F443121

General Info

Members Datasets Scaffolds Average Seq Length
434 249 422 269

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10190051|Ga0307405_101900512
Length 287
Sequence MSGLLRHCVPRNDDFMPELPEVETTVRGLEKVLQGRRLVRVEPRRADLRRAMPVDLGQRLTGARVTGLGRRAKYGLIETDRGDTLIFHLGMSGRWRIDPEEIGPHDHLLIESDDGHRLSLNDPRRFGSLDLVPTAEVASWPPFAVMGPEPLGDALSGAWLKQRLAGRTAAIKLMLLDQAIVAGLGNIYVCEALFRARIDPRRAAGKVSKARLDALVGAIRAVLDEAIAAGGSTLRDFARPDGELGYFSKQFDVYGREGERCRGDCGGTVKRFVQGGRSTFFCASCQR

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
6 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
7 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
8 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
9 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
10 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
11 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
12 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
82 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
245 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
246 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
247 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
248 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
249 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 16.59
Nodule 0
Rhizoplane 3.69
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001762 3300001915 Bacteria 5953
2 JGI24738J21930_10005673 3300002075 Bacteria 2972
3 JGI24751J29686_10000093 3300002459 Bacteria 50074
4 JGI25150J39212_1000465 3300002774 Bacteria 17717
5 JGI25151J46595_10029422 3300003187 Bacteria 2175
6 JGI25153J46596_10000029 3300003215 Bacteria 201658
7 Ga0055525_1000063 3300003759 Bacteria 198877
8 Ga0055525_1000064 3300003759 Bacteria 198750
9 Ga0055542_1000795 3300003762 Bacteria 23364
10 Ga0055542_1001337 3300003762 Bacteria 12843
11 Ga0055529_1000037 3300003763 Bacteria 237307
12 Ga0055526_1016035 3300003771 Bacteria 2966
13 Ga0055537_1003251 3300003773 Bacteria 5061
14 Ga0055524_1000410 3300003775 Bacteria 36259
15 Ga0055536_1014951 3300003781 Bacteria 2686
16 Ga0055530_10039588 3300003791 Bacteria 1163
17 Ga0055530_10040380 3300003791 Bacteria 1146
18 Ga0055540_1007633 3300003792 Bacteria 4039
19 Ga0055531_10020213 3300003794 Bacteria 2648
20 Ga0055531_10048253 3300003794 Bacteria 1150
21 Ga0055531_10048820 3300003794 Bacteria 1137
22 Ga0055543_1032020 3300004625 Bacteria 915
23 Ga0065165_1002223 3300005262 Bacteria 17324
24 Ga0065165_1005559 3300005262 Bacteria 7010
25 Ga0065165_1029801 3300005262 Bacteria 1744
26 Ga0065165_1065476 3300005262 Bacteria 980
27 Ga0070658_10000703 3300005327 Bacteria 29018
28 Ga0070658_10011480 3300005327 Bacteria 7104
29 Ga0070676_10042902 3300005328 Bacteria 2628
30 Ga0070676_10115907 3300005328 Bacteria 1675
31 Ga0070683_100497055 3300005329 Bacteria 1165
32 Ga0070670_100000005 3300005331 Bacteria 351569
33 Ga0070670_100040533 3300005331 Bacteria 4003
34 Ga0070670_100077904 3300005331 Bacteria 2848
35 Ga0070677_10052631 3300005333 Bacteria 1653
36 Ga0070666_10000476 3300005335 Bacteria 24221
37 Ga0070666_10080120 3300005335 Bacteria 2231
38 Ga0070680_100108767 3300005336 Bacteria 2306
39 Ga0070660_100001294 3300005339 Bacteria 17036
40 Ga0070660_100017915 3300005339 Bacteria 5167
41 Ga0070660_100119026 3300005339 Bacteria 2106
42 Ga0070660_100363056 3300005339 Bacteria 1194
43 Ga0070661_100014887 3300005344 Bacteria 5488
44 Ga0070661_100253939 3300005344 Bacteria 1357
45 Ga0070692_10025731 3300005345 Bacteria 2903
46 Ga0070692_10043587 3300005345 Bacteria 2308
47 Ga0070668_100000064 3300005347 Bacteria 65793
48 Ga0070668_100019555 3300005347 Bacteria 5097
49 Ga0070668_100091317 3300005347 Bacteria 2401
50 Ga0070669_100000096 3300005353 Bacteria 86930
51 Ga0070669_100000195 3300005353 Bacteria 53791
52 Ga0070675_100079591 3300005354 Bacteria 2731
53 Ga0070675_100142068 3300005354 Bacteria 2052
54 Ga0070671_100000045 3300005355 Bacteria 85779
55 Ga0070671_100017281 3300005355 Bacteria 5841
56 Ga0070674_100004401 3300005356 Bacteria 8030
57 Ga0070674_100010366 3300005356 Bacteria 5630
58 Ga0070673_100062226 3300005364 Bacteria 2965
59 Ga0070659_100000001 3300005366 Bacteria 576390
60 Ga0070659_100021220 3300005366 Bacteria 4941
61 Ga0070667_100000003 3300005367 Bacteria 447715
62 Ga0070667_100011334 3300005367 Bacteria 7374
63 Ga0070678_100007825 3300005456 Bacteria 6358
64 Ga0070662_100556418 3300005457 Bacteria 962
65 Ga0070681_10012624 3300005458 Bacteria 8380
66 Ga0070681_10100038 3300005458 Bacteria 2845
67 Ga0068867_100261624 3300005459 Bacteria 1411
68 Ga0070679_100407306 3300005530 Bacteria 1306
69 Ga0068853_100029337 3300005539 Bacteria 4636
70 Ga0068853_100094074 3300005539 Bacteria 2640
71 Ga0068853_100208329 3300005539 Bacteria 1781
72 Ga0070672_100080105 3300005543 Bacteria 2616
73 Ga0070686_100178733 3300005544 Bacteria 1506
74 Ga0070665_100000023 3300005548 Bacteria 375278
75 Ga0068854_100017271 3300005578 Bacteria 4826
76 Ga0068854_100037586 3300005578 Bacteria 3399
77 Ga0068854_100049025 3300005578 Bacteria 3015
78 Ga0068854_100057690 3300005578 Bacteria 2801
79 Ga0068856_100030557 3300005614 Bacteria 5265
80 Ga0068852_100071772 3300005616 Bacteria 3041
81 Ga0068852_100078536 3300005616 Bacteria 2920
82 Ga0068859_100000162 3300005617 Bacteria 65033
83 Ga0068859_100020051 3300005617 Bacteria 6714
84 Ga0068859_100028071 3300005617 Bacteria 5643
85 Ga0068859_100132544 3300005617 Bacteria 2564
86 Ga0068864_100000011 3300005618 Bacteria 350056
87 Ga0068864_100000677 3300005618 Bacteria 28506
88 Ga0068864_100004457 3300005618 Bacteria 11506
89 Ga0068861_100003029 3300005719 Bacteria 11100
90 Ga0068861_100004554 3300005719 Bacteria 9307
91 Ga0068861_100079246 3300005719 Bacteria 2567
92 Ga0068851_10038323 3300005834 Bacteria 2404
93 Ga0068863_100000784 3300005841 Bacteria 31931
94 Ga0068863_100028056 3300005841 Bacteria 5374
95 Ga0068863_100173482 3300005841 Bacteria 2069
96 Ga0068858_100000112 3300005842 Bacteria 86034
97 Ga0068858_100000892 3300005842 Bacteria 30965
98 Ga0068858_100002314 3300005842 Bacteria 19259
99 Ga0068860_100000045 3300005843 Bacteria 223252
100 Ga0068860_100004945 3300005843 Bacteria 13583
101 Ga0068862_100000011 3300005844 Bacteria 270105
102 Ga0068862_100000385 3300005844 Bacteria 47562
103 Ga0068862_100001387 3300005844 Bacteria 22482
104 Ga0068862_100007339 3300005844 Bacteria 9155
105 Ga0075432_10003913 3300006058 Bacteria 5072
106 Ga0075366_10028114 3300006195 Bacteria 3299
107 Ga0075366_10331383 3300006195 Bacteria 933
108 Ga0097620_100000162 3300006931 Bacteria 65033
109 Ga0097620_100020051 3300006931 Bacteria 6714
110 Ga0097620_100028069 3300006931 Bacteria 5643
111 Ga0097620_100132551 3300006931 Bacteria 2564
112 Ga0097620_100239520 3300006931 Bacteria 1903
113 Ga0105240_10314199 3300009093 Bacteria 1788
114 Ga0105245_10005071 3300009098 Bacteria 11578
115 Ga0105245_10013733 3300009098 Bacteria 7053
116 Ga0105247_10001548 3300009101 Bacteria 16396
117 Ga0105247_10436528 3300009101 Bacteria 941
118 Ga0105243_10000221 3300009148 Bacteria 66335
119 Ga0105241_10017028 3300009174 Bacteria 5335
120 Ga0105248_10000069 3300009177 Bacteria 120989
121 Ga0105248_10071990 3300009177 Bacteria 3885
122 Ga0105248_10105410 3300009177 Bacteria 3178
