F443062

General Info

Members Datasets Scaffolds Average Seq Length
434 247 427 326

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100063152|Ga0097621_1000631524
Length 346
Sequence MTLPIRSSSRNQKDPMTQHLPSPRPTRRLVVAAVLGIGALIAAGPSFGQAYPAKPITFVVPFAAGSATDQLARALGQSITEQTKQAVIVDNKAGASGMLAAQQVARAPADGYTVLITTNTTQAANEHLYKKLQYDPVKDFAAVTGLGRGGQVLVVRVDSPYKSVADLIADAKKRPGKLSFGSGSSSSRVAGEMLKQLTHTDILHVPYKSNPNAVTDLLGGQIDFMITDTATGMPQIKGGKLRGLAVSTTKRNPLLPDLPTLEEAGVKGYDMGYWFAAYAPAGTPAPVVARLRELLVTGTQSAAAKTFFEGTGSDPWTTTPEELAKFQIAEAQKWGRVIKAAGIEPE

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2721755523 Delftia sp. HK171 Isolate Unclassified
4 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
5 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
6 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
167 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
244 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
245 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.52
Nodule 1.15
Rhizoplane 3
Rhizosphere 73.73
Stem 0
Stem Tuber 0
Unclassified 7.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000134 3300002705 Bacteria 53987
2 JGI25154J39366_1000151 3300002738 Bacteria 53987
3 JGI25157J39369_1000173 3300002741 Bacteria 54214
4 JGI25159J45721_1001007 3300002987 Bacteria 12134
5 JGI25160J50197_1000576 3300003354 Bacteria 20623
6 JGI25161J50226_1000384 3300003374 Bacteria 22244
7 Ga0055526_1002868 3300003771 Bacteria 11363
8 Ga0055526_1003895 3300003771 Bacteria 9243
9 Ga0055537_1000006 3300003773 Bacteria 147020
10 Ga0055537_1000445 3300003773 Bacteria 26375
11 Ga0055524_1000032 3300003775 Bacteria 182182
12 Ga0055528_1002479 3300003790 Bacteria 9866
13 Ga0055530_10003406 3300003791 Bacteria 9074
14 Ga0055530_10029739 3300003791 Bacteria 1456
15 Ga0055540_1000046 3300003792 Bacteria 148762
16 Ga0055531_10012109 3300003794 Bacteria 4085
17 Ga0055543_1001191 3300004625 Bacteria 10956
18 Ga0065165_1011967 3300005262 Bacteria 3567
19 Ga0065704_10085452 3300005289 Bacteria 3221
20 Ga0070658_10058310 3300005327 Bacteria 3142
21 Ga0070676_10001200 3300005328 Bacteria 12990
22 Ga0070676_10001498 3300005328 Bacteria 11823
23 Ga0070683_100070006 3300005329 Bacteria 3272
24 Ga0070670_100014961 3300005331 Bacteria 6659
25 Ga0070670_100016883 3300005331 Bacteria 6267
26 Ga0068869_100008919 3300005334 Bacteria 6490
27 Ga0068869_100039531 3300005334 Bacteria 3368
28 Ga0068869_100050695 3300005334 Bacteria 3009
29 Ga0068869_100093638 3300005334 Bacteria 2264
30 Ga0068869_100096408 3300005334 Bacteria 2232
31 Ga0070666_10012809 3300005335 Bacteria 5301
32 Ga0068868_100035696 3300005338 Bacteria 3844
33 Ga0070660_100020129 3300005339 Bacteria 4899
34 Ga0070687_100012070 3300005343 Bacteria 3801
35 Ga0070668_100009867 3300005347 Bacteria 7071
36 Ga0070669_100014437 3300005353 Bacteria 5621
