bacteria 6157
279 Ga0495635_0001453 3300046663 Bacteria 15856
280 Ga0495635_0064046 3300046663 Bacteria 2524
281 Ga0495635_0091890 3300046663 Bacteria 2075
282 Ga0495635_0281671 3300046663 Bacteria 1117
283 Ga0495588_0016156 3300046674 Bacteria 3604
284 Ga0495588_0017145 3300046674 Bacteria 3511
285 Ga0495588_0062891 3300046674 Bacteria 1924
286 Ga0495657_0015460 3300046675 Bacteria 5584
287 Ga0495657_0017474 3300046675 Bacteria 5206
288 Ga0495657_0075834 3300046675 Bacteria 2185
289 Ga0495599_0010965 3300046678 Bacteria 5560
290 Ga0495599_0194041 3300046678 Bacteria 1248
291 Ga0495623_0037991 3300046679 Bacteria 3079
292 Ga0495623_0210098 3300046679 Bacteria 1114
293 Ga0495658_0008393 3300046683 Bacteria 5118
294 Ga0495658_0202941 3300046683 Bacteria 1236
295 Ga0495613_0027174 3300046689 Bacteria 4258
296 Ga0495613_0232216 3300046689 Bacteria 1292
297 Ga0495624_0049130 3300046690 Bacteria 2675
298 Ga0495670_0005702 3300046691 Bacteria 6107
299 Ga0495600_0011257 3300046809 Bacteria 5570
300 Ga0495600_0014737 3300046809 Bacteria 4929
301 Ga0495600_0155894 3300046809 Bacteria 1477
302 Ga0495581_0006515 3300047315 Bacteria 6771
303 Ga0495581_0039411 3300047315 Bacteria 2734
304 Ga0495581_0076648 3300047315 Bacteria 1934
305 Ga0495604_0002865 3300047317 Bacteria 13831
306 Ga0495604_0006115 3300047317 Bacteria 9553
307 Ga0495604_0043640 3300047317 Bacteria 3509
308 Ga0495604_0147082 3300047317 Bacteria 1678
309 Ga0495636_0003800 3300047318 Bacteria 5885
310 Ga0495674_0359083 3300047319 Bacteria 1181
311 Ga0495676_0044806 3300047321 Bacteria 3607
312 Ga0495680_0005831 3300047322 Bacteria 11525
313 Ga0495680_0022154 3300047322 Bacteria 5303
314 Ga0495680_0032423 3300047322 Bacteria 4241
315 Ga0495680_0389746 3300047322 Bacteria 963
316 Ga0495675_0006238 3300047444 Bacteria 7292
317 Ga0495675_0015671 3300047444 Bacteria 4791
318 Ga0495675_0097718 3300047444 Bacteria 1840
319 Ga0495685_112980 3300047447 Bacteria 893
320 Ga0495684_0010027 3300047471 Bacteria 7325
321 Ga0495593_0002835 3300047673 Bacteria 10439
322 Ga0495593_0015891 3300047673 Bacteria 4253
323 Ga0495602_0054310 3300048088 Bacteria 3538
324 Ga0495602_0068668 3300048088 Bacteria 3042
325 Ga0496100_0014426 3300048903 Bacteria 4587
326 Ga0496100_0200680 3300048903 Bacteria 1453
327 Ga0496101_0014152 3300048904 Bacteria 5358
328 Ga0496101_0459693 3300048904 Bacteria 1004
329 Ga0496102_0035983 3300048905 Bacteria 4458
330 Ga0496102_0060479 3300048905 Bacteria 3464
331 Ga0496102_0092550 3300048905 Bacteria 2800
332 Ga0496102_0217311 3300048905 Bacteria 1802
333 Ga0496102_0240412 3300048905 Bacteria 1707
334 Ga0496103_0021623 3300048906 Bacteria 3870
335 Ga0496103_0064843 3300048906 Bacteria 2277
336 Ga0496103_0067072 3300048906 Bacteria 2240
337 Ga0496104_0314225 3300048907 Bacteria 1480
338 Ga0496104_0488198 3300048907 Bacteria 1143
339 Ga0496105_0114398 3300048908 Bacteria 2225
340 Ga0496105_0266854 3300048908 Bacteria 1383
341 Ga0496106_0068068 3300048909 Bacteria 2715
342 Ga0496106_0081872 3300048909 Bacteria 2480
343 Ga0496106_0114433 3300048909 Bacteria 2103
344 Ga0496107_0032162 3300048910 Bacteria 3748
345 Ga0496107_0039192 3300048910 Bacteria 3399
346 Ga0496108_0105701 3300048911 Bacteria 2404
347 Ga0496108_0127293 3300048911 Bacteria 2187
348 Ga0496108_0293553 3300048911 Bacteria 1415
349 Ga0496108_0520145 3300048911 Bacteria 1039
350 Ga0496108_0638026 3300048911 Bacteria 926
351 Ga0496109_0116553 3300048912 Bacteria 2486