123 Ga0105237_10002971 3300009545 Bacteria 20505
124 Ga0105238_10655848 3300009551 Bacteria 1060
125 Ga0105249_10016302 3300009553 Bacteria 6590
126 Ga0105249_10874683 3300009553 Bacteria 965
127 Ga0157324_1001555 3300012506 Bacteria 1283
128 Ga0157326_1000018 3300012513 Bacteria 14715
129 Ga0157373_10058985 3300013100 Bacteria 2720
130 Ga0157371_10000256 3300013102 Bacteria 73768
131 Ga0157369_10242641 3300013105 Bacteria 1882
132 Ga0157369_10454584 3300013105 Bacteria 1326
133 Ga0157374_10151118 3300013296 Bacteria 2258
134 Ga0157378_10046547 3300013297 Bacteria 3856
135 Ga0157378_10051333 3300013297 Bacteria 3670
136 Ga0163162_10000823 3300013306 Bacteria 28858
137 Ga0163162_10290213 3300013306 Bacteria 1768
138 Ga0157372_10218242 3300013307 Bacteria 2211
139 Ga0157380_10000700 3300014326 Bacteria 20898
140 Ga0157379_10011118 3300014968 Bacteria 7849
141 Ga0163161_10062921 3300017792 Bacteria 2703
142 Ga0213875_10000105 3300021388 Bacteria 96051
143 Ga0213875_10008584 3300021388 Bacteria 5221
144 Ga0209674_109055 3300025226 Bacteria 1131
145 Ga0209563_100066 3300025230 Bacteria 257382
146 Ga0207425_1000041 3300025245 Bacteria 210441
147 Ga0207425_1011379 3300025245 Bacteria 2126
148 Ga0209148_1000011 3300025254 Bacteria 1196503
149 Ga0209129_1001272 3300025258 Bacteria 14424
150 Ga0209233_1017631 3300025261 Bacteria 1941
151 Ga0209565_1000008 3300025263 Bacteria 774179
152 Ga0209565_1000755 3300025263 Bacteria 19012
153 Ga0209455_1000006 3300025272 Bacteria 1196503
154 Ga0209673_1012801 3300025273 Bacteria 3354
155 Ga0209673_1013903 3300025273 Bacteria 3150
156 Ga0209675_1015297 3300025291 Bacteria 2288
157 Ga0209676_1013302 3300025292 Bacteria 3173
158 Ga0209676_1047606 3300025292 Bacteria 1152
159 Ga0209025_1000654 3300025294 Bacteria 60452
160 Ga0209564_1000565 3300025295 Bacteria 58712
161 Ga0209564_1037228 3300025295 Bacteria 1375
162 Ga0209758_1000004 3300025297 Bacteria 1375322
163 Ga0209758_1000017 3300025297 Bacteria 754393
164 Ga0209050_1000001 3300025298 Bacteria 3563507
165 Ga0209050_1010220 3300025298 Bacteria 4656
166 Ga0209050_1017968 3300025298 Bacteria 2781
167 Ga0209256_1000009 3300025299 Bacteria 922071
168 Ga0209256_1000010 3300025299 Bacteria 912110
169 Ga0209051_1000475 3300025303 Bacteria 52139
170 Ga0209257_1008341 3300025304 Bacteria 5923
171 Ga0209257_1008364 3300025304 Bacteria 5906
172 Ga0207697_10001562 3300025315 Bacteria 12366
173 Ga0207656_10012961 3300025321 Bacteria 3175
174 Ga0207682_10080950 3300025893 Bacteria 1392
175 Ga0207710_10061207 3300025900 Bacteria 1708
176 Ga0207688_10068880 3300025901 Bacteria 2005
177 Ga0207680_10000156 3300025903 Bacteria 33323
178 Ga0207680_10060831 3300025903 Bacteria 2301
179 Ga0207645_10082984 3300025907 Bacteria 2055
180 Ga0207705_10000513 3300025909 Bacteria 33021
181 Ga0207705_10011704 3300025909 Bacteria 6338
182 Ga0207705_10024244 3300025909 Bacteria 4330
183 Ga0207654_10004906 3300025911 Bacteria 6773
184 Ga0207707_10401823 3300025912 Bacteria 1176
185 Ga0207707_10484615 3300025912 Bacteria 1056
186 Ga0207695_10047824 3300025913 Bacteria 4523
187 Ga0207671_10001071 3300025914 Bacteria 33222
188 Ga0207671_10012983 3300025914 Bacteria 6663
189 Ga0207660_10041911 3300025917 Bacteria 3211
190 Ga0207660_10121560 3300025917 Bacteria 1978
191 Ga0207657_10000504 3300025919 Bacteria 41239
192 Ga0207657_10001645 3300025919 Bacteria 24085
193 Ga0207657_10002900 3300025919 Bacteria 18411
194 Ga0207657_10006411 3300025919 Bacteria 12208
195 Ga0207657_10034797 3300025919 Bacteria 4524
196 Ga0207649_10057685 3300025920 Bacteria 2428
197 Ga0207652_10089687 3300025921 Bacteria 2700
198 Ga0207652_10094189 3300025921 Bacteria 2637
199 Ga0207681_10000001 3300025923 Bacteria 1105841
200 Ga0207681_10000030 3300025923 Bacteria 173766
201 Ga0207681_10262860 3300025923 Bacteria 1352
202 Ga0207681_10437168 3300025923 Bacteria 1062
203 Ga0207694_10038386 3300025924 Bacteria 3682
204 Ga0207650_10000018 3300025925 Bacteria 352120
205 Ga0207650_10004846 3300025925 Bacteria 9193
206 Ga0207650_10057726 3300025925 Bacteria 2888
207 Ga0207659_10058902 3300025926 Bacteria 2759
208 Ga0207659_10117749 3300025926 Bacteria 2031
209 Ga0207659_10168015 3300025926 Bacteria 1728
210 Ga0207687_10016745 3300025927 Bacteria 4819
211 Ga0207687_10051979 3300025927 Bacteria 2858
212 Ga0207644_10000017 3300025931 Bacteria 177818
213 Ga0207644_10088561 3300025931 Bacteria 2302
214 Ga0207690_10000018 3300025932 Bacteria 238992
215 Ga0207690_10015155 3300025932 Bacteria 4668
216 Ga0207690_10034872 3300025932 Bacteria 3245
217 Ga0207706_10028490 3300025933 Bacteria 4988
218 Ga0207709_10000078 3300025935 Bacteria 169141
219 Ga0207669_10000020 3300025937 Bacteria 105051
220 Ga0207669_10003084 3300025937 Bacteria 7176
221 Ga0207691_10092889 3300025940 Bacteria 2702
222 Ga0207711_10021763 3300025941 Bacteria 5354
223 Ga0207711_10032762 3300025941 Bacteria 4395
224 Ga0207661_10214840 3300025944 Bacteria 1697
225 Ga0207667_10000002 3300025949 Bacteria 895662
226 Ga0207668_10000030 3300025972 Bacteria 122797
227 Ga0207668_10000620 3300025972 Bacteria 22083
228 Ga0207668_10003547 3300025972 Bacteria 9173
229 Ga0207668_10018106 3300025972 Bacteria 4426
230 Ga0207668_10056000 3300025972 Bacteria 2744
231 Ga0207668_10221113 3300025972 Bacteria 1521
232 Ga0207640_10013334 3300025981 Bacteria 4706
233 Ga0207640_10025277 3300025981 Bacteria 3592
234 Ga0207640_10063924 3300025981 Bacteria 2448
235 Ga0207658_10000002 3300025986 Bacteria 1364188
236 Ga0207658_10000350 3300025986 Bacteria 45928
237 Ga0207658_10012120 3300025986 Bacteria 5879
238 Ga0207658_10129351 3300025986 Bacteria 2026
239 Ga0207677_10000013 3300026023 Bacteria 186519
240 Ga0207703_10000358 3300026035 Bacteria 49140
241 Ga0207703_10003384 3300026035 Bacteria 13391
242 Ga0207703_10009901 3300026035 Bacteria 7478
243 Ga0207639_10002135 3300026041 Bacteria 13313
244 Ga0207639_10005755 3300026041 Bacteria 8392
245 Ga0207639_10039066 3300026041 Bacteria 3534
246 Ga0207639_10120019 3300026041 Bacteria 2159
247 Ga0207678_10006261 3300026067 Bacteria 10569
248 Ga0207702_10012593 3300026078 Bacteria 7039
249 Ga0207641_10000720 3300026088 Bacteria 35557
250 Ga0207641_10001779 3300026088 Bacteria 20758
251 Ga0207641_10006993 3300026088 Bacteria 9441
252 Ga0207641_10014895 3300026088 Bacteria 6375
253 Ga0207676_10000004 3300026095 Bacteria 725417
254 Ga0207676_10001237 3300026095 Bacteria 19005
255 Ga0207676_10003709 3300026095 Bacteria 10800
256 Ga0207674_10010604 3300026116 Bacteria 10425
257 Ga0207675_100000221 3300026118 Bacteria 53325
258 Ga0207675_100004956 3300026118 Bacteria 12833
259 Ga0207675_100061325 3300026118 Bacteria 3511
260 Ga0207683_10001150 3300026121 Bacteria 24080
261 Ga0207683_10145831 3300026121 Bacteria 2134
262 Ga0207698_10018394 3300026142 Bacteria 4760
263 Ga0268266_10000002 3300028379 Bacteria 3059047
264 Ga0268265_10000002 3300028380 Bacteria 1035381
265 Ga0268265_10000074 3300028380 Bacteria 127599
266 Ga0268265_10000469 3300028380 Bacteria 42727
267 Ga0268265_10008631 3300028380 Bacteria 6887
268 Ga0268264_10000101 3300028381 Bacteria 225109
269 Ga0268264_10000215 3300028381 Bacteria 113994
270 Ga0307513_10042610 3300031456 Bacteria 4996
271 Ga0307408_100016701 3300031548 Bacteria 4906