37 Ga0070669_100014655 3300005353 Bacteria 5581
38 Ga0070669_100024776 3300005353 Bacteria 4306
39 Ga0070675_100002601 3300005354 Bacteria 13543
40 Ga0070675_100006604 3300005354 Bacteria 8914
41 Ga0070675_100006975 3300005354 Bacteria 8678
42 Ga0070675_100012061 3300005354 Bacteria 6773
43 Ga0070675_100029340 3300005354 Bacteria 4436
44 Ga0070675_100046367 3300005354 Bacteria 3558
45 Ga0070671_100005450 3300005355 Bacteria 10159
46 Ga0070671_100043122 3300005355 Bacteria 3750
47 Ga0070671_100175690 3300005355 Bacteria 1812
48 Ga0070674_100001581 3300005356 Bacteria 12181
49 Ga0070674_100058869 3300005356 Bacteria 2672
50 Ga0070674_100124043 3300005356 Bacteria 1916
51 Ga0070673_100004089 3300005364 Bacteria 9180
52 Ga0070673_100005182 3300005364 Bacteria 8324
53 Ga0070673_100054562 3300005364 Bacteria 3144
54 Ga0070673_100118320 3300005364 Bacteria 2206
55 Ga0070673_100355201 3300005364 Bacteria 1301
56 Ga0070659_100096019 3300005366 Bacteria 2381
57 Ga0070659_100157926 3300005366 Bacteria 1853
58 Ga0070667_100003754 3300005367 Bacteria 12902
59 Ga0070667_100013733 3300005367 Bacteria 6695
60 Ga0070667_100062053 3300005367 Bacteria 3166
61 Ga0070667_100066958 3300005367 Bacteria 3052
62 Ga0070701_10136666 3300005438 Bacteria 1398
63 Ga0070700_100054377 3300005441 Bacteria 2501
64 Ga0070663_100094309 3300005455 Bacteria 2222
65 Ga0070678_100004125 3300005456 Bacteria 8188
66 Ga0070678_100019934 3300005456 Bacteria 4388
67 Ga0070678_100029268 3300005456 Bacteria 3769
68 Ga0070678_100036606 3300005456 Bacteria 3437
69 Ga0070678_100082016 3300005456 Bacteria 2447
70 Ga0070678_100166993 3300005456 Bacteria 1789
71 Ga0070662_100002267 3300005457 Bacteria 11804
72 Ga0070662_100096996 3300005457 Bacteria 2225
73 Ga0070662_100289861 3300005457 Bacteria 1327
74 Ga0068867_100002937 3300005459 Bacteria 12012
75 Ga0068867_100009106 3300005459 Bacteria 7006
76 Ga0068867_100017743 3300005459 Bacteria 5052
77 Ga0068867_100074393 3300005459 Bacteria 2546
78 Ga0070684_100006427 3300005535 Bacteria 9094
79 Ga0068853_100030819 3300005539 Bacteria 4531
80 Ga0070672_100000992 3300005543 Bacteria 17158
81 Ga0070672_100001573 3300005543 Bacteria 14128
82 Ga0070672_100004340 3300005543 Bacteria 9279
83 Ga0070672_100005495 3300005543 Bacteria 8404
84 Ga0070672_100016863 3300005543 Bacteria 5239
85 Ga0070672_100091214 3300005543 Bacteria 2458
86 Ga0070686_100179098 3300005544 Bacteria 1505
87 Ga0070665_100038031 3300005548 Bacteria 4837
88 Ga0070665_100091417 3300005548 Bacteria 3048
89 Ga0068855_100063329 3300005563 Bacteria 4315
90 Ga0068855_100281679 3300005563 Bacteria 1846
91 Ga0068855_100300338 3300005563 Bacteria 1778
92 Ga0070664_100079881 3300005564 Bacteria 2816
93 Ga0068857_100015394 3300005577 Bacteria 6679
94 Ga0068857_100052013 3300005577 Bacteria 3635
