metagRoot

F443069

General Info

Members	Datasets	Scaffolds	Average Seq Length
434	207	434	141

Family's Representative Sequence

Representative Sequence	3300006880\|Ga0075429_100992833\|Ga0075429_1009928333
Length	160
Sequence	MNAVTPKAAGHAGLPPLASRFVDVEALPWERSERHPGVETRTLLVDRSAGLLTLLLRMAPGAKLPDHEHVMIEQTYVLEGSLMCGEGECRAGQFVWRPAGSRHEAWAGPEGGLMLGIFQMPNRFFEADGRAVDFAGNDWDRSWGQALARAEQARFAPAPE

Samples

	Sample ID	Description	Type	Environment
1	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
2	3300003405	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM	Metagenome	Rhizosphere
3	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
6	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
7	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
8	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
9	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
10	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
11	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
12	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
13	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
14	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
15	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
16	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
17	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
18	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
19	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
20	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
21	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
22	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
23	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
24	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
25	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
26	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
27	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
28	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
29	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
30	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
31	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
32	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
33	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
34	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
35	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
36	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
37	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
38	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
39	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
40	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
41	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
42	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
43	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
44	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
45	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
46	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
47	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
48	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
49	3300012477	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610	Metagenome	Rhizosphere
50	3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Metagenome	Rhizosphere
51	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
52	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
53	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
54	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
55	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
56	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
57	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
58	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
59	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
60	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
61	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
62	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
63	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
64	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
65	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
66	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
67	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
68	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
69	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
70	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
82	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
84	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
85	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
86	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
87	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
88	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
89	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
90	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
91	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
92	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
93	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
94	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
95	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
96	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
97	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
98	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
99	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
100	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
101	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
102	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
103	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
104	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
105	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
106	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
107	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
108	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
109	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
110	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
111	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
112	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
113	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
114	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
115	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
116	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
117	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
118	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
119	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
120	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
121	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
122	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
123	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
124	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
125	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
126	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
127	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
128	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
129	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
130	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
131	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
132	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
133	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
134	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
135	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
136	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
137	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
138	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
139	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
140	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
141	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
142	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
143	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
144	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
145	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
146	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
147	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
148	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
149	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
150	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
151	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
152	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
153	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