352 Ga0496109_0126350 3300048912 Bacteria 2384
353 Ga0496109_0152935 3300048912 Bacteria 2161
354 Ga0496109_0345336 3300048912 Bacteria 1405
355 Ga0496110_0078052 3300048913 Bacteria 2947
356 Ga0496110_0086546 3300048913 Bacteria 2798
357 Ga0496110_0137733 3300048913 Bacteria 2206
358 Ga0496110_0170377 3300048913 Bacteria 1975
359 Ga0496110_0302887 3300048913 Bacteria 1456
360 Ga0496110_0399743 3300048913 Bacteria 1252
361 Ga0496111_0068214 3300048914 Bacteria 2584
362 Ga0496111_0101923 3300048914 Bacteria 2109
363 Ga0496111_0233689 3300048914 Bacteria 1365
364 Ga0496111_0325377 3300048914 Bacteria 1138
365 Ga0496112_0063731 3300048915 Bacteria 3636
366 Ga0496112_0192418 3300048915 Bacteria 2001
367 Ga0496113_0036563 3300048916 Bacteria 3598
368 Ga0496113_0044676 3300048916 Bacteria 3283
369 Ga0496113_0145417 3300048916 Bacteria 1867
370 Ga0496113_0279326 3300048916 Bacteria 1335
371 Ga0496114_0010724 3300048917 Bacteria 7293
372 Ga0496114_0039955 3300048917 Bacteria 3882
373 Ga0496114_0071811 3300048917 Bacteria 2910
374 Ga0496114_0076892 3300048917 Bacteria 2813
375 Ga0496114_0225425 3300048917 Bacteria 1646
376 Ga0496115_0034174 3300048918 Bacteria 4018
377 Ga0496115_0100936 3300048918 Bacteria 2365
378 Ga0496115_0180116 3300048918 Bacteria 1747
379 Ga0496120_0149693 3300048923 Bacteria 1175
380 Ga0496126_0330818 3300048929 Bacteria 1250
381 Ga0501031_0038291 3300049568 Bacteria 3130
382 Ga0501031_0173289 3300049568 Bacteria 1410
383 Ga0501031_0332528 3300049568 Bacteria 984
384 Ga0501031_0433425 3300049568 Bacteria 849
385 Ga0501033_0333811 3300049570 Bacteria 1064
386 Ga0501036_0072511 3300049572 Bacteria 2911
387 Ga0501039_0433890 3300049575 Bacteria 1032
388 Ga0501040_0251271 3300049576 Bacteria 1261
389 Ga0501041_0433641 3300049577 Bacteria 834
390 Ga0501042_0022572 3300049578 Bacteria 4397
391 Ga0501043_0304231 3300049579 Bacteria 1218
392 Ga0501046_0459183 3300049580 Bacteria 915
393 Ga0501067_0000820 3300049583 Bacteria 16779
394 Ga0501067_0037804 3300049583 Bacteria 2681
395 Ga0501068_0198587 3300049584 Bacteria 1272
396 Ga0501070_0004682 3300049586 Bacteria 11717
397 Ga0501072_0118490 3300049588 Bacteria 2109
398 Ga0501074_0067008 3300049590 Bacteria 2582
399 Ga0501074_0374883 3300049590 Bacteria 1010
400 Ga0501075_0305634 3300049591 Bacteria 1212
401 Ga0501075_0437628 3300049591 Bacteria 997
402 Ga0501080_0037954 3300049742 Bacteria 4499
403 Ga0501035_0070327 3300049822 Bacteria 3100
404 Ga0501044_0049649 3300049823 Bacteria 4331
405 Ga0501045_0102156 3300049824 Bacteria 2123
406 Ga0501045_0263736 3300049824 Bacteria 1282
407 Ga0501045_0531128 3300049824 Bacteria 873
408 nmdc:mga03n38_73266_c1 3300050490 Bacteria 1590
409 nmdc:mga00v17_99223_c1 3300050491 Bacteria 1837
410 nmdc:mga0yw44_108612_c1 3300050492 Bacteria 1776
411 nmdc:mga06z11_93717_c1 3300050494 Bacteria 1635
412 nmdc:mga07m45_48361_c1 3300050496 Bacteria 2392
413 nmdc:mga0rr50_125576_c1 3300050513 Bacteria 2048
414 nmdc:mga0rr50_318379_c1 3300050513 Bacteria 1304
415 Ga0495601_0020959 3300053077 Bacteria 3997
416 Ga0495601_0126386 3300053077 Bacteria 1663
417 Ga0495612_0007877 3300053078 Bacteria 4343
418 Ga0495595_0084034 3300053084 Bacteria 1520
419 Ga0495619_0013850 3300053085 Bacteria 5088
420 Ga0495619_0029588 3300053085 Bacteria 3540
421 Ga0501084_0175456 3300054114 Bacteria 1809
422 Ga0501084_0483958 3300054114 Bacteria 1046
423 Ga0501082_0425337 3300060353 Bacteria 1160