95 Ga0068857_100160702 3300005577 Bacteria 2038
96 Ga0068854_100092520 3300005578 Bacteria 2253
97 Ga0068856_100212190 3300005614 Bacteria 1951
98 Ga0068852_100002398 3300005616 Bacteria 12915
99 Ga0068852_100011496 3300005616 Bacteria 6666
100 Ga0068852_100034450 3300005616 Bacteria 4213
101 Ga0068852_100081205 3300005616 Bacteria 2877
102 Ga0068852_100299733 3300005616 Bacteria 1555
103 Ga0068852_100405080 3300005616 Bacteria 1342
104 Ga0068859_100069661 3300005617 Bacteria 3552
105 Ga0068859_100365544 3300005617 Bacteria 1538
106 Ga0068864_100050563 3300005618 Bacteria 3578
107 Ga0068864_100153258 3300005618 Bacteria 2090
108 Ga0068864_100412271 3300005618 Bacteria 1286
109 Ga0068866_10001423 3300005718 Bacteria 10258
110 Ga0068861_100001280 3300005719 Bacteria 15711
111 Ga0068861_100002558 3300005719 Bacteria 11892
112 Ga0068861_100003571 3300005719 Bacteria 10350
113 Ga0068851_10014026 3300005834 Bacteria 3799
114 Ga0068851_10068709 3300005834 Bacteria 1829
115 Ga0068870_10094406 3300005840 Bacteria 1679
116 Ga0068863_100001215 3300005841 Bacteria 25740
117 Ga0068863_100015545 3300005841 Bacteria 7311
118 Ga0068863_100175446 3300005841 Bacteria 2057
119 Ga0068863_100206645 3300005841 Bacteria 1890
120 Ga0068858_100008449 3300005842 Bacteria 9898
121 Ga0068858_100018161 3300005842 Bacteria 6588
122 Ga0068858_100277314 3300005842 Bacteria 1596
123 Ga0068860_100001001 3300005843 Bacteria 31286
124 Ga0068860_100002228 3300005843 Bacteria 20406
125 Ga0068860_100016552 3300005843 Bacteria 7192
126 Ga0068862_100005383 3300005844 Bacteria 10708
127 Ga0068862_100015591 3300005844 Bacteria 6312
128 Ga0081455_10146116 3300005937 Bacteria 1829
129 Ga0075363_100047337 3300006048 Bacteria 2283
130 Ga0075364_10015538 3300006051 Bacteria 4723
131 Ga0075364_10017599 3300006051 Bacteria 4469
132 Ga0075362_10002501 3300006177 Bacteria 6184
133 Ga0075362_10027525 3300006177 Bacteria 2435
134 Ga0075362_10092231 3300006177 Bacteria 1407
135 Ga0075367_10000951 3300006178 Bacteria 11789
136 Ga0075366_10000873 3300006195 Bacteria 14560
137 Ga0075366_10001902 3300006195 Bacteria 10548
138 Ga0075366_10098890 3300006195 Bacteria 1750
139 Ga0075366_10129545 3300006195 Bacteria 1522
140 Ga0097621_100022663 3300006237 Bacteria 4877
141 Ga0097621_100059042 3300006237 Bacteria 3139
142 Ga0097621_100063152 3300006237 Bacteria 3043
143 Ga0097621_100172020 3300006237 Bacteria 1867
144 Ga0075370_10018715 3300006353 Bacteria 3760
145 Ga0068871_100167575 3300006358 Bacteria 1881
146 Ga0075428_100247845 3300006844 Unclassified 1920
147 Ga0075430_100086702 3300006846 Bacteria 2620
148 Ga0075430_100125886 3300006846 Bacteria 2136
149 Ga0075429_100389871 3300006880 Bacteria 1220
150 Ga0068865_100008657 3300006881 Bacteria 6295
151 Ga0068865_100089048 3300006881 Bacteria 2234
152 Ga0097620_100069659 3300006931 Bacteria 3552