272 Ga0307408_100298559 3300031548 Bacteria 1348
273 Ga0316576_10075158 3300031727 Bacteria 2499
274 Ga0307405_10190051 3300031731 Bacteria 1482
275 Ga0307413_10034689 3300031824 Bacteria 2886
276 Ga0307413_10088682 3300031824 Bacteria 2007
277 Ga0307413_10258151 3300031824 Bacteria 1297
278 Ga0307410_10090984 3300031852 Bacteria 2165
279 Ga0307410_10096887 3300031852 Bacteria 2106
280 Ga0307406_10235274 3300031901 Bacteria 1370
281 Ga0307406_10244978 3300031901 Bacteria 1347
282 Ga0307412_10003432 3300031911 Bacteria 8806
283 Ga0307412_10025800 3300031911 Bacteria 3644
284 Ga0307412_10031934 3300031911 Bacteria 3330
285 Ga0307412_10052199 3300031911 Bacteria 2706
286 Ga0307409_100027886 3300031995 Bacteria 4011
287 Ga0307409_100141095 3300031995 Bacteria 2076
288 Ga0307409_100435612 3300031995 Bacteria 1261
289 Ga0307409_100460047 3300031995 Bacteria 1230
290 Ga0307416_100059138 3300032002 Bacteria 3112
291 Ga0307416_100111409 3300032002 Bacteria 2413
292 Ga0307416_100166410 3300032002 Bacteria 2046
293 Ga0307416_100307108 3300032002 Bacteria 1580
294 Ga0307414_10026412 3300032004 Bacteria 3737
295 Ga0307414_10084992 3300032004 Bacteria 2329
296 Ga0307414_10091650 3300032004 Bacteria 2259
297 Ga0307414_10164329 3300032004 Bacteria 1767
298 Ga0307414_10201109 3300032004 Bacteria 1620
299 Ga0307411_10024284 3300032005 Bacteria 3610
300 Ga0307411_10024975 3300032005 Bacteria 3571
301 Ga0307411_10134579 3300032005 Bacteria 1812
302 Ga0307411_10213253 3300032005 Bacteria 1492
303 Ga0307415_100029147 3300032126 Bacteria 3523
304 Ga0307415_100194228 3300032126 Bacteria 1604
305 Ga0316584_0196193 3300036712 Bacteria 1491
306 Ga0395899_0000287 3300037312 Bacteria 64885
307 Ga0395899_0036920 3300037312 Bacteria 3664
308 Ga0395900_0000031 3300037418 Bacteria 262393
309 Ga0395900_1012086 3300037418 Bacteria 750
310 Ga0395905_0159596 3300037471 Bacteria 2120
311 Ga0395905_0208768 3300037471 Bacteria 1830
312 Ga0395905_0800343 3300037471 Bacteria 845
313 Ga0436364_0184827 3300037853 Bacteria 146498
314 Ga0436364_0393449 3300037853 Bacteria 15268
315 Ga0395901_0000035 3300038443 Bacteria 223888
316 Ga0395901_0785287 3300038443 Bacteria 942
317 Ga0436363_1197184 3300039450 Bacteria 1365
318 Ga0439431_0052130 3300041997 Bacteria 1062
319 Ga0466963_0004653 3300044694 Bacteria 8005
320 Ga0466963_0214661 3300044694 Bacteria 1347
321 Ga0466963_0386784 3300044694 Bacteria 986
322 Ga0466957_0371265 3300044842 Bacteria 974
323 Ga0466958_0054518 3300045836 Bacteria 2425
324 Ga0466967_0073170 3300045976 Bacteria 3074
325 Ga0466967_0135671 3300045976 Bacteria 2288
326 Ga0495617_006544 3300046452 Bacteria 4079
327 Ga0495650_0000172 3300046471 Bacteria 142776
328 Ga0495584_0079864 3300046491 Bacteria 1646
329 Ga0495585_0027930 3300046492 Bacteria 3220
330 Ga0495585_0119642 3300046492 Bacteria 1394
331 Ga0495585_0175580 3300046492 Bacteria 1104
332 Ga0495583_0002048 3300046506 Bacteria 18294
333 Ga0495583_0004847 3300046506 Bacteria 9408
334 Ga0495583_0011033 3300046506 Bacteria 5210
335 Ga0495631_0158880 3300046518 Bacteria 970
336 Ga0495632_0100441 3300046519 Bacteria 1364
337 Ga0495643_0017797 3300046522 Bacteria 4145
338 Ga0495648_0000249 3300046524 Bacteria 60793
339 Ga0495663_0001306 3300046525 Bacteria 7894
340 Ga0495666_0068554 3300046526 Bacteria 1689
341 Ga0495587_0198068 3300046536 Bacteria 1136
342 Ga0495622_0019534 3300046557 Bacteria 3154
343 Ga0495668_0000080 3300046616 Bacteria 157259
344 Ga0495668_0017868 3300046616 Bacteria 4109
345 Ga0495625_0000541 3300046660 Bacteria 55446
346 Ga0495625_0179937 3300046660 Bacteria 1407
347 Ga0495661_0016849 3300046665 Bacteria 4831
348 Ga0495669_0000011 3300046684 Bacteria 158720
349 Ga0495649_0201673 3300046694 Bacteria 1033
350 Ga0495683_0019425 3300047323 Bacteria 3507
351 Ga0495687_000082 3300047443 Bacteria 147137
352 Ga0495687_002094 3300047443 Bacteria 16772
353 Ga0495677_0006435 3300047445 Bacteria 4439
354 Ga0495681_0005821 3300047470 Bacteria 8188
355 Ga0495681_0024906 3300047470 Bacteria 3139
356 Ga0495686_0163232 3300047472 Bacteria 1300
357 Ga0496102_0000034 3300048905 Bacteria 213826
358 Ga0496102_0000471 3300048905 Bacteria 44758
359 Ga0496102_0069336 3300048905 Bacteria 3237
360 Ga0496103_0000026 3300048906 Bacteria 213826
361 Ga0496103_0000166 3300048906 Bacteria 69117
362 Ga0496104_0010654 3300048907 Bacteria 8217
363 Ga0496105_0003221 3300048908 Bacteria 12024
364 Ga0496105_0211386 3300048908 Bacteria 1581
365 Ga0496109_0096519 3300048912 Bacteria 2739
366 Ga0496110_0101023 3300048913 Bacteria 2585
367 Ga0496111_0037863 3300048914 Bacteria 3453
368 Ga0496114_0076871 3300048917 Bacteria 2814
369 Ga0496115_0000030 3300048918 Bacteria 138328
370 Ga0496115_0000390 3300048918 Bacteria 36134
371 Ga0496116_0006531 3300048919 Bacteria 10566
372 Ga0496116_0010032 3300048919 Bacteria 7989
373 Ga0496117_0000072 3300048920 Bacteria 238366
374 Ga0496117_0000142 3300048920 Bacteria 157953
375 Ga0496117_0014014 3300048920 Bacteria 6938
376 Ga0496117_0020049 3300048920 Bacteria 5468
377 Ga0496118_0000030 3300048921 Bacteria 339946
378 Ga0496118_0000115 3300048921 Bacteria 146533
379 Ga0496118_0004303 3300048921 Bacteria 17009
380 Ga0496119_0059672 3300048922 Bacteria 2290
381 Ga0496120_0072884 3300048923 Bacteria 1881
382 Ga0496120_0100512 3300048923 Bacteria 1529
383 Ga0496121_0000104 3300048924 Bacteria 192186
384 Ga0496121_0000193 3300048924 Bacteria 136526
385 Ga0496122_0043264 3300048925 Bacteria 3531
386 Ga0496123_0028176 3300048926 Bacteria 4165
387 Ga0496123_0212985 3300048926 Bacteria 980
388 Ga0496124_0000061 3300048927 Bacteria 238225
389 Ga0496124_0000071 3300048927 Bacteria 220642
390 Ga0496124_0000146 3300048927 Bacteria 146468
391 Ga0496124_0055280 3300048927 Bacteria 3355
392 Ga0496124_0163651 3300048927 Bacteria 1731
393 Ga0496124_0177346 3300048927 Bacteria 1643
394 Ga0496125_0003343 3300048928 Bacteria 19548
395 Ga0496126_0000174 3300048929 Bacteria 146468
396 Ga0501032_0122302 3300049569 Bacteria 1720
397 Ga0501038_0046077 3300049574 Bacteria 3782
398 Ga0501043_0061428 3300049579 Bacteria 2951
399 Ga0501047_0014341 3300049581 Bacteria 7535
400 Ga0501249_000536 3300049679 Bacteria 9134
401 Ga0501268_024578 3300049765 Bacteria 1053
402 Ga0501044_0046060 3300049823 Bacteria 4517
403 Ga0501204_005365 3300049850 Bacteria 1404
404 nmdc:mga0k408_109619_c1 3300050493 Bacteria 1631
405 nmdc:mga0k408_63030_c1 3300050493 Bacteria 2156
406 Ga0500610_0000413 3300053079 Bacteria 13122
407 Ga0500643_004336 3300053087 Bacteria 6467
408 Ga0500643_034058 3300053087 Bacteria 1536
409 Ga0500643_039988 3300053087 Bacteria 1383
410 Ga0500592_018666 3300053116 Bacteria 1113
411 Ga0500595_001555 3300053119 Bacteria 12143
412 Ga0500618_003530 3300053125 Bacteria 5325
413 Ga0500642_0001088 3300053130 Bacteria 7802
414 Ga0500559_0017236 3300053136 Bacteria 3050
415 Ga0500559_0044675 3300053136 Bacteria 1938
416 Ga0500568_0026030 3300053139 Bacteria 2459
417 Ga0500577_0025971 3300053142 Bacteria 1988
418 Ga0500588_0068779 3300053146 Bacteria 1155
419 Ga0500619_037962 3300053154 Bacteria 1507
420 Ga0500624_000060 3300053157 Bacteria 68534
421 Ga0500645_000001 3300053730 Bacteria 455558
422 Ga0500596_004764 3300053735 Bacteria 2454