154	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
155	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
156	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
157	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
158	3300049526	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control	Metagenome	Rhizosphere
159	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
160	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
161	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
162	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
163	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
164	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
165	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
166	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
167	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
168	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
169	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
170	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
171	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
172	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
173	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
174	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
175	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
176	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
177	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
178	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
179	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
180	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
181	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
182	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
183	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
184	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
185	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
186	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
187	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
188	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
189	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
190	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
191	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
192	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
193	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
194	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
195	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
196	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
197	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
198	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
199	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
200	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
201	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
202	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
203	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
204	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
205	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
206	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
207	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.23
Nodule	0
Rhizoplane	0.46
Rhizosphere	99.31
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25407J50210_10140166	3300003373	Bacteria	595
2	JGI26132J50249_104450	3300003405	Unclassified	526
3	Ga0065707_10315558	3300005295	Bacteria	976
4	Ga0065707_10350762	3300005295	Bacteria	919
5	Ga0070690_100444474	3300005330	Bacteria	960
6	Ga0070690_100565789	3300005330	Bacteria	859
7	Ga0070690_100870743	3300005330	Bacteria	703
8	Ga0070680_100248821	3300005336	Bacteria	1503
9	Ga0070689_100095991	3300005340	Bacteria	2342
10	Ga0070689_100338986	3300005340	Bacteria	1259
11	Ga0070689_100418312	3300005340	Bacteria	1135
12	Ga0070691_10272866	3300005341	Bacteria	915
13	Ga0070692_10016606	3300005345	Bacteria	3503
14	Ga0070692_10475454	3300005345	Bacteria	805
15	Ga0070673_101951210	3300005364	Bacteria	557
16	Ga0070688_100125424	3300005365	Bacteria	1725
17	Ga0070711_101605487	3300005439	Unclassified	569
18	Ga0070705_100006109	3300005440	Bacteria	5896
19	Ga0070705_100222955	3300005440	Bacteria	1307
20	Ga0070705_100647302	3300005440	Bacteria	824
21	Ga0070705_100732048	3300005440	Bacteria	780
22	Ga0070700_100538777	3300005441	Bacteria	905
23	Ga0070694_100025626	3300005444	Bacteria	3815
24	Ga0070694_100026195	3300005444	Bacteria	3778
25	Ga0070694_100354476	3300005444	Bacteria	1137
26	Ga0070694_100505065	3300005444	Bacteria	963
27	Ga0070694_100827738	3300005444	Bacteria	760
28	Ga0070678_101172322	3300005456	Bacteria	711
29	Ga0070681_10000393	3300005458	Bacteria	35383
30	Ga0068867_100744271	3300005459	Unclassified	869
31	Ga0070707_101050849	3300005468	Bacteria	780
32	Ga0070698_100008239	3300005471	Bacteria	11272
33	Ga0070698_100667657	3300005471	Bacteria	981
34	Ga0070699_100009823	3300005518	Bacteria	8281
35	Ga0070679_100370317	3300005530	Bacteria	1380
36	Ga0070679_100969517	3300005530	Bacteria	794
37	Ga0070697_102116349	3300005536	Bacteria	504
38	Ga0070686_100092524	3300005544	Bacteria	2025
39	Ga0070686_100214074	3300005544	Bacteria	1389
40	Ga0070695_100010662	3300005545	Bacteria	5491
41	Ga0070695_100100510	3300005545	Bacteria	1947
42	Ga0070695_100255785	3300005545	Bacteria	1277
43	Ga0070695_100673412	3300005545	Bacteria	819
44	Ga0070695_100907552	3300005545	Bacteria	712
45	Ga0070696_100124992	3300005546	Bacteria	1865
46	Ga0070696_100141843	3300005546	Bacteria	1757
47	Ga0070696_100192247	3300005546	Bacteria	1519
48	Ga0070696_100244524	3300005546	Bacteria	1355
49	Ga0070696_101275943	3300005546	Bacteria	623
50	Ga0070696_101587798	3300005546	Bacteria	562
51	Ga0070693_100661321	3300005547	Bacteria	761
52	Ga0070704_100000615	3300005549	Bacteria	17162
53	Ga0070704_100011247	3300005549	Bacteria	5478
54	Ga0070704_100155529	3300005549	Bacteria	1803
55	Ga0070704_100562740	3300005549	Bacteria	997
56	Ga0070704_100879156	3300005549	Bacteria	805
57	Ga0070704_100988695	3300005549	Bacteria	760
58	Ga0068857_100389709	3300005577	Bacteria	1295
59	Ga0068857_101981217	3300005577	Bacteria	571
60	Ga0070702_100070725	3300005615	Bacteria	2060
61	Ga0070702_101109064	3300005615	Unclassified	633
62	Ga0068859_100016705	3300005617	Bacteria	7369
63	Ga0068859_100636441	3300005617	Bacteria	1159
64	Ga0068861_100025876	3300005719	Bacteria	4261
65	Ga0068862_100338493	3300005844	Bacteria	1393
66	Ga0081455_10063371	3300005937	Bacteria	3102
67	Ga0081538_10025199	3300005981	Bacteria	4203
68	Ga0081538_10063216	3300005981	Bacteria	2103
69	Ga0081538_10073309	3300005981	Bacteria	1872
70	Ga0068871_100981860	3300006358	Bacteria	786
71	Ga0075428_100007527	3300006844	Bacteria	12072
72	Ga0075428_100015345	3300006844	Bacteria	8495
73	Ga0075428_100451001	3300006844	Bacteria	1378
74	Ga0075428_102306947	3300006844	Bacteria	554
75	Ga0075430_100000319	3300006846	Bacteria	34222
76	Ga0075430_100005676	3300006846	Bacteria	10535
77	Ga0075430_100011470	3300006846	Bacteria	7527
78	Ga0075430_100279820	3300006846	Bacteria	1380
79	Ga0075430_100503220	3300006846	Bacteria	1000
80	Ga0075431_100002080	3300006847	Bacteria	19112
81	Ga0075431_100031957	3300006847	Bacteria	5423
82	Ga0075431_100037076	3300006847	Bacteria	5023
83	Ga0075431_100128735	3300006847	Bacteria	2612
84	Ga0075431_100273162	3300006847	Bacteria	1712
85	Ga0075431_100375694	3300006847	Bacteria	1426
86	Ga0075431_101824713	3300006847	Unclassified	564
87	Ga0075433_10200604	3300006852	Bacteria	1774
88	Ga0075433_10220312	3300006852	Bacteria	1685
89	Ga0075433_10431603	3300006852	Bacteria	1162
90	Ga0075434_100000003	3300006871	Bacteria	134839
91	Ga0075434_100288915	3300006871	Bacteria	1659
92	Ga0075434_100424722	3300006871	Bacteria	1350
93	Ga0075434_100853388	3300006871	Bacteria	926
94	Ga0075429_100000293	3300006880	Bacteria	35379
95	Ga0075429_100197461	3300006880	Bacteria	1762
96	Ga0075429_100199426	3300006880	Bacteria	1753
97	Ga0075429_100992833	3300006880	Unclassified	734
98	Ga0068865_101253820	3300006881	Bacteria	658
99	Ga0075436_100022169	3300006914	Bacteria	4362
100	Ga0075436_100064896	3300006914	Bacteria	2524
101	Ga0075436_100127562	3300006914	Unclassified	1783
102	Ga0097620_100016706	3300006931	Bacteria	7369
103	Ga0097620_100636413	3300006931	Bacteria	1159
104	Ga0075435_100059361	3300007076	Bacteria	3101
105	Ga0075435_100157490	3300007076	Bacteria	1911
106	Ga0075435_100589803	3300007076	Bacteria	963
107	Ga0111539_10393831	3300009094	Bacteria	1613
108	Ga0111539_10455101	3300009094	Bacteria	1490
109	Ga0111539_10807819	3300009094	Bacteria	1091