153 Ga0097620_100365572 3300006931 Bacteria 1538
154 Ga0079104_1000095 3300006946 Bacteria 129800
155 Ga0099826_10000097 3300006948 Bacteria 41321
156 Ga0105250_10000479 3300009092 Bacteria 28089
157 Ga0105240_10026714 3300009093 Bacteria 7572
158 Ga0105245_10095483 3300009098 Bacteria 2743
159 Ga0105245_10197018 3300009098 Bacteria 1933
160 Ga0114129_10019915 3300009147 Bacteria 9549
161 Ga0105243_10010477 3300009148 Bacteria 7040
162 Ga0105241_10555747 3300009174 Bacteria 1031
163 Ga0105242_10058886 3300009176 Bacteria 3151
164 Ga0105242_10308865 3300009176 Bacteria 1446
165 Ga0105248_10029398 3300009177 Bacteria 6130
166 Ga0105248_10051792 3300009177 Bacteria 4606
167 Ga0105237_10005901 3300009545 Bacteria 13730
168 Ga0105238_10037959 3300009551 Bacteria 4895
169 Ga0105238_10052121 3300009551 Bacteria 4114
170 Ga0105249_10003739 3300009553 Bacteria 13131
171 Ga0105249_10014093 3300009553 Bacteria 7068
172 Ga0105239_10011876 3300010375 Bacteria 9717
173 Ga0105246_10070029 3300011119 Bacteria 2466
174 Ga0157369_10040614 3300013105 Bacteria 5078
175 Ga0157378_10096900 3300013297 Bacteria 2688
176 Ga0157378_10122191 3300013297 Bacteria 2402
177 Ga0163162_10007379 3300013306 Bacteria 10691
178 Ga0163162_10209672 3300013306 Bacteria 2078
179 Ga0157372_10016369 3300013307 Bacteria 7954
180 Ga0157375_10007837 3300013308 Bacteria 9348
181 Ga0157375_10024552 3300013308 Bacteria 5581
182 Ga0163163_10120764 3300014325 Bacteria 2654
183 Ga0157380_10005014 3300014326 Bacteria 9231
184 Ga0157380_10009064 3300014326 Bacteria 7109
185 Ga0157377_10000667 3300014745 Bacteria 14251
186 Ga0157379_10008414 3300014968 Bacteria 8967
187 Ga0157376_10005055 3300014969 Bacteria 9199
188 Ga0157376_10005738 3300014969 Bacteria 8694
189 Ga0157376_10008216 3300014969 Bacteria 7514
190 Ga0163161_10004347 3300017792 Bacteria 9874
191 Ga0163161_10072838 3300017792 Bacteria 2516
192 Ga0163161_10133353 3300017792 Bacteria 1875
193 Ga0213872_10000648 3300021361 Bacteria 26347
194 Ga0209435_100002 3300025206 Bacteria 794178
195 Ga0207425_1013695 3300025245 Bacteria 1864
196 Ga0209646_1000001 3300025246 Bacteria 3092932
197 Ga0209026_1000040 3300025250 Bacteria 277470
198 Ga0209759_1000001 3300025256 Bacteria 2799452
199 Ga0209565_1000016 3300025263 Bacteria 477707
200 Ga0209565_1000336 3300025263 Bacteria 41751
201 Ga0209673_1000073 3300025273 Bacteria 233645
202 Ga0209130_1000040 3300025284 Bacteria 262926
203 Ga0209130_1000210 3300025284 Bacteria 77155
204 Ga0209675_1000080 3300025291 Bacteria 154613
205 Ga0209675_1002302 3300025291 Bacteria 9905
206 Ga0209676_1000165 3300025292 Bacteria 156709
207 Ga0209025_1001656 3300025294 Bacteria 27426
208 Ga0209025_1002837 3300025294 Bacteria 17401
209 Ga0209025_1005592 3300025294 Bacteria 10160
210 Ga0209025_1010891 3300025294 Bacteria 6089