424 Ga0501082_0612036 3300060353 Bacteria 953
425 Ga0466962_0038229 3300061719 Bacteria 2298
426 Ga0466962_0197819 3300061719 Bacteria 982
427 Ga0530510_0512144 3300061734 Bacteria 910
428 2515855459 2515154155 Bacteria 7985436
429 2731907342 2731639228 Bacteria 4187555
430 2812348837 2811994878 Bacteria 5992952
431 2844850084 2844849076 Bacteria 4091819
432 2870806205 2870804320 Bacteria 2552467
433 2904777247 2904776348 Bacteria 4658726
434 2939602475 2939598168 Bacteria 4687164
435 Ga0495629_0103122
436 JGI25152J39213_1000595
437 Ga0065714_10127041
438 Ga0070676_10031981
439 Ga0070683_100162712
440 Ga0070677_10006080
441 Ga0068869_100043777
442 Ga0070680_100010160
443 Ga0070682_100187500
444 Ga0070660_100159085
445 Ga0070661_100267918
446 Ga0070675_100029061
447 Ga0070671_100099166
448 Ga0070709_10130027
449 Ga0070714_100079806
450 Ga0070714_100213301
451 Ga0070713_100551500
452 Ga0070710_10048319
453 Ga0070710_10120682
454 Ga0070710_10222832
455 Ga0070711_100045633
456 Ga0070711_100699279
457 Ga0070708_100030773
458 Ga0070708_100413118
459 Ga0070681_10043052
460 Ga0070681_10101642
461 Ga0070706_100015918
462 Ga0070707_100005631
463 Ga0070707_100372800
464 Ga0070698_100015282
465 Ga0070698_100100406
466 Ga0070699_100080476
467 Ga0070699_100288186
468 Ga0070679_100059117
469 Ga0070665_100130265
470 Ga0068856_100590334
471 Ga0068870_10497199
472 Ga0068858_100000001
473 Ga0081455_10242064
474 Ga0070717_10056042
475 Ga0070717_10117412
476 Ga0075365_10100249
477 Ga0075363_100032456
478 Ga0075364_10107324
479 Ga0075364_10117437
480 Ga0070716_100007376
481 Ga0070712_100102418
482 Ga0075367_10004544
483 Ga0075367_10253055
484 Ga0097621_100273184
485 Ga0075370_10058327
486 Ga0068865_100306409
487 Ga0075435_100592883
488 Ga0099794_10032085
489 Ga0105240_10232127
490 Ga0105245_10021016
491 Ga0105245_10099402
492 Ga0105245_10325117
493 Ga0105248_10001012
494 Ga0105248_10048439
495 Ga0105238_10585549
496 Ga0105246_10002459
497 Ga0105246_10019117
498 Ga0157373_10058939
499 Ga0157371_10259228
500 Ga0157370_10064733
501 Ga0157369_10076177
502 Ga0157369_10395787
503 Ga0157378_10455218
504 Ga0163162_10532804
505 Ga0163162_11004101
506 Ga0163163_10221503
507 Ga0157377_10260915
508 Ga0157377_10319231
509 Ga0157379_10000010
510 Ga0163161_10070702
511 Ga0206353_10205279
512 Ga0206353_11350053
513 Ga0213875_10159896
514 Ga0209129_1000060
515 Ga0209025_1000805
516 Ga0209051_1023577
517 Ga0207697_10007621
518 Ga0207655_1005824
519 Ga0207682_10002847
520 Ga0207692_10012003
521 Ga0207647_10099037
522 Ga0207685_10000244
523 Ga0207645_10000753
524 Ga0207705_10027045
525 Ga0207684_10019473
526 Ga0207684_10028473
527 Ga0207684_10143766
528 Ga0207707_10017886
529 Ga0207707_10096936
530 Ga0207695_10180732
531 Ga0207693_10019673
532 Ga0207693_10049320
533 Ga0207663_10365659
534 Ga0207657_10024444
535 Ga0207649_10185797
536 Ga0207652_10029091
537 Ga0207646_10010027
538 Ga0207646_10063418
539 Ga0207646_10282617
540 Ga0207650_10055848
541 Ga0207687_10050271
542 Ga0207687_10070559
543 Ga0207700_10049111
544 Ga0207700_10467649
545 Ga0207664_10338950
546 Ga0207664_10536285
547 Ga0207644_10061785
548 Ga0207644_10151577
549 Ga0207704_10211426
550 Ga0207665_10014029
551 Ga0207665_10021432
552 Ga0207665_10150219
553 Ga0207691_10004792
554 Ga0207711_10285782
555 Ga0207661_10039841
556 Ga0207661_10409927
557 Ga0207658_10438465
558 Ga0207677_10326868
559 Ga0207703_10000007
560 Ga0207702_10195523