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_1012086 Ga0395900_1012086_12_686 224
2 3300038443 Ga0395901_0785287 Ga0395901_0785287_12_686 224
3 3300044694 Ga0466963_0386784 Ga0466963_0386784_79_765 228
4 iso_pu_bacteria 2896429255 2896430595 229
5 3300037471 Ga0395905_0800343 Ga0395905_0800343_50_751 233
6 3300037471 Ga0395905_0159596 Ga0395905_0159596_233_1039 238
7 3300026041 Ga0207639_10039066 Ga0207639_100390663 239
8 3300021388 Ga0213875_10008584 Ga0213875_100085846 241
9 3300037853 Ga0436364_0393449 Ga0436364_0393449_11688_12521 241
10 3300044694 Ga0466963_0004653 Ga0466963_0004653_295_1101 248
11 3300044842 Ga0466957_0371265 Ga0466957_0371265_57_863 248
12 3300045836 Ga0466958_0054518 Ga0466958_0054518_976_1782 248
13 3300045976 Ga0466967_0135671 Ga0466967_0135671_1197_2003 248
14 3300049569 Ga0501032_0122302 Ga0501032_0122302_439_1251 257
15 3300049579 Ga0501043_0061428 Ga0501043_0061428_1391_2203 257
16 3300049581 Ga0501047_0014341 Ga0501047_0014341_6038_6850 257
17 3300049679 Ga0501249_000536 Ga0501249_000536_2160_2972 257
18 3300049823 Ga0501044_0046060 Ga0501044_0046060_2354_3166 257
19 3300049850 Ga0501204_005365 Ga0501204_005365_135_947 257
20 3300013297 Ga0157378_10051333 Ga0157378_100513333 258
21 3300005578 Ga0068854_100037586 Ga0068854_1000375863 260
22 3300025981 Ga0207640_10013334 Ga0207640_100133343 260
23 iso_pu_bacteria 2599185359 2600225314 265
24 iso_pu_bacteria 2818991466 2819713583 265
25 iso_pu_bacteria 2879163058 2879166298 265
26 iso_pu_bacteria 2928526807 2928530115 265
27 iso_pu_bacteria 2928968154 2928969698 265
28 iso_pu_bacteria 2582581305 2585260476 266
29 iso_pu_bacteria 2643221605 2644037534 266
30 iso_pu_bacteria 2885429604 2885430423 266
31 iso_pu_bacteria 2990265787 2990265857 266
32 iso_pu_bacteria 2993693658 2993696352 266
33 3300005327 Ga0070658_10011480 Ga0070658_100114807 268
34 3300005328 Ga0070676_10115907 Ga0070676_101159072 268
35 3300005336 Ga0070680_100108767 Ga0070680_1001087672 268
36 3300005339 Ga0070660_100017915 Ga0070660_1000179153 268
37 3300005344 Ga0070661_100014887 Ga0070661_1000148873 268
38 3300005345 Ga0070692_10025731 Ga0070692_100257313 268
39 3300005345 Ga0070692_10043587 Ga0070692_100435872 268
40 3300005354 Ga0070675_100142068 Ga0070675_1001420683 268
41 3300005366 Ga0070659_100021220 Ga0070659_1000212202 268
42 3300005458 Ga0070681_10012624 Ga0070681_100126246 268
43 3300005458 Ga0070681_10100038 Ga0070681_101000383 268
44 3300005530 Ga0070679_100407306 Ga0070679_1004073062 268
45 3300005539 Ga0068853_100094074 Ga0068853_1000940742 268
46 3300005543 Ga0070672_100080105 Ga0070672_1000801052 268
47 3300013100 Ga0157373_10058985 Ga0157373_100589852 268
48 3300013307 Ga0157372_10218242 Ga0157372_102182422 268
49 3300025909 Ga0207705_10011704 Ga0207705_100117043 268
50 3300025909 Ga0207705_10024244 Ga0207705_100242443 268
51 3300025912 Ga0207707_10401823 Ga0207707_104018232 268
52 3300025912 Ga0207707_10484615 Ga0207707_104846151 268
53 3300025917 Ga0207660_10041911 Ga0207660_100419113 268
54 3300025917 Ga0207660_10121560 Ga0207660_101215602 268
55 3300025919 Ga0207657_10000504 Ga0207657_1000050428 268
56 3300025919 Ga0207657_10001645 Ga0207657_1000164519 268
57 3300025919 Ga0207657_10002900 Ga0207657_1000290010 268
58 3300025920 Ga0207649_10057685 Ga0207649_100576853 268
59 3300025921 Ga0207652_10089687 Ga0207652_100896872 268
60 3300025921 Ga0207652_10094189 Ga0207652_100941893 268
61 3300025926 Ga0207659_10168015 Ga0207659_101680153 268
62 3300025932 Ga0207690_10034872 Ga0207690_100348721 268
63 3300025940 Ga0207691_10092889 Ga0207691_100928893 268
64 3300026041 Ga0207639_10120019 Ga0207639_101200192 268
65 3300037312 Ga0395899_0000287 Ga0395899_0000287_28659_29492 268
66 3300037418 Ga0395900_0000031 Ga0395900_0000031_192944_193777 268
67 3300037471 Ga0395905_0208768 Ga0395905_0208768_672_1505 268
68 3300038443 Ga0395901_0000035 Ga0395901_0000035_92135_92968 268
69 3300045976 Ga0466967_0073170 Ga0466967_0073170_1710_2543 268
70 iso_pu_bacteria 2599185354 2600201659 268
71 3300002774 JGI25150J39212_1000465 JGI25150J39212_10004657 269
72 3300003187 JGI25151J46595_10029422 JGI25151J46595_100294223 269
73 3300003215 JGI25153J46596_10000029 JGI25153J46596_1000002965 269
74 3300003771 Ga0055526_1016035 Ga0055526_10160353 269
75 3300003773 Ga0055537_1003251 Ga0055537_10032514 269
76 3300003775 Ga0055524_1000410 Ga0055524_100041036 269
77 3300003781 Ga0055536_1014951 Ga0055536_10149511 269
78 3300003791 Ga0055530_10039588 Ga0055530_100395882 269
79 3300003791 Ga0055530_10040380 Ga0055530_100403801 269
80 3300003792 Ga0055540_1007633 Ga0055540_10076335 269
81 3300003794 Ga0055531_10020213 Ga0055531_100202132 269
82 3300003794 Ga0055531_10048253 Ga0055531_100482531 269
83 3300003794 Ga0055531_10048820 Ga0055531_100488201 269
84 3300004625 Ga0055543_1032020 Ga0055543_10320201 269
85 3300005262 Ga0065165_1002223 Ga0065165_10022233 269
86 3300005262 Ga0065165_1029801 Ga0065165_10298011 269
87 3300005262 Ga0065165_1065476 Ga0065165_10654761 269
88 3300005578 Ga0068854_100057690 Ga0068854_1000576902 269
89 3300005842 Ga0068858_100000112 Ga0068858_10000011254 269
90 3300009098 Ga0105245_10005071 Ga0105245_100050718 269
91 3300009545 Ga0105237_10002971 Ga0105237_1000297123 269
92 3300013105 Ga0157369_10242641 Ga0157369_102426412 269
93 3300013306 Ga0163162_10290213 Ga0163162_102902132 269
94 3300025245 Ga0207425_1000041 Ga0207425_1000041189 269
95 3300025245 Ga0207425_1011379 Ga0207425_10113793 269
96 3300025258 Ga0209129_1001272 Ga0209129_100127210 269
97 3300025263 Ga0209565_1000008 Ga0209565_1000008486 269
98 3300025263 Ga0209565_1000755 Ga0209565_100075519 269
99 3300025273 Ga0209673_1012801 Ga0209673_10128013 269
100 3300025273 Ga0209673_1013903 Ga0209673_10139033 269
101 3300025291 Ga0209675_1015297 Ga0209675_10152973 269
102 3300025292 Ga0209676_1013302 Ga0209676_10133023 269
103 3300025292 Ga0209676_1047606 Ga0209676_10476062 269
104 3300025294 Ga0209025_1000654 Ga0209025_100065454 269
105 3300025295 Ga0209564_1000565 Ga0209564_100056549 269
106 3300025295 Ga0209564_1037228 Ga0209564_10372281 269
107 3300025297 Ga0209758_1000004 Ga0209758_1000004257 269
108 3300025298 Ga0209050_1000001 Ga0209050_10000012210 269
109 3300025298 Ga0209050_1010220 Ga0209050_10102203 269
110 3300025298 Ga0209050_1017968 Ga0209050_10179683 269
111 3300025299 Ga0209256_1000009 Ga0209256_1000009384 269
112 3300025299 Ga0209256_1000010 Ga0209256_1000010308 269
113 3300025303 Ga0209051_1000475 Ga0209051_10004755 269
114 3300025304 Ga0209257_1008341 Ga0209257_10083411 269