211 Ga0209564_1000165 3300025295 Bacteria 160244
212 Ga0209564_1002785 3300025295 Bacteria 13064
213 Ga0209050_1000084 3300025298 Bacteria 263245
214 Ga0209050_1001772 3300025298 Bacteria 21321
215 Ga0209256_1000110 3300025299 Bacteria 182312
216 Ga0207426_1000188 3300025302 Bacteria 153510
217 Ga0207426_1002104 3300025302 Bacteria 13705
218 Ga0209051_1000058 3300025303 Bacteria 263137
219 Ga0209257_1000092 3300025304 Bacteria 263137
220 Ga0207697_10028537 3300025315 Bacteria 2282
221 Ga0207697_10045360 3300025315 Bacteria 1809
222 Ga0207696_1000661 3300025711 Bacteria 24577
223 Ga0207682_10028970 3300025893 Bacteria 2212
224 Ga0207682_10056127 3300025893 Bacteria 1639
225 Ga0207642_10059457 3300025899 Bacteria 1768
226 Ga0207642_10083298 3300025899 Bacteria 1559
227 Ga0207680_10143355 3300025903 Bacteria 1586
228 Ga0207645_10000522 3300025907 Bacteria 31934
229 Ga0207643_10021678 3300025908 Bacteria 3533
230 Ga0207705_10083595 3300025909 Bacteria 2329
231 Ga0207657_10003562 3300025919 Bacteria 16610
232 Ga0207649_10009622 3300025920 Bacteria 5291
233 Ga0207681_10008389 3300025923 Bacteria 6317
234 Ga0207681_10091032 3300025923 Bacteria 2178
235 Ga0207681_10122088 3300025923 Bacteria 1912
236 Ga0207694_10049947 3300025924 Bacteria 3238
237 Ga0207650_10013551 3300025925 Bacteria 5648
238 Ga0207650_10015893 3300025925 Bacteria 5251
239 Ga0207650_10068263 3300025925 Bacteria 2669
240 Ga0207659_10001489 3300025926 Bacteria 13949
241 Ga0207659_10052187 3300025926 Bacteria 2912
242 Ga0207687_10186297 3300025927 Bacteria 1612
243 Ga0207687_10263009 3300025927 Bacteria 1376
244 Ga0207644_10000466 3300025931 Bacteria 26232
245 Ga0207644_10036252 3300025931 Bacteria 3461
246 Ga0207644_10166204 3300025931 Bacteria 1719
247 Ga0207644_10325828 3300025931 Bacteria 1243
248 Ga0207690_10016568 3300025932 Bacteria 4487
249 Ga0207706_10004369 3300025933 Bacteria 13281
250 Ga0207706_10077613 3300025933 Bacteria 2921
251 Ga0207706_10119337 3300025933 Bacteria 2319
252 Ga0207706_10302836 3300025933 Bacteria 1392
253 Ga0207686_10277998 3300025934 Bacteria 1235
254 Ga0207709_10000186 3300025935 Bacteria 83013
255 Ga0207709_10036876 3300025935 Bacteria 2901
256 Ga0207709_10043246 3300025935 Bacteria 2714
257 Ga0207709_10045810 3300025935 Bacteria 2651
258 Ga0207669_10010215 3300025937 Bacteria 4511
259 Ga0207704_10000478 3300025938 Bacteria 17814
260 Ga0207691_10000238 3300025940 Bacteria 53833
261 Ga0207691_10006870 3300025940 Bacteria 10981
262 Ga0207691_10007224 3300025940 Bacteria 10713
263 Ga0207691_10009260 3300025940 Bacteria 9451
264 Ga0207691_10009267 3300025940 Bacteria 9444
265 Ga0207691_10165847 3300025940 Bacteria 1936
266 Ga0207691_10180761 3300025940 Bacteria 1843
267 Ga0207711_10024252 3300025941 Bacteria 5078
268 Ga0207689_10000393 3300025942 Bacteria 41140