110	Ga0111539_10841467	3300009094	Bacteria	1067
111	Ga0111539_11635129	3300009094	Bacteria	747
112	Ga0114129_10002323	3300009147	Bacteria	26403
113	Ga0114129_10020624	3300009147	Bacteria	9370
114	Ga0114129_10403214	3300009147	Bacteria	1802
115	Ga0114129_10440412	3300009147	Bacteria	1711
116	Ga0114129_10554311	3300009147	Bacteria	1494
117	Ga0114129_10991996	3300009147	Bacteria	1058
118	Ga0105238_11151956	3300009551	Bacteria	799
119	Ga0157336_1011758	3300012477	Bacteria	686
120	Ga0157338_1017451	3300012515	Bacteria	804
121	Ga0157380_10154710	3300014326	Bacteria	1986
122	Ga0182007_10217862	3300015262	Bacteria	673
123	Ga0207707_10001889	3300025912	Bacteria	19120
124	Ga0207663_10454219	3300025916	Unclassified	989
125	Ga0207660_10227221	3300025917	Bacteria	1466
126	Ga0207662_10372246	3300025918	Bacteria	964
127	Ga0207652_10478733	3300025921	Bacteria	1121
128	Ga0207646_10908543	3300025922	Bacteria	781
129	Ga0207670_10967577	3300025936	Bacteria	715
130	Ga0207704_10654338	3300025938	Bacteria	866
131	Ga0207665_10064318	3300025939	Bacteria	2493
132	Ga0207665_10330228	3300025939	Bacteria	1147
133	Ga0207691_10137661	3300025940	Bacteria	2153
134	Ga0207689_10488359	3300025942	Bacteria	1031
135	Ga0207661_11735592	3300025944	Bacteria	570
136	Ga0207648_10708728	3300026089	Bacteria	933
137	Ga0207648_11118638	3300026089	Unclassified	739
138	Ga0207675_100263225	3300026118	Bacteria	1672
139	Ga0207683_10408251	3300026121	Bacteria	1250
140	Ga0209969_1005898	3300027360	Bacteria	1724
141	Ga0209969_1006985	3300027360	Bacteria	1593
142	Ga0209969_1019719	3300027360	Bacteria	1001
143	Ga0209967_1001983	3300027364	Bacteria	2638
144	Ga0209967_1070942	3300027364	Bacteria	544
145	Ga0209981_1002579	3300027378	Bacteria	2313
146	Ga0209981_1004673	3300027378	Bacteria	1804
147	Ga0209981_1053126	3300027378	Bacteria	615
148	Ga0209996_1006256	3300027395	Bacteria	1535
149	Ga0209996_1026566	3300027395	Bacteria	831
150	Ga0210000_1001658	3300027462	Bacteria	3135
151	Ga0210000_1007748	3300027462	Bacteria	1571
152	Ga0210000_1037634	3300027462	Bacteria	764
153	Ga0209968_1007743	3300027526	Bacteria	1629
154	Ga0209968_1062825	3300027526	Bacteria	656
155	Ga0209999_1002310	3300027543	Bacteria	3357
156	Ga0209999_1005788	3300027543	Bacteria	2224
157	Ga0209999_1007387	3300027543	Bacteria	1979
158	Ga0209982_1044845	3300027552	Bacteria	708
159	Ga0209970_1047635	3300027614	Bacteria	771
160	Ga0209983_1009461	3300027665	Bacteria	1993
161	Ga0209971_1010154	3300027682	Bacteria	2227
162	Ga0209971_1102282	3300027682	Bacteria	702
163	Ga0209966_1005210	3300027695	Bacteria	2227
164	Ga0209966_1013178	3300027695	Bacteria	1527
165	Ga0209966_1034071	3300027695	Bacteria	1041
166	Ga0209974_10074985	3300027876	Bacteria	1158
167	Ga0207428_10006862	3300027907	Bacteria	10435
168	Ga0207428_10267077	3300027907	Bacteria	1273
169	Ga0268265_10815279	3300028380	Bacteria	911
170	Ga0307408_100193617	3300031548	Unclassified	1640
171	Ga0307408_100689804	3300031548	Bacteria	917
172	Ga0316575_10010752	3300031665	Bacteria	3371
173	Ga0307410_11284516	3300031852	Bacteria	640
174	Ga0307406_11588676	3300031901	Unclassified	577
175	Ga0307407_10220422	3300031903	Bacteria	1282
176	Ga0307412_12294626	3300031911	Unclassified	503
177	Ga0307409_100097855	3300031995	Bacteria	2425
178	Ga0307409_101555443	3300031995	Bacteria	689
179	Ga0307409_102372762	3300031995	Bacteria	560
180	Ga0307416_100555775	3300032002	Bacteria	1222
181	Ga0307416_100965770	3300032002	Bacteria	954
182	Ga0307416_103166992	3300032002	Bacteria	550
183	Ga0307411_10117273	3300032005	Bacteria	1918
184	Ga0307411_10616286	3300032005	Bacteria	935
185	Ga0307411_11319967	3300032005	Unclassified	658
186	Ga0307415_100636626	3300032126	Bacteria	954
187	Ga0307415_100767733	3300032126	Bacteria	877
188	Ga0373948_0172601	3300034817	Bacteria	551
189	Ga0373938_0038997	3300034957	Bacteria	1049
190	Ga0373938_0104769	3300034957	Bacteria	714
191	Ga0373926_0075423	3300035083	Bacteria	1243
192	Ga0373928_0088043	3300035084	Bacteria	793
193	Ga0373934_0212129	3300035086	Bacteria	798
194	Ga0373940_0015687	3300035088	Bacteria	1866
195	Ga0373932_0097435	3300035112	Bacteria	952
196	Ga0373932_0418804	3300035112	Bacteria	521
197	Ga0373939_0038258	3300035114	Bacteria	1430
198	Ga0373939_0304334	3300035114	Bacteria	636
199	Ga0373941_0017535	3300035115	Bacteria	1964
200	Ga0373941_0212931	3300035115	Bacteria	740
201	Ga0373956_0387581	3300035119	Bacteria	666
202	Ga0373960_0126165	3300035121	Bacteria	854
203	Ga0373961_0058107	3300035241	Bacteria	1166
204	Ga0373931_0154133	3300035691	Bacteria	1342
205	Ga0373935_0006765	3300035692	Bacteria	6850
206	Ga0373927_0050266	3300035695	Bacteria	2695
207	Ga0373947_0045635	3300035725	Bacteria	2623
208	Ga0373937_0506965	3300036401	Bacteria	1146
209	Ga0373925_0141141	3300037068	Bacteria	1885
210	Ga0439453_0002518	3300041408	Bacteria	2541
211	Ga0439461_0026721	3300041410	Bacteria	1179
212	Ga0451798_0300454	3300041458	Bacteria	837
213	Ga0451807_1419061	3300041486	Bacteria	1179
214	Ga0439441_000072	3300042001	Bacteria	7785
215	Ga0439443_040357	3300042003	Unclassified	795
216	Ga0450888_014695	3300042126	Bacteria	950
217	Ga0450898_098058	3300042134	Unclassified	610
218	Ga0439446_0073317	3300042156	Bacteria	1050
219	Ga0439446_0385849	3300042156	Unclassified	504
220	Ga0439434_0002344	3300042435	Bacteria	5510
221	Ga0439434_0257937	3300042435	Bacteria	597
222	Ga0439435_0002037	3300042436	Bacteria	3908
223	Ga0439435_0047274	3300042436	Bacteria	1221
224	Ga0439435_0103700	3300042436	Bacteria	876
225	Ga0439444_0026907	3300042437	Bacteria	1055
226	Ga0439444_0035806	3300042437	Bacteria	954
227	Ga0439460_0151577	3300042461	Bacteria	773
228	Ga0451577_0386104	3300042876	Bacteria	1271
229	Ga0466960_0718183	3300044901	Bacteria	600
230	Ga0451576_0247865	3300045051	Bacteria	1861
231	Ga0451576_0259633	3300045051	Bacteria	1815
232	Ga0451576_0336548	3300045051	Bacteria	1580
233	Ga0451576_1508622	3300045051	Bacteria	698
234	Ga0495592_0004382	3300046454	Bacteria	10326
235	Ga0495582_0307155	3300046473	Bacteria	912
236	Ga0495662_0002560	3300046476	Bacteria	9181
237	Ga0495608_0000643	3300046511	Bacteria	24055
238	Ga0495618_0018719	3300046514	Bacteria	4254
239	Ga0495628_0006198	3300046516	Bacteria	10459
240	Ga0495630_0018417	3300046517	Bacteria	5130
241	Ga0495644_0257921	3300046523	Bacteria	678
242	Ga0495666_0046143	3300046526	Bacteria	2101
243	Ga0495642_0026735	3300046528	Bacteria	2294
244	Ga0495642_0233872	3300046528	Bacteria	803
245	Ga0495652_0014137	3300046529	Bacteria	7170
246	Ga0495640_0009574	3300046533	Bacteria	7537
247	Ga0495586_0000323	3300046535	Bacteria	30293
248	Ga0495587_0119566	3300046536	Bacteria	1509
249	Ga0495587_0478878	3300046536	Bacteria	689
250	Ga0495621_0107596	3300046539	Bacteria	1067
251	Ga0495645_0291867	3300046543	Bacteria	1069
252	Ga0495667_0001031	3300046559	Bacteria	18064
253	Ga0495634_0007644	3300046642	Bacteria	8094
254	Ga0495659_0058255	3300046664	Bacteria	1421
255	Ga0495599_0003189	3300046678	Bacteria	9554
256	Ga0495658_0100826	3300046683	Bacteria	1723
257	Ga0495669_0167680	3300046684	Bacteria	1044
258	Ga0495613_0001197	3300046689	Bacteria	19799
259	Ga0495624_0039151	3300046690	Bacteria	3040
260	Ga0495600_0001307	3300046809	Bacteria	13751
261	Ga0495604_0004264	3300047317	Bacteria	11321
262	Ga0495604_0549239	3300047317	Bacteria	745
263	Ga0495636_0000940	3300047318	Bacteria	10831
264	Ga0495680_0002278	3300047322	Bacteria	19760
265	Ga0495675_0244211	3300047444	Bacteria	1080
266	Ga0495593_0189923	3300047673	Bacteria	1033
267	Ga0501298_027202	3300049521	Bacteria	1105
268	Ga0501303_020826	3300049526	Bacteria	698
269	Ga0501031_0013351	3300049568	Bacteria	5360
270	Ga0501031_0023338	3300049568	Bacteria	4034
271	Ga0501032_0047993	3300049569	Bacteria	2883
272	Ga0501033_0002408	3300049570	Bacteria	15915
273	Ga0501033_0177467	3300049570	Bacteria	1528
274	Ga0501033_0966735	3300049570	Unclassified	570
275	Ga0501033_1130001	3300049570	Bacteria	520
276	Ga0501036_0006130	3300049572	Bacteria	9754
277	Ga0501036_0243771	3300049572	Bacteria	1507
278	Ga0501036_0285799	3300049572	Bacteria	1380
279	Ga0501036_0573277	3300049572	Bacteria	937
280	Ga0501036_1079505	3300049572	Bacteria	656
281	Ga0501036_1084581	3300049572	Bacteria	654
282	Ga0501037_0006992	3300049573	Bacteria	8240
283	Ga0501037_0207638	3300049573	Bacteria	1382
284	Ga0501038_0001672	3300049574	Bacteria	20558
285	Ga0501038_0072732	3300049574	Bacteria	2913
286	Ga0501038_0773480	3300049574	Bacteria	715
287	Ga0501038_1359923	3300049574	Bacteria	511
288	Ga0501039_0000763	3300049575	Bacteria	23161
289	Ga0501039_0050977	3300049575	Bacteria	3203