115 3300025304 Ga0209257_1008364 Ga0209257_10083641 269
116 3300025914 Ga0207671_10012983 Ga0207671_100129834 269
117 3300025923 Ga0207681_10262860 Ga0207681_102628602 269
118 3300025924 Ga0207694_10038386 Ga0207694_100383863 269
119 3300025972 Ga0207668_10221113 Ga0207668_102211132 269
120 3300025981 Ga0207640_10063924 Ga0207640_100639243 269
121 3300026035 Ga0207703_10009901 Ga0207703_100099016 269
122 3300031727 Ga0316576_10075158 Ga0316576_100751582 269
123 3300031911 Ga0307412_10003432 Ga0307412_100034326 269
124 3300036712 Ga0316584_0196193 Ga0316584_0196193_51_872 269
125 3300041997 Ga0439431_0052130 Ga0439431_0052130_121_930 269
126 3300046492 Ga0495585_0119642 Ga0495585_0119642_427_1236 269
127 3300046526 Ga0495666_0068554 Ga0495666_0068554_232_1041 269
128 3300046660 Ga0495625_0179937 Ga0495625_0179937_148_957 269
129 3300047470 Ga0495681_0024906 Ga0495681_0024906_14_823 269
130 3300048918 Ga0496115_0000390 Ga0496115_0000390_9262_10071 269
131 3300048923 Ga0496120_0100512 Ga0496120_0100512_516_1325 269
132 3300048925 Ga0496122_0043264 Ga0496122_0043264_2056_2865 269
133 3300048926 Ga0496123_0212985 Ga0496123_0212985_73_882 269
134 3300048927 Ga0496124_0000071 Ga0496124_0000071_159_968 269
135 3300048927 Ga0496124_0163651 Ga0496124_0163651_763_1572 269
136 3300048927 Ga0496124_0177346 Ga0496124_0177346_719_1528 269
137 3300053087 Ga0500643_039988 Ga0500643_039988_372_1181 269
138 3300053136 Ga0500559_0044675 Ga0500559_0044675_969_1778 269
139 3300053139 Ga0500568_0026030 Ga0500568_0026030_1495_2304 269
140 3300053146 Ga0500588_0068779 Ga0500588_0068779_189_998 269
141 3300001915 JGI24741J21665_1001762 JGI24741J21665_10017625 270
142 3300002075 JGI24738J21930_10005673 JGI24738J21930_100056733 270
143 3300002459 JGI24751J29686_10000093 JGI24751J29686_1000009349 270
144 3300003759 Ga0055525_1000063 Ga0055525_100006339 270
145 3300003759 Ga0055525_1000064 Ga0055525_100006439 270
146 3300003762 Ga0055542_1000795 Ga0055542_100079520 270
147 3300003762 Ga0055542_1001337 Ga0055542_10013373 270
148 3300003763 Ga0055529_1000037 Ga0055529_1000037226 270
149 3300005262 Ga0065165_1005559 Ga0065165_10055593 270
150 3300005327 Ga0070658_10000703 Ga0070658_1000070316 270
151 3300005328 Ga0070676_10042902 Ga0070676_100429023 270
152 3300005329 Ga0070683_100497055 Ga0070683_1004970551 270
153 3300005331 Ga0070670_100000005 Ga0070670_100000005133 270
154 3300005331 Ga0070670_100040533 Ga0070670_1000405333 270
155 3300005331 Ga0070670_100077904 Ga0070670_1000779043 270
156 3300005333 Ga0070677_10052631 Ga0070677_100526312 270
157 3300005335 Ga0070666_10000476 Ga0070666_1000047621 270
158 3300005335 Ga0070666_10080120 Ga0070666_100801202 270
159 3300005339 Ga0070660_100001294 Ga0070660_10000129417 270
160 3300005339 Ga0070660_100119026 Ga0070660_1001190262 270
161 3300005339 Ga0070660_100363056 Ga0070660_1003630561 270
162 3300005344 Ga0070661_100253939 Ga0070661_1002539391 270
163 3300005347 Ga0070668_100000064 Ga0070668_10000006429 270
164 3300005347 Ga0070668_100019555 Ga0070668_1000195553 270
165 3300005347 Ga0070668_100091317 Ga0070668_1000913172 270
166 3300005353 Ga0070669_100000096 Ga0070669_10000009661 270
167 3300005353 Ga0070669_100000195 Ga0070669_10000019542 270
168 3300005354 Ga0070675_100079591 Ga0070675_1000795912 270
169 3300005355 Ga0070671_100000045 Ga0070671_10000004551 270
170 3300005355 Ga0070671_100017281 Ga0070671_1000172815 270
171 3300005356 Ga0070674_100004401 Ga0070674_1000044013 270
172 3300005356 Ga0070674_100010366 Ga0070674_1000103664 270
173 3300005364 Ga0070673_100062226 Ga0070673_1000622263 270
174 3300005366 Ga0070659_100000001 Ga0070659_100000001180 270
175 3300005367 Ga0070667_100000003 Ga0070667_100000003292 270
176 3300005367 Ga0070667_100011334 Ga0070667_1000113345 270
177 3300005456 Ga0070678_100007825 Ga0070678_1000078255 270
178 3300005457 Ga0070662_100556418 Ga0070662_1005564181 270
179 3300005459 Ga0068867_100261624 Ga0068867_1002616241 270
180 3300005539 Ga0068853_100029337 Ga0068853_1000293373 270
181 3300005539 Ga0068853_100208329 Ga0068853_1002083292 270
182 3300005544 Ga0070686_100178733 Ga0070686_1001787332 270
183 3300005548 Ga0070665_100000023 Ga0070665_100000023132 270
184 3300005578 Ga0068854_100017271 Ga0068854_1000172712 270
185 3300005578 Ga0068854_100049025 Ga0068854_1000490254 270
186 3300005614 Ga0068856_100030557 Ga0068856_1000305573 270
187 3300005616 Ga0068852_100071772 Ga0068852_1000717722 270
188 3300005616 Ga0068852_100078536 Ga0068852_1000785362 270
189 3300005617 Ga0068859_100000162 Ga0068859_10000016251 270
190 3300005617 Ga0068859_100020051 Ga0068859_1000200516 270
191 3300005617 Ga0068859_100028071 Ga0068859_1000280713 270
192 3300005617 Ga0068859_100132544 Ga0068859_1001325441 270
193 3300005618 Ga0068864_100000011 Ga0068864_100000011131 270
194 3300005618 Ga0068864_100000677 Ga0068864_1000006776 270
195 3300005618 Ga0068864_100004457 Ga0068864_1000044574 270
196 3300005719 Ga0068861_100003029 Ga0068861_1000030296 270
197 3300005719 Ga0068861_100004554 Ga0068861_1000045543 270
198 3300005719 Ga0068861_100079246 Ga0068861_1000792462 270
199 3300005834 Ga0068851_10038323 Ga0068851_100383232 270
200 3300005841 Ga0068863_100000784 Ga0068863_10000078438 270
201 3300005841 Ga0068863_100028056 Ga0068863_1000280563 270
202 3300005841 Ga0068863_100173482 Ga0068863_1001734823 270
203 3300005842 Ga0068858_100000892 Ga0068858_10000089220 270
204 3300005842 Ga0068858_100002314 Ga0068858_1000023143 270
205 3300005843 Ga0068860_100000045 Ga0068860_10000004561 270
206 3300005843 Ga0068860_100004945 Ga0068860_10000494513 270
207 3300005844 Ga0068862_100000011 Ga0068862_100000011104 270
208 3300005844 Ga0068862_100000385 Ga0068862_10000038537 270
209 3300005844 Ga0068862_100001387 Ga0068862_10000138715 270
210 3300005844 Ga0068862_100007339 Ga0068862_1000073399 270
211 3300006058 Ga0075432_10003913 Ga0075432_100039133 270
212 3300006195 Ga0075366_10028114 Ga0075366_100281143 270
213 3300006195 Ga0075366_10331383 Ga0075366_103313831 270
214 3300006931 Ga0097620_100000162 Ga0097620_10000016251 270
215 3300006931 Ga0097620_100020051 Ga0097620_1000200516 270
216 3300006931 Ga0097620_100028069 Ga0097620_1000280693 270
217 3300006931 Ga0097620_100132551 Ga0097620_1001325511 270
218 3300006931 Ga0097620_100239520 Ga0097620_1002395202 270
219 3300009093 Ga0105240_10314199 Ga0105240_103141991 270
220 3300009098 Ga0105245_10013733 Ga0105245_100137337 270
221 3300009101 Ga0105247_10001548 Ga0105247_100015483 270