269 Ga0207689_10002255 3300025942 Bacteria 18068
270 Ga0207689_10008356 3300025942 Bacteria 9013
271 Ga0207689_10095641 3300025942 Bacteria 2440
272 Ga0207661_10008899 3300025944 Bacteria 7188
273 Ga0207667_10215667 3300025949 Bacteria 1967
274 Ga0207651_10034152 3300025960 Bacteria 3290
275 Ga0207651_10035126 3300025960 Bacteria 3255
276 Ga0207651_10186111 3300025960 Bacteria 1652
277 Ga0207651_10273398 3300025960 Bacteria 1392
278 Ga0207658_10002981 3300025986 Bacteria 12105
279 Ga0207658_10059319 3300025986 Bacteria 2851
280 Ga0207658_10083051 3300025986 Bacteria 2461
281 Ga0207677_10009028 3300026023 Bacteria 5594
282 Ga0207677_10018512 3300026023 Bacteria 4181
283 Ga0207677_10189893 3300026023 Bacteria 1624
284 Ga0207703_10065515 3300026035 Bacteria 2986
285 Ga0207703_10137465 3300026035 Bacteria 2117
286 Ga0207678_10015576 3300026067 Bacteria 6685
287 Ga0207678_10056716 3300026067 Bacteria 3372
288 Ga0207708_10012900 3300026075 Bacteria 6231
289 Ga0207702_10344379 3300026078 Bacteria 1425
290 Ga0207641_10003675 3300026088 Bacteria 13509
291 Ga0207641_10027120 3300026088 Bacteria 4730
292 Ga0207641_10092317 3300026088 Bacteria 2651
293 Ga0207641_10203992 3300026088 Bacteria 1825
294 Ga0207648_10000432 3300026089 Bacteria 46265
295 Ga0207648_10006190 3300026089 Bacteria 11916
296 Ga0207648_10019114 3300026089 Bacteria 6182
297 Ga0207648_10094573 3300026089 Bacteria 2613
298 Ga0207676_10030489 3300026095 Bacteria 4049
299 Ga0207676_10158120 3300026095 Bacteria 1960
300 Ga0207676_10247005 3300026095 Bacteria 1604
301 Ga0207676_10396658 3300026095 Bacteria 1288
302 Ga0207674_10017057 3300026116 Bacteria 7926
303 Ga0207674_10063257 3300026116 Bacteria 3735
304 Ga0207674_10113128 3300026116 Bacteria 2687
305 Ga0207674_10182845 3300026116 Bacteria 2047
306 Ga0207675_100002706 3300026118 Bacteria 17462
307 Ga0207675_100002790 3300026118 Bacteria 17167
308 Ga0207675_100598664 3300026118 Bacteria 1105
309 Ga0207683_10001562 3300026121 Bacteria 20610
310 Ga0207683_10008607 3300026121 Bacteria 8730
311 Ga0207683_10036202 3300026121 Bacteria 4296
312 Ga0207683_10120477 3300026121 Bacteria 2355
313 Ga0207683_10151938 3300026121 Bacteria 2090
314 Ga0207698_10231011 3300026142 Bacteria 1679
315 Ga0207698_10262305 3300026142 Bacteria 1588
316 Ga0209281_1000002 3300027111 Bacteria 1924012
317 Ga0209282_1000295 3300027666 Bacteria 24592
318 Ga0209974_10011220 3300027876 Bacteria 3016
319 Ga0268266_10046246 3300028379 Bacteria 3726
320 Ga0268266_10051532 3300028379 Bacteria 3533
321 Ga0268265_10006247 3300028380 Bacteria 8072
322 Ga0268265_10027073 3300028380 Bacteria 4087
323 Ga0268265_10322515 3300028380 Bacteria 1400
324 Ga0268264_10002889 3300028381 Bacteria 14945
325 Ga0268264_10003826 3300028381 Bacteria 12902
326 Ga0268264_10345674 3300028381 Bacteria 1414
327 Ga0307515_10006232 3300028794 Bacteria 23953