290	Ga0501039_0246039	3300049575	Bacteria	1406
291	Ga0501039_0697621	3300049575	Bacteria	794
292	Ga0501040_0007208	3300049576	Bacteria	7200
293	Ga0501040_0013952	3300049576	Bacteria	5290
294	Ga0501040_0015660	3300049576	Bacteria	5014
295	Ga0501040_0198612	3300049576	Bacteria	1424
296	Ga0501040_0306786	3300049576	Bacteria	1135
297	Ga0501040_1017018	3300049576	Bacteria	601
298	Ga0501041_0000164	3300049577	Bacteria	29413
299	Ga0501041_0034097	3300049577	Bacteria	3081
300	Ga0501041_0037426	3300049577	Bacteria	2940
301	Ga0501041_0525599	3300049577	Bacteria	753
302	Ga0501042_0004683	3300049578	Bacteria	8725
303	Ga0501042_0040682	3300049578	Bacteria	3304
304	Ga0501042_0104084	3300049578	Bacteria	2042
305	Ga0501042_1095742	3300049578	Bacteria	581
306	Ga0501043_0029893	3300049579	Bacteria	4280
307	Ga0501043_1116523	3300049579	Bacteria	557
308	Ga0501046_0000247	3300049580	Bacteria	55379
309	Ga0501046_0039577	3300049580	Bacteria	3774
310	Ga0501046_0194225	3300049580	Bacteria	1513
311	Ga0501046_0727857	3300049580	Bacteria	698
312	Ga0501047_0149626	3300049581	Bacteria	2211
313	Ga0501048_0000609	3300049582	Bacteria	25452
314	Ga0501048_0085729	3300049582	Bacteria	2221
315	Ga0501048_0119135	3300049582	Bacteria	1865
316	Ga0501048_0284786	3300049582	Bacteria	1175
317	Ga0501048_0346127	3300049582	Bacteria	1060
318	Ga0501067_0048007	3300049583	Bacteria	2368
319	Ga0501068_0004471	3300049584	Bacteria	7610
320	Ga0501068_0208008	3300049584	Bacteria	1242
321	Ga0501068_0664431	3300049584	Bacteria	681
322	Ga0501069_0410569	3300049585	Bacteria	802
323	Ga0501070_0024336	3300049586	Bacteria	5079
324	Ga0501071_0014506	3300049587	Bacteria	5390
325	Ga0501072_0000333	3300049588	Bacteria	33584
326	Ga0501072_0018385	3300049588	Bacteria	5381
327	Ga0501072_0064212	3300049588	Bacteria	2895
328	Ga0501072_0755045	3300049588	Bacteria	763
329	Ga0501072_1215643	3300049588	Bacteria	585
330	Ga0501072_1411711	3300049588	Unclassified	538
331	Ga0501073_0215403	3300049589	Bacteria	1327
332	Ga0501074_0021961	3300049590	Bacteria	4634
333	Ga0501074_0794950	3300049590	Bacteria	667
334	Ga0501074_0811072	3300049590	Bacteria	659
335	Ga0501074_1137363	3300049590	Bacteria	548
336	Ga0501075_0000988	3300049591	Bacteria	18130
337	Ga0501075_0016147	3300049591	Bacteria	5373
338	Ga0501075_0034306	3300049591	Bacteria	3778
339	Ga0501075_0155418	3300049591	Bacteria	1744
340	Ga0501075_0226926	3300049591	Bacteria	1424
341	Ga0501075_0372234	3300049591	Bacteria	1089
342	Ga0501075_0572078	3300049591	Bacteria	862
343	Ga0501076_0001258	3300049592	Bacteria	16886
344	Ga0501076_0005211	3300049592	Bacteria	9313
345	Ga0501076_0030880	3300049592	Bacteria	4174
346	Ga0501076_0323105	3300049592	Bacteria	1266
347	Ga0501076_0494404	3300049592	Bacteria	1008
348	Ga0501077_0000223	3300049593	Bacteria	33258
349	Ga0501077_0019590	3300049593	Bacteria	4279
350	Ga0501077_0040000	3300049593	Bacteria	2987
351	Ga0501077_0393272	3300049593	Bacteria	886
352	Ga0501077_0455779	3300049593	Bacteria	819
353	Ga0501079_0001744	3300049741	Bacteria	15507
354	Ga0501079_0048243	3300049741	Bacteria	3286
355	Ga0501079_0127610	3300049741	Bacteria	1979
356	Ga0501079_0548468	3300049741	Bacteria	909
357	Ga0501079_0623236	3300049741	Bacteria	849
358	Ga0501080_0115391	3300049742	Bacteria	2490
359	Ga0501081_0004498	3300049743	Bacteria	8953
360	Ga0501081_0011313	3300049743	Bacteria	5838
361	Ga0501081_0016547	3300049743	Bacteria	4875
362	Ga0501081_0113440	3300049743	Bacteria	1925
363	Ga0501081_0136466	3300049743	Bacteria	1756
364	Ga0501081_0440997	3300049743	Bacteria	967
365	Ga0501081_1229277	3300049743	Bacteria	568
366	Ga0501083_0074943	3300049744	Bacteria	2248
367	Ga0501083_0280115	3300049744	Bacteria	1085
368	Ga0501035_0052164	3300049822	Bacteria	3660
369	Ga0501035_0382541	3300049822	Bacteria	1173
370	Ga0501035_0770002	3300049822	Bacteria	771
371	Ga0501035_1495342	3300049822	Unclassified	515
372	Ga0501045_0000481	3300049824	Bacteria	24710
373	Ga0501045_0041147	3300049824	Bacteria	3362
374	Ga0501045_0069825	3300049824	Bacteria	2583
375	Ga0501045_0072966	3300049824	Bacteria	2527
376	Ga0501045_0375649	3300049824	Bacteria	1058
377	Ga0501045_0406730	3300049824	Bacteria	1013
378	Ga0501045_0940553	3300049824	Bacteria	634
379	nmdc:mga05p37_1652_c1	3300050507	Bacteria	25883
380	nmdc:mga05p37_234575_c1	3300050507	Bacteria	2209
381	nmdc:mga05p37_362218_c1	3300050507	Bacteria	1704
382	nmdc:mga05p37_6455_c1	3300050507	Bacteria	13831
383	nmdc:mga09592_1087_c1	3300050508	Bacteria	21584
384	nmdc:mga09592_127562_c1	3300050508	Bacteria	2188
385	nmdc:mga09592_5035_c1	3300050508	Bacteria	10721
386	nmdc:mga0qj67_236341_c1	3300050509	Bacteria	1483
387	nmdc:mga0qj67_252_c1	3300050509	Bacteria	36647
388	nmdc:mga0qj67_414385_c1	3300050509	Bacteria	1087
389	nmdc:mga0qj67_64412_c1	3300050509	Bacteria	2915
390	nmdc:mga06r32_1101043_c1	3300050510	Bacteria	743
391	nmdc:mga06r32_13548_c1	3300050510	Bacteria	7389
392	nmdc:mga06r32_14265_c1	3300050510	Bacteria	7207
393	nmdc:mga06r32_266525_c1	3300050510	Bacteria	1700
394	nmdc:mga06r32_37108_c1	3300050510	Bacteria	4610
395	nmdc:mga08y16_1121003_c1	3300050511	Bacteria	761
396	nmdc:mga08y16_206044_c1	3300050511	Bacteria	2038
397	nmdc:mga08y16_341598_c1	3300050511	Bacteria	1539
398	nmdc:mga08y16_384431_c1	3300050511	Bacteria	1438
399	nmdc:mga0n895_2706_c1	3300050512	Bacteria	13991
400	nmdc:mga0n895_315310_c1	3300050512	Bacteria	1585
401	nmdc:mga0n895_47093_c1	3300050512	Bacteria	4215
402	nmdc:mga0rr50_60588_c1	3300050513	Bacteria	2848
403	nmdc:mga08x19_17350_c1	3300050514	Bacteria	4404
404	nmdc:mga08x19_227583_c1	3300050514	Bacteria	1283
405	nmdc:mga08x19_42613_c1	3300050514	Bacteria	2894
406	nmdc:mga0a205_391893_c1	3300050515	Bacteria	1253
407	nmdc:mga0a205_471325_c1	3300050515	Bacteria	1114
408	nmdc:mga0a205_549943_c1	3300050515	Bacteria	1009
409	nmdc:mga0a205_667787_c1	3300050515	Bacteria	890
410	Ga0495595_0151518	3300053084	Bacteria	1141
411	Ga0495619_0120029	3300053085	Bacteria	1802
412	Ga0500566_0252757	3300053094	Bacteria	856
413	Ga0501084_0002403	3300054114	Bacteria	15056
414	Ga0501084_0027048	3300054114	Bacteria	4793
415	Ga0501084_0150352	3300054114	Bacteria	1962
416	Ga0501084_0403068	3300054114	Bacteria	1156
417	Ga0590071_035541	3300059421	Bacteria	1193
418	Ga0590071_036861	3300059421	Bacteria	1173
419	Ga0590071_062438	3300059421	Bacteria	912
420	Ga0590075_132194	3300059424	Unclassified	655
421	Ga0590077_022819	3300059426	Bacteria	1337
422	Ga0590077_027792	3300059426	Bacteria	1227
423	Ga0590077_066949	3300059426	Unclassified	817
424	Ga0501082_0009333	3300060353	Bacteria	8454
425	Ga0501082_0010829	3300060353	Bacteria	7853
426	Ga0501082_0218935	3300060353	Bacteria	1656
427	Ga0501082_0325207	3300060353	Bacteria	1340
428	Ga0501082_0728092	3300060353	Bacteria	868
429	Ga0501082_1371294	3300060353	Bacteria	618
430	Ga0530510_0000412	3300061734	Bacteria	27774
431	Ga0530510_0012325	3300061734	Bacteria	6004
432	Ga0530510_0013466	3300061734	Bacteria	5750
433	Ga0530510_0277629	3300061734	Bacteria	1251
434	Ga0530510_0442669	3300061734	Bacteria	982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049591	Ga0501075_0226926	Ga0501075_0226926_26_388	119
2	3300049578	Ga0501042_1095742	Ga0501042_1095742_179_550	122
3	3300049590	Ga0501074_1137363	Ga0501074_1137363_26_412	127
4	3300049743	Ga0501081_1229277	Ga0501081_1229277_63_452	128
5	3300006847	Ga0075431_100031957	Ga0075431_1000319574	129
6	3300006846	Ga0075430_100011470	Ga0075430_1000114705	131
7	3300027360	Ga0209969_1005898	Ga0209969_10058982	131
8	3300027360	Ga0209969_1006985	Ga0209969_10069852	131
9	3300027364	Ga0209967_1001983	Ga0209967_10019832	131
10	3300027364	Ga0209967_1070942	Ga0209967_10709421	131
11	3300027395	Ga0209996_1006256	Ga0209996_10062561	131
12	3300027526	Ga0209968_1062825	Ga0209968_10628252	131
13	3300027543	Ga0209999_1002310	Ga0209999_10023104	131
14	3300027543	Ga0209999_1007387	Ga0209999_10073873	131
15	3300042436	Ga0439435_0103700	Ga0439435_0103700_37_435	131
16	3300042876	Ga0451577_0386104	Ga0451577_0386104_275_673	131
17	3300049521	Ga0501298_027202	Ga0501298_027202_347_745	131
18	3300050507	nmdc:mga05p37_362218_c1	nmdc:mga05p37_362218_c1_473_871	131
19	3300050509	nmdc:mga0qj67_236341_c1	nmdc:mga0qj67_236341_c1_581_979	131
20	3300005459	Ga0068867_100744271	Ga0068867_1007442711	132
21	3300005530	Ga0070679_100969517	Ga0070679_1009695171	132
22	3300005544	Ga0070686_100214074	Ga0070686_1002140742	132
23	3300025921	Ga0207652_10478733	Ga0207652_104787332	132
24	3300026089	Ga0207648_11118638	Ga0207648_111186382	132
25	3300027695	Ga0209966_1013178	Ga0209966_10131782	132
26	3300034957	Ga0373938_0038997	Ga0373938_0038997_574_975	132