222 3300009101 Ga0105247_10436528 Ga0105247_104365281 270
223 3300009148 Ga0105243_10000221 Ga0105243_1000022141 270
224 3300009174 Ga0105241_10017028 Ga0105241_100170285 270
225 3300009177 Ga0105248_10000069 Ga0105248_10000069104 270
226 3300009177 Ga0105248_10071990 Ga0105248_100719903 270
227 3300009177 Ga0105248_10105410 Ga0105248_101054102 270
228 3300009551 Ga0105238_10655848 Ga0105238_106558481 270
229 3300009553 Ga0105249_10016302 Ga0105249_100163026 270
230 3300009553 Ga0105249_10874683 Ga0105249_108746831 270
231 3300012506 Ga0157324_1001555 Ga0157324_10015552 270
232 3300012513 Ga0157326_1000018 Ga0157326_10000189 270
233 3300013102 Ga0157371_10000256 Ga0157371_1000025624 270
234 3300013105 Ga0157369_10454584 Ga0157369_104545841 270
235 3300013296 Ga0157374_10151118 Ga0157374_101511182 270
236 3300013297 Ga0157378_10046547 Ga0157378_100465473 270
237 3300013306 Ga0163162_10000823 Ga0163162_1000082323 270
238 3300014326 Ga0157380_10000700 Ga0157380_1000070012 270
239 3300014968 Ga0157379_10011118 Ga0157379_100111183 270
240 3300017792 Ga0163161_10062921 Ga0163161_100629212 270
241 3300021388 Ga0213875_10000105 Ga0213875_1000010578 270
242 3300025226 Ga0209674_109055 Ga0209674_1090551 270
243 3300025230 Ga0209563_100066 Ga0209563_100066104 270
244 3300025254 Ga0209148_1000011 Ga0209148_1000011892 270
245 3300025261 Ga0209233_1017631 Ga0209233_10176311 270
246 3300025272 Ga0209455_1000006 Ga0209455_1000006300 270
247 3300025297 Ga0209758_1000017 Ga0209758_1000017632 270
248 3300025315 Ga0207697_10001562 Ga0207697_100015623 270
249 3300025321 Ga0207656_10012961 Ga0207656_100129613 270
250 3300025893 Ga0207682_10080950 Ga0207682_100809502 270
251 3300025900 Ga0207710_10061207 Ga0207710_100612072 270
252 3300025901 Ga0207688_10068880 Ga0207688_100688802 270
253 3300025903 Ga0207680_10000156 Ga0207680_1000015610 270
254 3300025903 Ga0207680_10060831 Ga0207680_100608313 270
255 3300025907 Ga0207645_10082984 Ga0207645_100829843 270
256 3300025909 Ga0207705_10000513 Ga0207705_1000051315 270
257 3300025911 Ga0207654_10004906 Ga0207654_100049065 270
258 3300025913 Ga0207695_10047824 Ga0207695_100478243 270
259 3300025914 Ga0207671_10001071 Ga0207671_1000107129 270
260 3300025919 Ga0207657_10006411 Ga0207657_1000641112 270
261 3300025919 Ga0207657_10034797 Ga0207657_100347973 270
262 3300025923 Ga0207681_10000001 Ga0207681_10000001527 270
263 3300025923 Ga0207681_10000030 Ga0207681_10000030140 270
264 3300025923 Ga0207681_10437168 Ga0207681_104371681 270
265 3300025925 Ga0207650_10000018 Ga0207650_10000018132 270
266 3300025925 Ga0207650_10004846 Ga0207650_100048468 270
267 3300025925 Ga0207650_10057726 Ga0207650_100577262 270
268 3300025926 Ga0207659_10058902 Ga0207659_100589023 270
269 3300025926 Ga0207659_10117749 Ga0207659_101177493 270
270 3300025927 Ga0207687_10016745 Ga0207687_100167452 270
271 3300025927 Ga0207687_10051979 Ga0207687_100519793 270
272 3300025931 Ga0207644_10000017 Ga0207644_10000017142 270
273 3300025931 Ga0207644_10088561 Ga0207644_100885612 270
274 3300025932 Ga0207690_10000018 Ga0207690_1000001885 270
275 3300025932 Ga0207690_10015155 Ga0207690_100151553 270
276 3300025933 Ga0207706_10028490 Ga0207706_100284903 270
277 3300025935 Ga0207709_10000078 Ga0207709_10000078116 270
278 3300025937 Ga0207669_10000020 Ga0207669_1000002073 270
279 3300025937 Ga0207669_10003084 Ga0207669_100030845 270
280 3300025941 Ga0207711_10021763 Ga0207711_100217634 270
281 3300025941 Ga0207711_10032762 Ga0207711_100327622 270
282 3300025944 Ga0207661_10214840 Ga0207661_102148402 270
283 3300025949 Ga0207667_10000002 Ga0207667_10000002607 270
284 3300025972 Ga0207668_10000030 Ga0207668_1000003089 270
285 3300025972 Ga0207668_10000620 Ga0207668_100006206 270
286 3300025972 Ga0207668_10003547 Ga0207668_100035474 270
287 3300025972 Ga0207668_10018106 Ga0207668_100181065 270
288 3300025972 Ga0207668_10056000 Ga0207668_100560003 270
289 3300025981 Ga0207640_10025277 Ga0207640_100252772 270
290 3300025986 Ga0207658_10000002 Ga0207658_100000021193 270
291 3300025986 Ga0207658_10000350 Ga0207658_100003505 270
292 3300025986 Ga0207658_10012120 Ga0207658_100121206 270
293 3300025986 Ga0207658_10129351 Ga0207658_101293512 270
294 3300026023 Ga0207677_10000013 Ga0207677_1000001324 270
295 3300026035 Ga0207703_10000358 Ga0207703_1000035829 270
296 3300026035 Ga0207703_10003384 Ga0207703_100033846 270
297 3300026041 Ga0207639_10002135 Ga0207639_1000213512 270
298 3300026041 Ga0207639_10005755 Ga0207639_100057556 270
299 3300026067 Ga0207678_10006261 Ga0207678_100062613 270
300 3300026078 Ga0207702_10012593 Ga0207702_100125934 270
301 3300026088 Ga0207641_10000720 Ga0207641_100007205 270
302 3300026088 Ga0207641_10001779 Ga0207641_100017793 270
303 3300026088 Ga0207641_10006993 Ga0207641_100069933 270
304 3300026088 Ga0207641_10014895 Ga0207641_100148952 270
305 3300026095 Ga0207676_10000004 Ga0207676_10000004525 270
306 3300026095 Ga0207676_10001237 Ga0207676_1000123718 270
307 3300026095 Ga0207676_10003709 Ga0207676_100037098 270
308 3300026116 Ga0207674_10010604 Ga0207674_100106047 270
309 3300026118 Ga0207675_100000221 Ga0207675_10000022151 270
310 3300026118 Ga0207675_100004956 Ga0207675_10000495610 270
311 3300026118 Ga0207675_100061325 Ga0207675_1000613254 270
312 3300026121 Ga0207683_10001150 Ga0207683_1000115023 270
313 3300026121 Ga0207683_10145831 Ga0207683_101458313 270
314 3300026142 Ga0207698_10018394 Ga0207698_100183943 270
315 3300028379 Ga0268266_10000002 Ga0268266_100000021346 270
316 3300028380 Ga0268265_10000002 Ga0268265_10000002544 270
317 3300028380 Ga0268265_10000074 Ga0268265_1000007435 270
318 3300028380 Ga0268265_10000469 Ga0268265_1000046924 270
319 3300028380 Ga0268265_10008631 Ga0268265_100086317 270
320 3300028381 Ga0268264_10000101 Ga0268264_1000010163 270
321 3300028381 Ga0268264_10000215 Ga0268264_1000021577 270
322 3300031456 Ga0307513_10042610 Ga0307513_100426103 270
323 3300031548 Ga0307408_100016701 Ga0307408_1000167015 270
324 3300031548 Ga0307408_100298559 Ga0307408_1002985592 270
325 3300031731 Ga0307405_10190051 Ga0307405_101900512 270
326 3300031824 Ga0307413_10034689 Ga0307413_100346893 270
327 3300031824 Ga0307413_10088682 Ga0307413_100886822 270
328 3300031824 Ga0307413_10258151 Ga0307413_102581512 270
329 3300031852 Ga0307410_10090984 Ga0307410_100909843 270
330 3300031852 Ga0307410_10096887 Ga0307410_100968873 270
331 3300031901 Ga0307406_10235274 Ga0307406_102352742 270
332 3300031901 Ga0307406_10244978 Ga0307406_102449782 270
333 3300031911 Ga0307412_10025800 Ga0307412_100258003 270