328 Ga0307515_10169117 3300028794 Bacteria 2188
329 Ga0307515_10228706 3300028794 Bacteria 1658
330 Ga0307515_10266068 3300028794 Bacteria 1443
331 Ga0307515_10270896 3300028794 Bacteria 1419
332 Ga0265327_10000049 3300031251 Bacteria 268046
333 Ga0307513_10000066 3300031456 Bacteria 141617
334 Ga0307513_10002919 3300031456 Bacteria 23376
335 Ga0307513_10009567 3300031456 Bacteria 12244
336 Ga0307513_10033659 3300031456 Bacteria 5758
337 Ga0307513_10068314 3300031456 Bacteria 3723
338 Ga0307513_10102261 3300031456 Bacteria 2885
339 Ga0307509_10026592 3300031507 Bacteria 6448
340 Ga0307408_100116920 3300031548 Bacteria 2059
341 Ga0307514_10002224 3300031649 Bacteria 20708
342 Ga0307516_10000689 3300031730 Bacteria 45886
343 Ga0307516_10195276 3300031730 Bacteria 1747
344 Ga0307516_10256966 3300031730 Bacteria 1439
345 Ga0307406_10018188 3300031901 Bacteria 4101
346 Ga0307416_100017439 3300032002 Bacteria 5026
347 Ga0307414_10003801 3300032004 Bacteria 8116
348 Ga0307415_100006789 3300032126 Bacteria 6209
349 Ga0307510_10208294 3300033180 Bacteria 1481
350 Ga0373957_0072949 3300035120 Bacteria 1345
351 Ga0373943_0101282 3300035170 Bacteria 1507
352 Ga0373931_0000504 3300035691 Bacteria 15954
353 Ga0373935_0229245 3300035692 Bacteria 1293
354 Ga0373937_0134607 3300036401 Bacteria 2310
355 Ga0436361_1179952 3300039447 Bacteria 34821
356 Ga0439433_0035824 3300041999 Bacteria 1145
357 Ga0451577_0011750 3300042876 Bacteria 8265
358 Ga0451577_0285469 3300042876 Bacteria 1495
359 Ga0451577_0387762 3300042876 Bacteria 1268
360 Ga0466966_0071160 3300044684 Bacteria 2179
361 Ga0466961_0007027 3300044693 Bacteria 7162
362 Ga0466960_0095322 3300044901 Bacteria 1524
363 Ga0451576_0055690 3300045051 Bacteria 4136
364 Ga0451576_0153294 3300045051 Bacteria 2403
365 Ga0495629_0013373 3300046459 Bacteria 5922
366 Ga0495596_0000011 3300046500 Bacteria 129089
367 Ga0495583_0036364 3300046506 Bacteria 2344
368 Ga0495632_0099983 3300046519 Bacteria 1367
369 Ga0495666_0041721 3300046526 Bacteria 2221
370 Ga0495598_0008601 3300046537 Bacteria 2384
371 Ga0495609_0000754 3300046538 Bacteria 24406
372 Ga0495621_0001506 3300046539 Bacteria 6044
373 Ga0495645_0085088 3300046543 Bacteria 2264
374 Ga0495633_0000959 3300046558 Bacteria 23887
375 Ga0495668_0065734 3300046616 Bacteria 1996
376 Ga0495625_0077875 3300046660 Bacteria 2315
377 Ga0495658_0103222 3300046683 Bacteria 1705
378 Ga0495671_0000326 3300046692 Bacteria 39898
379 Ga0495671_0110099 3300046692 Bacteria 1345
380 Ga0495676_0034475 3300047321 Bacteria 4247
381 Ga0495680_0308665 3300047322 Bacteria 1109
382 Ga0495687_000548 3300047443 Bacteria 44802
383 Ga0495687_004851 3300047443 Bacteria 8838
384 Ga0495686_0002956 3300047472 Bacteria 15188
385 Ga0496101_0070423 3300048904 Bacteria 2561
386 Ga0496102_0112752 3300048905 Bacteria 2536