27	3300035114	Ga0373939_0038258	Ga0373939_0038258_551_952	132
28	3300035115	Ga0373941_0017535	Ga0373941_0017535_1243_1644	132
29	3300035241	Ga0373961_0058107	Ga0373961_0058107_117_518	132
30	3300044901	Ga0466960_0718183	Ga0466960_0718183_160_561	132
31	3300049575	Ga0501039_0697621	Ga0501039_0697621_114_515	132
32	3300049583	Ga0501067_0048007	Ga0501067_0048007_1764_2165	132
33	3300049590	Ga0501074_0811072	Ga0501074_0811072_123_524	132
34	3300006871	Ga0075434_100424722	Ga0075434_1004247222	133
35	3300007076	Ga0075435_100589803	Ga0075435_1005898032	133
36	3300025944	Ga0207661_11735592	Ga0207661_117355921	133
37	3300035691	Ga0373931_0154133	Ga0373931_0154133_380_784	133
38	3300050512	nmdc:mga0n895_315310_c1	nmdc:mga0n895_315310_c1_891_1295	133
39	3300050515	nmdc:mga0a205_391893_c1	nmdc:mga0a205_391893_c1_389_793	133
40	3300003405	JGI26132J50249_104450	JGI26132J50249_1044501	134
41	3300005336	Ga0070680_100248821	Ga0070680_1002488212	134
42	3300005345	Ga0070692_10016606	Ga0070692_100166064	134
43	3300005440	Ga0070705_100222955	Ga0070705_1002229552	134
44	3300005444	Ga0070694_100354476	Ga0070694_1003544762	134
45	3300005545	Ga0070695_100100510	Ga0070695_1001005103	134
46	3300005546	Ga0070696_100244524	Ga0070696_1002445241	134
47	3300005549	Ga0070704_100011247	Ga0070704_1000112472	134
48	3300005981	Ga0081538_10063216	Ga0081538_100632161	134
49	3300006844	Ga0075428_100015345	Ga0075428_1000153452	134
50	3300006846	Ga0075430_100279820	Ga0075430_1002798202	134
51	3300006847	Ga0075431_100037076	Ga0075431_1000370764	134
52	3300006880	Ga0075429_100197461	Ga0075429_1001974612	134
53	3300009094	Ga0111539_10807819	Ga0111539_108078192	134
54	3300009147	Ga0114129_10403214	Ga0114129_104032142	134
55	3300025917	Ga0207660_10227221	Ga0207660_102272212	134
56	3300026089	Ga0207648_10708728	Ga0207648_107087282	134
57	3300027378	Ga0209981_1004673	Ga0209981_10046733	134
58	3300027462	Ga0210000_1001658	Ga0210000_10016582	134
59	3300027526	Ga0209968_1007743	Ga0209968_10077432	134
60	3300027543	Ga0209999_1005788	Ga0209999_10057882	134
61	3300027552	Ga0209982_1044845	Ga0209982_10448451	134
62	3300027614	Ga0209970_1047635	Ga0209970_10476352	134
63	3300027665	Ga0209983_1009461	Ga0209983_10094613	134
64	3300027682	Ga0209971_1010154	Ga0209971_10101543	134
65	3300027695	Ga0209966_1034071	Ga0209966_10340712	134
66	3300027876	Ga0209974_10074985	Ga0209974_100749852	134
67	3300031548	Ga0307408_100689804	Ga0307408_1006898042	134
68	3300031911	Ga0307412_12294626	Ga0307412_122946261	134
69	3300036401	Ga0373937_0506965	Ga0373937_0506965_634_1041	134
70	3300041408	Ga0439453_0002518	Ga0439453_0002518_1931_2347	134
71	3300042001	Ga0439441_000072	Ga0439441_000072_7181_7588	134
72	3300042126	Ga0450888_014695	Ga0450888_014695_25_432	134
73	3300042436	Ga0439435_0047274	Ga0439435_0047274_265_681	134
74	3300042437	Ga0439444_0026907	Ga0439444_0026907_383_790	134
75	3300042437	Ga0439444_0035806	Ga0439444_0035806_217_663	134
76	3300042461	Ga0439460_0151577	Ga0439460_0151577_195_602	134
77	3300046528	Ga0495642_0026735	Ga0495642_0026735_426_833	134
78	3300046528	Ga0495642_0233872	Ga0495642_0233872_181_588	134
79	3300046539	Ga0495621_0107596	Ga0495621_0107596_139_546	134
80	3300046664	Ga0495659_0058255	Ga0495659_0058255_804_1211	134
81	3300047317	Ga0495604_0549239	Ga0495604_0549239_323_730	134
82	3300049572	Ga0501036_1079505	Ga0501036_1079505_149_556	134
83	3300049573	Ga0501037_0207638	Ga0501037_0207638_583_990	134
84	3300049575	Ga0501039_0246039	Ga0501039_0246039_446_853	134
85	3300049576	Ga0501040_0015660	Ga0501040_0015660_373_780	134
86	3300049577	Ga0501041_0525599	Ga0501041_0525599_229_636	134
87	3300049590	Ga0501074_0794950	Ga0501074_0794950_105_512	134
88	3300049593	Ga0501077_0455779	Ga0501077_0455779_347_754	134
89	3300049743	Ga0501081_0011313	Ga0501081_0011313_2030_2437	134
90	3300050507	nmdc:mga05p37_234575_c1	nmdc:mga05p37_234575_c1_421_837	134
91	3300050508	nmdc:mga09592_127562_c1	nmdc:mga09592_127562_c1_521_937	134
92	3300050509	nmdc:mga0qj67_414385_c1	nmdc:mga0qj67_414385_c1_306_722	134
93	3300050510	nmdc:mga06r32_37108_c1	nmdc:mga06r32_37108_c1_3702_4118	134
94	3300050511	nmdc:mga08y16_1121003_c1	nmdc:mga08y16_1121003_c1_331_738	134
95	3300060353	Ga0501082_0325207	Ga0501082_0325207_623_1030	134
96	3300005330	Ga0070690_100444474	Ga0070690_1004444742	135
97	3300005340	Ga0070689_100095991	Ga0070689_1000959913	135
98	3300005440	Ga0070705_100647302	Ga0070705_1006473021	135
99	3300005441	Ga0070700_100538777	Ga0070700_1005387772	135
100	3300005456	Ga0070678_101172322	Ga0070678_1011723221	135
101	3300005615	Ga0070702_100070725	Ga0070702_1000707252	135
102	3300005719	Ga0068861_100025876	Ga0068861_1000258764	135
103	3300025940	Ga0207691_10137661	Ga0207691_101376613	135
104	3300025942	Ga0207689_10488359	Ga0207689_104883592	135
105	3300026118	Ga0207675_100263225	Ga0207675_1002632252	135
106	3300026121	Ga0207683_10408251	Ga0207683_104082512	135
107	3300027378	Ga0209981_1002579	Ga0209981_10025792	135
108	3300027462	Ga0210000_1007748	Ga0210000_10077482	135
109	3300041410	Ga0439461_0026721	Ga0439461_0026721_369_779	135
110	3300042156	Ga0439446_0073317	Ga0439446_0073317_333_743	135
111	3300042435	Ga0439434_0002344	Ga0439434_0002344_4366_4776	135
112	3300042436	Ga0439435_0002037	Ga0439435_0002037_1868_2278	135
113	3300049579	Ga0501043_1116523	Ga0501043_1116523_70_516	135
114	3300059421	Ga0590071_036861	Ga0590071_036861_273_683	135
115	3300005458	Ga0070681_10000393	Ga0070681_100003937	136
116	3300005530	Ga0070679_100370317	Ga0070679_1003703172	136
117	3300006358	Ga0068871_100981860	Ga0068871_1009818602	136
118	3300006852	Ga0075433_10431603	Ga0075433_104316032	136
119	3300006871	Ga0075434_100000003	Ga0075434_10000000350	136
120	3300006914	Ga0075436_100064896	Ga0075436_1000648963	136
121	3300007076	Ga0075435_100059361	Ga0075435_1000593613	136
122	3300009551	Ga0105238_11151956	Ga0105238_111519561	136
123	3300025912	Ga0207707_10001889	Ga0207707_100018892	136
124	3300025939	Ga0207665_10330228	Ga0207665_103302282	136
125	3300031852	Ga0307410_11284516	Ga0307410_112845162	136
126	3300032002	Ga0307416_100555775	Ga0307416_1005557752	136
127	3300032126	Ga0307415_100767733	Ga0307415_1007677332	136
128	3300041458	Ga0451798_0300454	Ga0451798_0300454_158_580	136
129	3300041486	Ga0451807_1419061	Ga0451807_1419061_221_643	136
130	3300046536	Ga0495587_0478878	Ga0495587_0478878_12_425	136
131	3300047444	Ga0495675_0244211	Ga0495675_0244211_96_509	136
132	3300049568	Ga0501031_0013351	Ga0501031_0013351_1935_2348	136
133	3300049569	Ga0501032_0047993	Ga0501032_0047993_1490_1903	136
134	3300049570	Ga0501033_0002408	Ga0501033_0002408_11958_12371	136
135	3300049570	Ga0501033_0177467	Ga0501033_0177467_730_1143	136
136	3300049572	Ga0501036_0006130	Ga0501036_0006130_9243_9656	136
137	3300049572	Ga0501036_0285799	Ga0501036_0285799_744_1157	136
138	3300049573	Ga0501037_0006992	Ga0501037_0006992_6342_6755	136
139	3300049574	Ga0501038_0001672	Ga0501038_0001672_2900_3313	136
140	3300049575	Ga0501039_0000763	Ga0501039_0000763_11696_12109	136
141	3300049576	Ga0501040_0013952	Ga0501040_0013952_2894_3307	136
142	3300049577	Ga0501041_0000164	Ga0501041_0000164_5357_5770	136
143	3300049577	Ga0501041_0034097	Ga0501041_0034097_708_1121	136
144	3300049578	Ga0501042_0004683	Ga0501042_0004683_4402_4815	136
145	3300049578	Ga0501042_0040682	Ga0501042_0040682_2166_2579	136
146	3300049579	Ga0501043_0029893	Ga0501043_0029893_3827_4240	136
147	3300049580	Ga0501046_0000247	Ga0501046_0000247_26743_27156	136
148	3300049580	Ga0501046_0194225	Ga0501046_0194225_345_758	136
149	3300049581	Ga0501047_0149626	Ga0501047_0149626_1614_2027	136
150	3300049582	Ga0501048_0000609	Ga0501048_0000609_1181_1594	136
151	3300049582	Ga0501048_0119135	Ga0501048_0119135_951_1364	136
152	3300049584	Ga0501068_0004471	Ga0501068_0004471_1410_1823	136
153	3300049584	Ga0501068_0208008	Ga0501068_0208008_82_495	136
154	3300049584	Ga0501068_0664431	Ga0501068_0664431_55_468	136
155	3300049586	Ga0501070_0024336	Ga0501070_0024336_1906_2319	136
156	3300049588	Ga0501072_0000333	Ga0501072_0000333_9325_9738	136
157	3300049588	Ga0501072_0018385	Ga0501072_0018385_4136_4549	136
158	3300049589	Ga0501073_0215403	Ga0501073_0215403_852_1265	136
159	3300049590	Ga0501074_0021961	Ga0501074_0021961_2926_3339	136
160	3300049591	Ga0501075_0000988	Ga0501075_0000988_9005_9418	136
161	3300049591	Ga0501075_0016147	Ga0501075_0016147_3078_3491	136
162	3300049591	Ga0501075_0372234	Ga0501075_0372234_479_934	136
163	3300049591	Ga0501075_0572078	Ga0501075_0572078_392_805	136