334 3300031911 Ga0307412_10031934 Ga0307412_100319342 270
335 3300031911 Ga0307412_10052199 Ga0307412_100521993 270
336 3300031995 Ga0307409_100027886 Ga0307409_1000278861 270
337 3300031995 Ga0307409_100141095 Ga0307409_1001410953 270
338 3300031995 Ga0307409_100435612 Ga0307409_1004356122 270
339 3300031995 Ga0307409_100460047 Ga0307409_1004600471 270
340 3300032002 Ga0307416_100059138 Ga0307416_1000591382 270
341 3300032002 Ga0307416_100111409 Ga0307416_1001114092 270
342 3300032002 Ga0307416_100166410 Ga0307416_1001664103 270
343 3300032002 Ga0307416_100307108 Ga0307416_1003071081 270
344 3300032004 Ga0307414_10026412 Ga0307414_100264122 270
345 3300032004 Ga0307414_10084992 Ga0307414_100849923 270
346 3300032004 Ga0307414_10091650 Ga0307414_100916502 270
347 3300032004 Ga0307414_10164329 Ga0307414_101643292 270
348 3300032004 Ga0307414_10201109 Ga0307414_102011092 270
349 3300032005 Ga0307411_10024284 Ga0307411_100242842 270
350 3300032005 Ga0307411_10024975 Ga0307411_100249752 270
351 3300032005 Ga0307411_10134579 Ga0307411_101345792 270
352 3300032005 Ga0307411_10213253 Ga0307411_102132532 270
353 3300032126 Ga0307415_100029147 Ga0307415_1000291474 270
354 3300032126 Ga0307415_100194228 Ga0307415_1001942281 270
355 3300037312 Ga0395899_0036920 Ga0395899_0036920_1644_2456 270
356 3300037853 Ga0436364_0184827 Ga0436364_0184827_33997_34815 270
357 3300039450 Ga0436363_1197184 Ga0436363_1197184_341_1156 270
358 3300044694 Ga0466963_0214661 Ga0466963_0214661_213_1025 270
359 3300046452 Ga0495617_006544 Ga0495617_006544_2367_3179 270
360 3300046471 Ga0495650_0000172 Ga0495650_0000172_87265_88077 270
361 3300046491 Ga0495584_0079864 Ga0495584_0079864_303_1115 270
362 3300046492 Ga0495585_0027930 Ga0495585_0027930_1674_2486 270
363 3300046492 Ga0495585_0175580 Ga0495585_0175580_234_1046 270
364 3300046506 Ga0495583_0002048 Ga0495583_0002048_16883_17695 270
365 3300046506 Ga0495583_0004847 Ga0495583_0004847_931_1743 270
366 3300046506 Ga0495583_0011033 Ga0495583_0011033_875_1687 270
367 3300046518 Ga0495631_0158880 Ga0495631_0158880_31_843 270
368 3300046519 Ga0495632_0100441 Ga0495632_0100441_408_1220 270
369 3300046522 Ga0495643_0017797 Ga0495643_0017797_2888_3706 270
370 3300046524 Ga0495648_0000249 Ga0495648_0000249_26963_27775 270
371 3300046525 Ga0495663_0001306 Ga0495663_0001306_6090_6902 270
372 3300046536 Ga0495587_0198068 Ga0495587_0198068_215_1027 270
373 3300046557 Ga0495622_0019534 Ga0495622_0019534_1337_2149 270
374 3300046616 Ga0495668_0000080 Ga0495668_0000080_45721_46533 270
375 3300046616 Ga0495668_0017868 Ga0495668_0017868_2795_3607 270
376 3300046660 Ga0495625_0000541 Ga0495625_0000541_47896_48708 270
377 3300046665 Ga0495661_0016849 Ga0495661_0016849_3304_4116 270
378 3300046684 Ga0495669_0000011 Ga0495669_0000011_113073_113885 270
379 3300046694 Ga0495649_0201673 Ga0495649_0201673_46_864 270
380 3300047323 Ga0495683_0019425 Ga0495683_0019425_1216_2028 270
381 3300047443 Ga0495687_000082 Ga0495687_000082_115662_116474 270
382 3300047443 Ga0495687_002094 Ga0495687_002094_910_1722 270
383 3300047445 Ga0495677_0006435 Ga0495677_0006435_3509_4327 270
384 3300047470 Ga0495681_0005821 Ga0495681_0005821_6930_7742 270
385 3300047472 Ga0495686_0163232 Ga0495686_0163232_332_1144 270
386 3300048905 Ga0496102_0000034 Ga0496102_0000034_180753_181565 270
387 3300048905 Ga0496102_0000471 Ga0496102_0000471_6374_7186 270
388 3300048905 Ga0496102_0069336 Ga0496102_0069336_1646_2458 270
389 3300048906 Ga0496103_0000026 Ga0496103_0000026_180753_181565 270
390 3300048906 Ga0496103_0000166 Ga0496103_0000166_17254_18066 270
391 3300048907 Ga0496104_0010654 Ga0496104_0010654_1228_2040 270
392 3300048908 Ga0496105_0003221 Ga0496105_0003221_4828_5640 270
393 3300048908 Ga0496105_0211386 Ga0496105_0211386_143_955 270
394 3300048912 Ga0496109_0096519 Ga0496109_0096519_1271_2083 270
395 3300048913 Ga0496110_0101023 Ga0496110_0101023_856_1668 270
396 3300048914 Ga0496111_0037863 Ga0496111_0037863_1732_2544 270
397 3300048917 Ga0496114_0076871 Ga0496114_0076871_1930_2742 270
398 3300048918 Ga0496115_0000030 Ga0496115_0000030_76787_77599 270
399 3300048919 Ga0496116_0006531 Ga0496116_0006531_4638_5450 270
400 3300048919 Ga0496116_0010032 Ga0496116_0010032_3987_4799 270
401 3300048920 Ga0496117_0000072 Ga0496117_0000072_205293_206105 270
402 3300048920 Ga0496117_0000142 Ga0496117_0000142_127860_128672 270
403 3300048920 Ga0496117_0014014 Ga0496117_0014014_1531_2349 270
404 3300048920 Ga0496117_0020049 Ga0496117_0020049_3278_4093 270
405 3300048921 Ga0496118_0000030 Ga0496118_0000030_32262_33074 270
406 3300048921 Ga0496118_0000115 Ga0496118_0000115_128428_129240 270
407 3300048921 Ga0496118_0004303 Ga0496118_0004303_2254_3072 270
408 3300048922 Ga0496119_0059672 Ga0496119_0059672_1411_2223 270
409 3300048923 Ga0496120_0072884 Ga0496120_0072884_474_1286 270
410 3300048924 Ga0496121_0000104 Ga0496121_0000104_29241_30053 270
411 3300048924 Ga0496121_0000193 Ga0496121_0000193_129101_129913 270
412 3300048926 Ga0496123_0028176 Ga0496123_0028176_794_1606 270
413 3300048927 Ga0496124_0000061 Ga0496124_0000061_32262_33074 270
414 3300048927 Ga0496124_0000146 Ga0496124_0000146_17229_18041 270
415 3300048927 Ga0496124_0055280 Ga0496124_0055280_1077_1895 270
416 3300048928 Ga0496125_0003343 Ga0496125_0003343_964_1776 270
417 3300048929 Ga0496126_0000174 Ga0496126_0000174_128428_129240 270
418 3300049574 Ga0501038_0046077 Ga0501038_0046077_1305_2120 270
419 3300049765 Ga0501268_024578 Ga0501268_024578_128_946 270
420 3300050493 nmdc:mga0k408_109619_c1 nmdc:mga0k408_109619_c1_789_1601 270
421 3300050493 nmdc:mga0k408_63030_c1 nmdc:mga0k408_63030_c1_139_951 270
422 3300053079 Ga0500610_0000413 Ga0500610_0000413_2591_3403 270
423 3300053087 Ga0500643_004336 Ga0500643_004336_4882_5694 270
424 3300053087 Ga0500643_034058 Ga0500643_034058_534_1346 270
425 3300053116 Ga0500592_018666 Ga0500592_018666_64_876 270
426 3300053119 Ga0500595_001555 Ga0500595_001555_3455_4267 270
427 3300053125 Ga0500618_003530 Ga0500618_003530_1684_2496 270
428 3300053130 Ga0500642_0001088 Ga0500642_0001088_850_1662 270
429 3300053136 Ga0500559_0017236 Ga0500559_0017236_1842_2654 270
430 3300053142 Ga0500577_0025971 Ga0500577_0025971_427_1242 270
431 3300053154 Ga0500619_037962 Ga0500619_037962_275_1087 270
432 3300053157 Ga0500624_000060 Ga0500624_000060_55254_56066 270
433 3300053730 Ga0500645_000001 Ga0500645_000001_108688_109500 270
434 3300053735 Ga0500596_004764 Ga0500596_004764_885_1697 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