561 Ga0207702_10224576
562 Ga0207698_10085875
563 Ga0207698_10289767
564 Ga0207698_11176512
565 Ga0265337_1001685
566 Ga0265326_10001256
567 Ga0265319_1002714
568 Ga0265334_10000618
569 Ga0265318_10008746
570 Ga0265322_10010065
571 Ga0265336_10003353
572 Ga0265338_10001346
573 Ga0265338_10271736
574 Ga0265332_10000905
575 Ga0265320_10006967
576 Ga0265340_10002575
577 Ga0265313_10008137
578 Ga0265314_10020769
579 Ga0265342_10017620
580 Ga0307405_10117844
581 Ga0307405_10141240
582 Ga0307405_10570608
583 Ga0307413_10021726
584 Ga0307413_10056019
585 Ga0307410_10025579
586 Ga0307410_10659496
587 Ga0307410_10774737
588 Ga0307407_10004579
589 Ga0307407_10061793
590 Ga0307412_10007993
591 Ga0307412_10038452
592 Ga0307412_10053463
593 Ga0307412_10119632
594 Ga0307409_100002887
595 Ga0307409_100007897
596 Ga0307409_100239350
597 Ga0307416_100114778
598 Ga0307416_100408102
599 Ga0307414_10110388
600 Ga0307411_10027640
601 Ga0307415_100021160
602 Ga0307415_100027759
603 Ga0373958_0006861
604 Ga0373926_0007115
605 Ga0373934_0032509
606 Ga0373923_0039761
607 Ga0373932_0086960
608 Ga0373936_0003643
609 Ga0373936_0030557
610 Ga0373945_0000701
611 Ga0373945_0025131
612 Ga0373953_0032603
613 Ga0373954_0137552
614 Ga0373943_0011877
615 Ga0373943_0201852
616 Ga0373946_0001378
617 Ga0373955_0011725
618 Ga0373924_0054242
619 Ga0373935_0015980
620 Ga0373935_0188231
621 Ga0373935_0538351
622 Ga0373927_0086833
623 Ga0373927_0203623
624 Ga0373933_0005444
625 Ga0373933_0059758
626 Ga0373933_0289343
627 Ga0373937_0096775
628 Ga0373925_0006508
629 Ga0395899_0262486
630 Ga0395900_0097125
631 Ga0395898_0040691
632 Ga0395898_0391083
633 Ga0436364_0682537
634 Ga0436364_1213767
635 Ga0395901_0328381
636 Ga0242420_030326
637 Ga0436365_1068602
638 Ga0436365_1914973
639 Ga0436363_0583494
640 Ga0439442_000378
641 Ga0439449_0047549
642 Ga0466963_0058031
643 Ga0466957_0315851
644 Ga0466960_0044912
645 Ga0466960_0121623
646 Ga0466960_0162875
647 Ga0466959_0011187
648 Ga0466958_0000222
649 Ga0466967_0013783
650 Ga0466967_0147052
651 Ga0466967_0367153
652 Ga0466967_0593050
653 Ga0466967_0739275
654 Ga0495592_0031864
655 Ga0495592_0054849
656 Ga0495592_0083854
657 Ga0495603_0029493
658 Ga0495629_0017316
659 Ga0495629_0024703
660 Ga0495629_0311396
661 Ga0495651_0108705
662 Ga0495653_0133065
663 Ga0495580_0004442
664 Ga0495580_0086047
665 Ga0495580_0184918
666 Ga0495582_0001907
667 Ga0495639_0000863
668 Ga0495639_0024673
669 Ga0495662_0001177
670 Ga0495664_0003240
671 Ga0495664_0046053
672 Ga0495664_0068602
673 Ga0495594_0310533
674 Ga0495608_0097793
675 Ga0495610_0051033
676 Ga0495618_0013548
677 Ga0495618_0016673
678 Ga0495618_0074447
679 Ga0495628_0130909
680 Ga0495628_0145268
681 Ga0495630_0021275
682 Ga0495630_0071491
683 Ga0495630_0226299
684 Ga0495631_0021731
685 Ga0495643_0059149
686 Ga0495666_0009643
687 Ga0495652_0054058
688 Ga0495652_0063094
689 Ga0495652_0209168
690 Ga0495652_0234360
691 Ga0495665_0001341
692 Ga0495665_0002702
693 Ga0495665_0009372
694 Ga0495640_0014463
695 Ga0495640_0061796
696 Ga0495586_0004889
697 Ga0495586_0016000
698 Ga0495586_0155323
699 Ga0495587_0022980
700 Ga0495587_0047590
701 Ga0495587_0050453
702 Ga0495587_0074695
703 Ga0495645_0006257
704 Ga0495645_0018361
705 Ga0495645_0048565
706 Ga0495645_0189777
707 Ga0495667_0002148
708 Ga0495667_0011230
709 Ga0495667_0054723
710 Ga0495656_0001944
711 Ga0495668_0076169
712 Ga0495634_0012442
713 Ga0495635_0001453
714 Ga0495635_0064046