164	3300049592	Ga0501076_0001258	Ga0501076_0001258_1550_1963	136
165	3300049592	Ga0501076_0005211	Ga0501076_0005211_6952_7365	136
166	3300049593	Ga0501077_0000223	Ga0501077_0000223_19411_19824	136
167	3300049593	Ga0501077_0040000	Ga0501077_0040000_1871_2284	136
168	3300049741	Ga0501079_0001744	Ga0501079_0001744_3915_4328	136
169	3300049741	Ga0501079_0127610	Ga0501079_0127610_98_511	136
170	3300049742	Ga0501080_0115391	Ga0501080_0115391_1699_2112	136
171	3300049743	Ga0501081_0004498	Ga0501081_0004498_2871_3284	136
172	3300049743	Ga0501081_0016547	Ga0501081_0016547_2962_3375	136
173	3300049744	Ga0501083_0074943	Ga0501083_0074943_853_1266	136
174	3300049822	Ga0501035_0052164	Ga0501035_0052164_182_595	136
175	3300049822	Ga0501035_1495342	Ga0501035_1495342_71_484	136
176	3300049824	Ga0501045_0000481	Ga0501045_0000481_1457_1870	136
177	3300049824	Ga0501045_0041147	Ga0501045_0041147_948_1361	136
178	3300050510	nmdc:mga06r32_1101043_c1	nmdc:mga06r32_1101043_c1_115_549	136
179	3300050512	nmdc:mga0n895_2706_c1	nmdc:mga0n895_2706_c1_2398_2811	136
180	3300050513	nmdc:mga0rr50_60588_c1	nmdc:mga0rr50_60588_c1_1834_2247	136
181	3300050514	nmdc:mga08x19_42613_c1	nmdc:mga08x19_42613_c1_1763_2176	136
182	3300050515	nmdc:mga0a205_667787_c1	nmdc:mga0a205_667787_c1_447_860	136
183	3300054114	Ga0501084_0002403	Ga0501084_0002403_8411_8824	136
184	3300054114	Ga0501084_0150352	Ga0501084_0150352_1532_1945	136
185	3300060353	Ga0501082_0009333	Ga0501082_0009333_7142_7555	136
186	3300060353	Ga0501082_0010829	Ga0501082_0010829_6980_7393	136
187	3300061734	Ga0530510_0000412	Ga0530510_0000412_8949_9362	136
188	3300061734	Ga0530510_0012325	Ga0530510_0012325_4994_5407	136
189	3300061734	Ga0530510_0277629	Ga0530510_0277629_108_563	136
190	3300005330	Ga0070690_100870743	Ga0070690_1008707432	137
191	3300005340	Ga0070689_100418312	Ga0070689_1004183122	137
192	3300005444	Ga0070694_100827738	Ga0070694_1008277381	137
193	3300005536	Ga0070697_102116349	Ga0070697_1021163491	137
194	3300005544	Ga0070686_100092524	Ga0070686_1000925243	137
195	3300005546	Ga0070696_100192247	Ga0070696_1001922472	137
196	3300005547	Ga0070693_100661321	Ga0070693_1006613212	137
197	3300005549	Ga0070704_100562740	Ga0070704_1005627402	137
198	3300005617	Ga0068859_100636441	Ga0068859_1006364412	137
199	3300006846	Ga0075430_100000319	Ga0075430_10000031914	137
200	3300006847	Ga0075431_100375694	Ga0075431_1003756942	137
201	3300006931	Ga0097620_100636413	Ga0097620_1006364132	137
202	3300009147	Ga0114129_10991996	Ga0114129_109919961	137
203	3300025936	Ga0207670_10967577	Ga0207670_109675772	137
204	3300027378	Ga0209981_1053126	Ga0209981_10531261	137
205	3300027395	Ga0209996_1026566	Ga0209996_10265662	137
206	3300027682	Ga0209971_1102282	Ga0209971_11022821	137
207	3300031903	Ga0307407_10220422	Ga0307407_102204222	137
208	3300031995	Ga0307409_100097855	Ga0307409_1000978552	137
209	3300032002	Ga0307416_100965770	Ga0307416_1009657702	137
210	3300032005	Ga0307411_10117273	Ga0307411_101172733	137
211	3300032005	Ga0307411_10616286	Ga0307411_106162862	137
212	3300032126	Ga0307415_100636626	Ga0307415_1006366262	137
213	3300035086	Ga0373934_0212129	Ga0373934_0212129_305_721	137
214	3300035119	Ga0373956_0387581	Ga0373956_0387581_32_448	137
215	3300042134	Ga0450898_098058	Ga0450898_098058_144_560	137
216	3300042156	Ga0439446_0385849	Ga0439446_0385849_21_437	137
217	3300046454	Ga0495592_0004382	Ga0495592_0004382_2950_3366	137
218	3300046473	Ga0495582_0307155	Ga0495582_0307155_236_652	137
219	3300046476	Ga0495662_0002560	Ga0495662_0002560_5980_6396	137
220	3300046511	Ga0495608_0000643	Ga0495608_0000643_15294_15710	137
221	3300046514	Ga0495618_0018719	Ga0495618_0018719_3697_4113	137
222	3300046516	Ga0495628_0006198	Ga0495628_0006198_157_573	137
223	3300046517	Ga0495630_0018417	Ga0495630_0018417_648_1064	137
224	3300046523	Ga0495644_0257921	Ga0495644_0257921_214_630	137
225	3300046526	Ga0495666_0046143	Ga0495666_0046143_646_1062	137
226	3300046529	Ga0495652_0014137	Ga0495652_0014137_5626_6042	137
227	3300046533	Ga0495640_0009574	Ga0495640_0009574_4077_4493	137
228	3300046535	Ga0495586_0000323	Ga0495586_0000323_886_1302	137
229	3300046536	Ga0495587_0119566	Ga0495587_0119566_511_927	137
230	3300046543	Ga0495645_0291867	Ga0495645_0291867_124_540	137
231	3300046559	Ga0495667_0001031	Ga0495667_0001031_7020_7436	137
232	3300046642	Ga0495634_0007644	Ga0495634_0007644_1687_2103	137
233	3300046678	Ga0495599_0003189	Ga0495599_0003189_8467_8883	137
234	3300046683	Ga0495658_0100826	Ga0495658_0100826_727_1143	137
235	3300046689	Ga0495613_0001197	Ga0495613_0001197_6747_7163	137
236	3300046690	Ga0495624_0039151	Ga0495624_0039151_1686_2102	137
237	3300046809	Ga0495600_0001307	Ga0495600_0001307_11002_11418	137
238	3300047317	Ga0495604_0004264	Ga0495604_0004264_5961_6377	137
239	3300047318	Ga0495636_0000940	Ga0495636_0000940_864_1280	137
240	3300047322	Ga0495680_0002278	Ga0495680_0002278_8104_8520	137
241	3300047673	Ga0495593_0189923	Ga0495593_0189923_51_467	137
242	3300049743	Ga0501081_0440997	Ga0501081_0440997_224_640	137
243	3300050509	nmdc:mga0qj67_252_c1	nmdc:mga0qj67_252_c1_23835_24251	137
244	3300050510	nmdc:mga06r32_13548_c1	nmdc:mga06r32_13548_c1_6461_6877	137
245	3300050512	nmdc:mga0n895_47093_c1	nmdc:mga0n895_47093_c1_2293_2709	137
246	3300053084	Ga0495595_0151518	Ga0495595_0151518_549_965	137
247	3300053085	Ga0495619_0120029	Ga0495619_0120029_22_438	137
248	3300053094	Ga0500566_0252757	Ga0500566_0252757_50_466	137
249	3300005546	Ga0070696_101587798	Ga0070696_1015877981	138
250	3300025918	Ga0207662_10372246	Ga0207662_103722462	138
251	3300045051	Ga0451576_0247865	Ga0451576_0247865_1025_1444	138
252	3300045051	Ga0451576_1508622	Ga0451576_1508622_135_569	138
253	3300005439	Ga0070711_101605487	Ga0070711_1016054871	139
254	3300005440	Ga0070705_100006109	Ga0070705_1000061096	139
255	3300005518	Ga0070699_100009823	Ga0070699_1000098237	139
256	3300005546	Ga0070696_100124992	Ga0070696_1001249922	139
257	3300005615	Ga0070702_101109064	Ga0070702_1011090641	139
258	3300006846	Ga0075430_100503220	Ga0075430_1005032202	139
259	3300006871	Ga0075434_100853388	Ga0075434_1008533882	139
260	3300006914	Ga0075436_100022169	Ga0075436_1000221692	139
261	3300015262	Ga0182007_10217862	Ga0182007_102178621	139
262	3300025916	Ga0207663_10454219	Ga0207663_104542192	139
263	3300031995	Ga0307409_102372762	Ga0307409_1023727621	139
264	3300042435	Ga0439434_0257937	Ga0439434_0257937_120_542	139
265	3300049570	Ga0501033_1130001	Ga0501033_1130001_39_461	139
266	3300049572	Ga0501036_0573277	Ga0501036_0573277_232_669	139
267	3300049572	Ga0501036_1084581	Ga0501036_1084581_20_442	139
268	3300049574	Ga0501038_1359923	Ga0501038_1359923_29_466	139
269	3300049576	Ga0501040_1017018	Ga0501040_1017018_27_449	139
270	3300049824	Ga0501045_0940553	Ga0501045_0940553_166_588	139
271	3300050514	nmdc:mga08x19_17350_c1	nmdc:mga08x19_17350_c1_2836_3258	139
272	3300050514	nmdc:mga08x19_227583_c1	nmdc:mga08x19_227583_c1_571_993	139
273	3300059421	Ga0590071_035541	Ga0590071_035541_171_593	139
274	3300059421	Ga0590071_062438	Ga0590071_062438_400_822	139
275	3300059426	Ga0590077_022819	Ga0590077_022819_457_879	139
276	3300059426	Ga0590077_027792	Ga0590077_027792_684_1106	139
277	3300006871	Ga0075434_100288915	Ga0075434_1002889152	140
278	3300006914	Ga0075436_100127562	Ga0075436_1001275621	140
279	3300007076	Ga0075435_100157490	Ga0075435_1001574902	140
280	3300009147	Ga0114129_10440412	Ga0114129_104404122	140
281	3300031995	Ga0307409_101555443	Ga0307409_1015554431	140
282	3300032002	Ga0307416_103166992	Ga0307416_1031669921	140
283	3300049526	Ga0501303_020826	Ga0501303_020826_156_584	140
284	3300049574	Ga0501038_0773480	Ga0501038_0773480_136_561	140
285	3300049582	Ga0501048_0346127	Ga0501048_0346127_296_721	140
286	3300049588	Ga0501072_1215643	Ga0501072_1215643_140_565	140
287	3300049592	Ga0501076_0494404	Ga0501076_0494404_406_831	140
288	3300049822	Ga0501035_0770002	Ga0501035_0770002_163_588	140
289	3300049824	Ga0501045_0375649	Ga0501045_0375649_52_477	140
290	3300005295	Ga0065707_10315558	Ga0065707_103155582	141
291	3300006844	Ga0075428_100007527	Ga0075428_1000075275	141
292	3300006847	Ga0075431_100273162	Ga0075431_1002731622	141
293	3300006852	Ga0075433_10220312	Ga0075433_102203122	141
294	3300006880	Ga0075429_100199426	Ga0075429_1001994262	141
295	3300009094	Ga0111539_10841467	Ga0111539_108414672	141
296	3300009094	Ga0111539_11635129	Ga0111539_116351292	141
297	3300009147	Ga0114129_10020624	Ga0114129_100206249	141
298	3300012477	Ga0157336_1011758	Ga0157336_10117582	141
299	3300012515	Ga0157338_1017451	Ga0157338_10174512	141