146

238

0.98

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

16

129

0.96

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

258

287

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c4i-assembly1.cif.gz_m conformation of methylated ggq in the peptidyl transferase center during translation termination 0.9217 169 206
8r57-assembly1.cif.gz_S cryoem structure of wheat 40s ribosomal subunit, head domain 0.915 169 202
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9112 2 270
7m4y-assembly1.cif.gz_m a. baumannii ribosome-eravacycline complex: e-site trna 70s 0.9102 152 204
7n2u-assembly1.cif.gz_SM elongating 70s ribosome complex in a hybrid-h1 pre-translocation (pre-h1) conformation 0.9092 168 206
ID Description Score Start End Superfamily
af_P05523_2_128_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9187 2 118 3.20.190.10
4ojuC00 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9184 48 69 3.80.10.10
af_P9WNC3_1_133_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9147 1 118 3.20.190.10
1l1tA01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8967 2 129 3.20.190.10
2y10M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8951 152 202 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A352H7J1-F1-model_v4 deleted 0.9914 1 168
AF-A0A4Q5SIZ1-F1-model_v4 Bifunctional DNA-formamidopyrimidine glycosylase/DNA-(Apurinic or apyrimidinic site) lyase (EC 3.2.2.23, EC 4.2.99.18) 0.9892 1 208 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A352H7J1-F1-model_v4 deleted 0.9855 1 168
AF-A0A257PRL7-F1-model_v4 DNA-formamidopyrimidine glycosylase 0.9814 1 218 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039
AF-A0A4Q5SIZ1-F1-model_v4 Bifunctional DNA-formamidopyrimidine glycosylase/DNA-(Apurinic or apyrimidinic site) lyase (EC 3.2.2.23, EC 4.2.99.18) 0.9798 1 208 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078

Feature Viewer

pLDDT pTM Quality
86.79 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map