715 Ga0495635_0091890
716 Ga0495635_0281671
717 Ga0495588_0016156
718 Ga0495588_0017145
719 Ga0495588_0062891
720 Ga0495657_0015460
721 Ga0495657_0017474
722 Ga0495657_0075834
723 Ga0495599_0010965
724 Ga0495599_0194041
725 Ga0495623_0037991
726 Ga0495623_0210098
727 Ga0495658_0008393
728 Ga0495658_0202941
729 Ga0495613_0027174
730 Ga0495613_0232216
731 Ga0495624_0049130
732 Ga0495670_0005702
733 Ga0495600_0011257
734 Ga0495600_0014737
735 Ga0495600_0155894
736 Ga0495581_0006515
737 Ga0495581_0039411
738 Ga0495581_0076648
739 Ga0495604_0002865
740 Ga0495604_0006115
741 Ga0495604_0043640
742 Ga0495604_0147082
743 Ga0495636_0003800
744 Ga0495674_0359083
745 Ga0495676_0044806
746 Ga0495680_0005831
747 Ga0495680_0022154
748 Ga0495680_0032423
749 Ga0495680_0389746
750 Ga0495675_0006238
751 Ga0495675_0015671
752 Ga0495675_0097718
753 Ga0495685_112980
754 Ga0495684_0010027
755 Ga0495593_0002835
756 Ga0495593_0015891
757 Ga0495602_0054310
758 Ga0495602_0068668
759 Ga0496100_0014426
760 Ga0496100_0200680
761 Ga0496101_0014152
762 Ga0496101_0459693
763 Ga0496102_0035983
764 Ga0496102_0060479
765 Ga0496102_0092550
766 Ga0496102_0217311
767 Ga0496102_0240412
768 Ga0496103_0021623
769 Ga0496103_0064843
770 Ga0496103_0067072
771 Ga0496104_0314225
772 Ga0496104_0488198
773 Ga0496105_0114398
774 Ga0496105_0266854
775 Ga0496106_0068068
776 Ga0496106_0081872
777 Ga0496106_0114433
778 Ga0496107_0032162
779 Ga0496107_0039192
780 Ga0496108_0105701
781 Ga0496108_0127293
782 Ga0496108_0293553
783 Ga0496108_0520145
784 Ga0496108_0638026
785 Ga0496109_0116553
786 Ga0496109_0126350
787 Ga0496109_0152935
788 Ga0496109_0345336
789 Ga0496110_0078052
790 Ga0496110_0086546
791 Ga0496110_0137733
792 Ga0496110_0170377
793 Ga0496110_0302887
794 Ga0496110_0399743
795 Ga0496111_0068214
796 Ga0496111_0101923
797 Ga0496111_0233689
798 Ga0496111_0325377
799 Ga0496112_0063731
800 Ga0496112_0192418
801 Ga0496113_0036563
802 Ga0496113_0044676
803 Ga0496113_0145417
804 Ga0496113_0279326
805 Ga0496114_0010724
806 Ga0496114_0039955
807 Ga0496114_0071811
808 Ga0496114_0076892
809 Ga0496114_0225425
810 Ga0496115_0034174
811 Ga0496115_0100936
812 Ga0496115_0180116
813 Ga0496120_0149693
814 Ga0496126_0330818
815 Ga0501031_0038291
816 Ga0501031_0173289
817 Ga0501031_0332528
818 Ga0501031_0433425
819 Ga0501033_0333811
820 Ga0501036_0072511
821 Ga0501039_0433890
822 Ga0501040_0251271
823 Ga0501041_0433641
824 Ga0501042_0022572
825 Ga0501043_0304231
826 Ga0501046_0459183
827 Ga0501067_0000820
828 Ga0501067_0037804
829 Ga0501068_0198587
830 Ga0501070_0004682
831 Ga0501072_0118490
832 Ga0501074_0067008
833 Ga0501074_0374883
834 Ga0501075_0305634
835 Ga0501075_0437628
836 Ga0501080_0037954
837 Ga0501035_0070327
838 Ga0501044_0049649
839 Ga0501045_0102156
840 Ga0501045_0263736
841 Ga0501045_0531128
842 nmdc:mga03n38_73266_c1
843 nmdc:mga00v17_99223_c1
844 nmdc:mga0yw44_108612_c1
845 nmdc:mga06z11_93717_c1
846 nmdc:mga07m45_48361_c1
847 nmdc:mga0rr50_125576_c1
848 nmdc:mga0rr50_318379_c1
849 Ga0495601_0020959
850 Ga0495601_0126386
851 Ga0495612_0007877
852 Ga0495595_0084034
853 Ga0495619_0013850
854 Ga0495619_0029588
855 Ga0501084_0175456
856 Ga0501084_0483958
857 Ga0501082_0425337
858 Ga0501082_0612036
859 Ga0466962_0038229
860 Ga0466962_0197819
861 Ga0530510_0512144
862 2515855459
863 2731907342
864 2812348837
865 2844850084
866 2870806205
867 2904777247
868 2939602475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10576