300	3300014326	Ga0157380_10154710	Ga0157380_101547102	141
301	3300025939	Ga0207665_10064318	Ga0207665_100643183	141
302	3300027907	Ga0207428_10006862	Ga0207428_1000686210	141
303	3300034957	Ga0373938_0104769	Ga0373938_0104769_48_479	141
304	3300035088	Ga0373940_0015687	Ga0373940_0015687_216_647	141
305	3300035112	Ga0373932_0097435	Ga0373932_0097435_510_941	141
306	3300035114	Ga0373939_0304334	Ga0373939_0304334_113_544	141
307	3300035121	Ga0373960_0126165	Ga0373960_0126165_315_746	141
308	3300045051	Ga0451576_0259633	Ga0451576_0259633_136_567	141
309	3300046684	Ga0495669_0167680	Ga0495669_0167680_354_791	141
310	3300050507	nmdc:mga05p37_1652_c1	nmdc:mga05p37_1652_c1_8477_8908	141
311	3300050508	nmdc:mga09592_5035_c1	nmdc:mga09592_5035_c1_9033_9464	141
312	3300050509	nmdc:mga0qj67_64412_c1	nmdc:mga0qj67_64412_c1_2215_2652	141
313	3300050510	nmdc:mga06r32_266525_c1	nmdc:mga06r32_266525_c1_693_1124	141
314	3300050511	nmdc:mga08y16_206044_c1	nmdc:mga08y16_206044_c1_158_589	141
315	3300050515	nmdc:mga0a205_471325_c1	nmdc:mga0a205_471325_c1_556_987	141
316	3300005341	Ga0070691_10272866	Ga0070691_102728662	142
317	3300050511	nmdc:mga08y16_384431_c1	nmdc:mga08y16_384431_c1_142_573	142
318	3300027695	Ga0209966_1005210	Ga0209966_10052102	145
319	3300049576	Ga0501040_0306786	Ga0501040_0306786_617_1060	145
320	3300049588	Ga0501072_0755045	Ga0501072_0755045_289_732	145
321	3300005295	Ga0065707_10350762	Ga0065707_103507621	147
322	3300005340	Ga0070689_100338986	Ga0070689_1003389862	147
323	3300005345	Ga0070692_10475454	Ga0070692_104754541	147
324	3300005364	Ga0070673_101951210	Ga0070673_1019512101	147
325	3300005365	Ga0070688_100125424	Ga0070688_1001254242	147
326	3300005440	Ga0070705_100732048	Ga0070705_1007320482	147
327	3300005444	Ga0070694_100025626	Ga0070694_1000256265	147
328	3300005444	Ga0070694_100026195	Ga0070694_1000261953	147
329	3300005444	Ga0070694_100505065	Ga0070694_1005050652	147
330	3300005468	Ga0070707_101050849	Ga0070707_1010508491	147
331	3300005471	Ga0070698_100008239	Ga0070698_1000082399	147
332	3300005471	Ga0070698_100667657	Ga0070698_1006676571	147
333	3300005545	Ga0070695_100010662	Ga0070695_1000106626	147
334	3300005545	Ga0070695_100255785	Ga0070695_1002557852	147
335	3300005545	Ga0070695_100673412	Ga0070695_1006734122	147
336	3300005545	Ga0070695_100907552	Ga0070695_1009075521	147
337	3300005546	Ga0070696_100141843	Ga0070696_1001418432	147
338	3300005546	Ga0070696_101275943	Ga0070696_1012759431	147
339	3300005549	Ga0070704_100000615	Ga0070704_10000061514	147
340	3300005549	Ga0070704_100155529	Ga0070704_1001555292	147
341	3300005549	Ga0070704_100879156	Ga0070704_1008791562	147
342	3300005549	Ga0070704_100988695	Ga0070704_1009886952	147
343	3300005577	Ga0068857_100389709	Ga0068857_1003897092	147
344	3300005577	Ga0068857_101981217	Ga0068857_1019812171	147
345	3300005617	Ga0068859_100016705	Ga0068859_1000167055	147
346	3300005844	Ga0068862_100338493	Ga0068862_1003384932	147
347	3300006844	Ga0075428_100451001	Ga0075428_1004510012	147
348	3300006844	Ga0075428_102306947	Ga0075428_1023069471	147
349	3300006846	Ga0075430_100005676	Ga0075430_1000056767	147
350	3300006847	Ga0075431_100002080	Ga0075431_10000208011	147
351	3300006852	Ga0075433_10200604	Ga0075433_102006042	147
352	3300006880	Ga0075429_100000293	Ga0075429_1000002935	147
353	3300006881	Ga0068865_101253820	Ga0068865_1012538202	147
354	3300006931	Ga0097620_100016706	Ga0097620_1000167064	147
355	3300009094	Ga0111539_10393831	Ga0111539_103938312	147
356	3300009094	Ga0111539_10455101	Ga0111539_104551012	147
357	3300009147	Ga0114129_10002323	Ga0114129_1000232316	147
358	3300025922	Ga0207646_10908543	Ga0207646_109085431	147
359	3300025938	Ga0207704_10654338	Ga0207704_106543382	147
360	3300027462	Ga0210000_1037634	Ga0210000_10376342	147
361	3300027907	Ga0207428_10267077	Ga0207428_102670772	147
362	3300028380	Ga0268265_10815279	Ga0268265_108152792	147
363	3300034817	Ga0373948_0172601	Ga0373948_0172601_88_534	147
364	3300035083	Ga0373926_0075423	Ga0373926_0075423_635_1081	147
365	3300035084	Ga0373928_0088043	Ga0373928_0088043_108_554	147
366	3300035112	Ga0373932_0418804	Ga0373932_0418804_33_479	147
367	3300035115	Ga0373941_0212931	Ga0373941_0212931_45_491	147
368	3300035692	Ga0373935_0006765	Ga0373935_0006765_2786_3232	147
369	3300035695	Ga0373927_0050266	Ga0373927_0050266_1776_2222	147
370	3300035725	Ga0373947_0045635	Ga0373947_0045635_445_891	147
371	3300037068	Ga0373925_0141141	Ga0373925_0141141_1215_1661	147
372	3300042003	Ga0439443_040357	Ga0439443_040357_314_760	147
373	3300045051	Ga0451576_0336548	Ga0451576_0336548_900_1346	147
374	3300050507	nmdc:mga05p37_6455_c1	nmdc:mga05p37_6455_c1_8963_9409	147
375	3300050508	nmdc:mga09592_1087_c1	nmdc:mga09592_1087_c1_8977_9423	147
376	3300050510	nmdc:mga06r32_14265_c1	nmdc:mga06r32_14265_c1_6058_6504	147
377	3300050511	nmdc:mga08y16_341598_c1	nmdc:mga08y16_341598_c1_695_1141	147
378	3300050515	nmdc:mga0a205_549943_c1	nmdc:mga0a205_549943_c1_169_615	147
379	3300049568	Ga0501031_0023338	Ga0501031_0023338_3010_3456	148
380	3300049570	Ga0501033_0966735	Ga0501033_0966735_31_477	148
381	3300049572	Ga0501036_0243771	Ga0501036_0243771_311_757	148
382	3300049574	Ga0501038_0072732	Ga0501038_0072732_467_913	148
383	3300049575	Ga0501039_0050977	Ga0501039_0050977_2299_2745	148
384	3300049576	Ga0501040_0007208	Ga0501040_0007208_1943_2389	148
385	3300049577	Ga0501041_0037426	Ga0501041_0037426_1508_1954	148
386	3300049578	Ga0501042_0104084	Ga0501042_0104084_1094_1540	148
387	3300049580	Ga0501046_0039577	Ga0501046_0039577_2159_2605	148
388	3300049582	Ga0501048_0085729	Ga0501048_0085729_1389_1835	148
389	3300049587	Ga0501071_0014506	Ga0501071_0014506_2212_2658	148
390	3300049588	Ga0501072_0064212	Ga0501072_0064212_1307_1753	148
391	3300049591	Ga0501075_0034306	Ga0501075_0034306_2892_3338	148
392	3300049592	Ga0501076_0030880	Ga0501076_0030880_1488_1934	148
393	3300049593	Ga0501077_0019590	Ga0501077_0019590_1094_1540	148
394	3300049741	Ga0501079_0048243	Ga0501079_0048243_1869_2315	148
395	3300049743	Ga0501081_0136466	Ga0501081_0136466_878_1324	148
396	3300049744	Ga0501083_0280115	Ga0501083_0280115_582_1028	148
397	3300049822	Ga0501035_0382541	Ga0501035_0382541_582_1028	148
398	3300049824	Ga0501045_0069825	Ga0501045_0069825_1174_1620	148
399	3300054114	Ga0501084_0027048	Ga0501084_0027048_2582_3028	148
400	3300060353	Ga0501082_0218935	Ga0501082_0218935_174_620	148
401	3300061734	Ga0530510_0013466	Ga0530510_0013466_2592_3038	148
402	3300006847	Ga0075431_100128735	Ga0075431_1001287352	149
403	3300009147	Ga0114129_10554311	Ga0114129_105543111	149
404	3300027360	Ga0209969_1019719	Ga0209969_10197192	149
405	3300059424	Ga0590075_132194	Ga0590075_132194_77_529	149
406	3300059426	Ga0590077_066949	Ga0590077_066949_194_646	149
407	3300006847	Ga0075431_101824713	Ga0075431_1018247131	150
408	3300006880	Ga0075429_100992833	Ga0075429_1009928333	150
409	3300031548	Ga0307408_100193617	Ga0307408_1001936172	150
410	3300031665	Ga0316575_10010752	Ga0316575_100107524	150
411	3300031901	Ga0307406_11588676	Ga0307406_115886761	150
412	3300032005	Ga0307411_11319967	Ga0307411_113199671	150
413	3300049582	Ga0501048_0284786	Ga0501048_0284786_80_562	150
414	3300003373	JGI25407J50210_10140166	JGI25407J50210_101401661	151
415	3300005330	Ga0070690_100565789	Ga0070690_1005657891	151
416	3300005937	Ga0081455_10063371	Ga0081455_100633711	151
417	3300005981	Ga0081538_10025199	Ga0081538_100251993	151
418	3300005981	Ga0081538_10073309	Ga0081538_100733093	151
419	3300049576	Ga0501040_0198612	Ga0501040_0198612_415_870	151
420	3300049580	Ga0501046_0727857	Ga0501046_0727857_136_591	151
421	3300049585	Ga0501069_0410569	Ga0501069_0410569_53_517	151
422	3300049588	Ga0501072_1411711	Ga0501072_1411711_33_488	151
423	3300049591	Ga0501075_0155418	Ga0501075_0155418_939_1394	151
424	3300049592	Ga0501076_0323105	Ga0501076_0323105_45_500	151
425	3300049593	Ga0501077_0393272	Ga0501077_0393272_277_732	151
426	3300049741	Ga0501079_0548468	Ga0501079_0548468_27_482	151
427	3300049741	Ga0501079_0623236	Ga0501079_0623236_103_558	151
428	3300049743	Ga0501081_0113440	Ga0501081_0113440_279_734	151
429	3300049824	Ga0501045_0072966	Ga0501045_0072966_1119_1574	151
430	3300049824	Ga0501045_0406730	Ga0501045_0406730_133_588	151
431	3300054114	Ga0501084_0403068	Ga0501084_0403068_52_507	151
432	3300060353	Ga0501082_0728092	Ga0501082_0728092_72_527	151
433	3300060353	Ga0501082_1371294	Ga0501082_1371294_21_485	151
434	3300061734	Ga0530510_0442669	Ga0530510_0442669_322_777	151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12973

Cupin_7

ChrR Cupin-like domain

18

122

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3k3n-assembly1.cif.gz_A	crystal structure of the catalytic core domain of human phf8	0.9188	52	118
2yu1-assembly1.cif.gz_A	crystal structure of hjhdm1a complexed with a-ketoglutarate	0.9131	52	118
2yu2-assembly1.cif.gz_A	crystal structure of hjhdm1a without a-ketoglutarate	0.9097	52	118
3o14-assembly2.cif.gz_B	crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution	0.909	22	116
7uva-assembly2.cif.gz_D	crystal structure of kdm2a histone demethylase catalytic domain in complex with an h3c36 peptide modified by unc8015	0.8982	52	118

ID	Description	Score	Start	End	Superfamily
3k3nA01	Mainly Beta;Sandwich;Jelly Rolls;Cupin	0.9188	52	118	2.60.120.650
af_Q95Q98_1_277_2.60.120.650	Mainly Beta;Sandwich;Jelly Rolls;Cupin	0.9135	52	118	2.60.120.650
af_P40034_123_421_2.60.120.650	Mainly Beta;Sandwich;Jelly Rolls;Cupin	0.9047	52	118	2.60.120.650
4qx8A01	Mainly Beta;Sandwich;Jelly Rolls;Cupin	0.8975	52	118	2.60.120.650
3o14B00	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.8933	22	116	2.60.120.10

ID	Description	Score	Start	End
AF-A0A382XY09-F1-model_v4	ChrR-like cupin domain-containing protein	0.9866	2	118
AF-A0A7V4CZG3-F1-model_v4	ChrR-like cupin domain-containing protein	0.9857	19	122
AF-A0A1F4CY28-F1-model_v4	ChrR-like cupin domain-containing protein	0.9827	16	106
AF-A0A2V6PGU3-F1-model_v4	ChrR-like cupin domain-containing protein	0.981	23	120
AF-A0A512N923-F1-model_v4	ChrR-like cupin domain-containing protein	0.9792	19	124

Feature Viewer

pLDDT	pTM	Quality
91.18	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F443069

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF12973

Cupin_7

ChrR Cupin-like domain

18

122

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map