EndIII_4Fe-2S

Iron-sulfur binding domain of endonuclease III

217

233

0.99

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

64

199

0.96

PF00633

HHH

Helix-hairpin-helix motif

129

157

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ofh-assembly1.cif.gz_A structural basis for thymine glycosylase activity on t:o6-methylg mismatch by methyl-cpg binding domain protein 4: implications for roles of arg468 in mismatch recognition and catalysis 0.9033 38 136
4ea4-assembly1.cif.gz_A structure of the glycosylase domain of mbd4 bound to 5hmu-containing dna 0.9026 38 135
4ew0-assembly1.cif.gz_A mouse mbd4 glycosylase domain in complex with a g:5hmu (5-hydroxymethyluracil) mismatch 0.8982 38 138
7rdt-assembly1.cif.gz_A structure of human nthl1 - linker 1 chimera 0.8944 30 188
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.8928 12 188
ID Description Score Start End Superfamily
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9947 32 141 1.10.340.30
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.977 32 141 1.10.340.30
af_Q4CY47_40_146_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9715 38 135 1.10.340.30
af_Q58030_26_127_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.97 39 139 1.10.340.30
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9691 30 140 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A4Q4CRY3-F1-model_v4 Endonuclease III 0.9569 19 182 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A357IPJ2-F1-model_v4 Endonuclease III 0.9477 11 177 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A7K0TFR4-F1-model_v4 Endonuclease III 0.9415 12 172 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A554VT78-F1-model_v4 Endonuclease III 0.9399 10 171 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0051539
AF-A0A540RA75-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9394 14 188 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078

Map