387 Ga0496104_0028300 3300048907 Bacteria 5195
388 Ga0496104_0044372 3300048907 Bacteria 4177
389 Ga0496108_0105743 3300048911 Bacteria 2403
390 Ga0496108_0211866 3300048911 Bacteria 1682
391 Ga0496108_0468759 3300048911 Bacteria 1100
392 Ga0496109_0112302 3300048912 Bacteria 2534
393 Ga0496110_0006940 3300048913 Bacteria 9007
394 Ga0496112_0030008 3300048915 Bacteria 5261
395 Ga0496113_0063150 3300048916 Bacteria 2799
396 Ga0496114_0054474 3300048917 Bacteria 3335
397 Ga0496115_0018868 3300048918 Bacteria 5303
398 Ga0496122_0021978 3300048925 Bacteria 5686
399 Ga0496123_0012770 3300048926 Bacteria 7122
400 Ga0496123_0038314 3300048926 Bacteria 3371
401 Ga0496124_0116246 3300048927 Bacteria 2145
402 Ga0496125_0009307 3300048928 Bacteria 10132
403 Ga0496126_0033237 3300048929 Bacteria 4853
404 Ga0501043_0000020 3300049579 Bacteria 155270
405 Ga0501046_0000039 3300049580 Bacteria 155237
406 Ga0501047_0000028 3300049581 Bacteria 220279
407 Ga0501071_0047767 3300049587 Bacteria 3075
408 Ga0501258_006730 3300049687 Bacteria 1149
409 Ga0501045_0003924 3300049824 Bacteria 10247
410 nmdc:mga03683_29757_c1 3300050489 Bacteria 2180
411 nmdc:mga0k408_21229_c1 3300050493 Bacteria 3646
412 nmdc:mga0k408_29506_c1 3300050493 Bacteria 3123
413 nmdc:mga0k408_49575_c1 3300050493 Bacteria 2431
414 nmdc:mga0k408_556_c1 3300050493 Bacteria 16497
415 nmdc:mga07m45_4747_c1 3300050496 Bacteria 6678
416 nmdc:mga07m45_81642_c1 3300050496 Bacteria 1846
417 nmdc:mga09592_267644_c1 3300050508 Bacteria 1482
418 nmdc:mga0qj67_115370_c1 3300050509 Bacteria 2170
419 nmdc:mga0qj67_178886_c1 3300050509 Bacteria 1723
420 nmdc:mga0sz30_15408_c1 3300050516 Bacteria 3021
421 Ga0495601_0230503 3300053077 Bacteria 1210
422 Ga0500562_005463 3300053108 Bacteria 3189
423 Ga0500593_000358 3300053117 Bacteria 18456
424 Ga0500568_0080460 3300053139 Bacteria 1237
425 Ga0500586_022335 3300053145 Bacteria 2006
426 Ga0500645_000533 3300053730 Bacteria 25443
427 Ga0500645_024091 3300053730 Bacteria 1862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0285469 Ga0451577_0285469_73_1047 283
2 3300009177 Ga0105248_10029398 Ga0105248_100293983 287
3 3300048907 Ga0496104_0028300 Ga0496104_0028300_2902_3870 287
4 3300046558 Ga0495633_0000959 Ga0495633_0000959_10827_11798 289
5 3300053108 Ga0500562_005463 Ga0500562_005463_193_1161 295
6 3300048911 Ga0496108_0468759 Ga0496108_0468759_37_1005 300
7 3300048915 Ga0496112_0030008 Ga0496112_0030008_2760_3728 300
8 3300006948 Ga0099826_10000097 Ga0099826_1000009713 303
9 3300027666 Ga0209282_1000295 Ga0209282_100029513 303
10 3300046500 Ga0495596_0000011 Ga0495596_0000011_33750_34715 303
11 3300046538 Ga0495609_0000754 Ga0495609_0000754_7396_8361 303
12 3300046692 Ga0495671_0000326 Ga0495671_0000326_5763_6728 303
13 3300046537 Ga0495598_0008601 Ga0495598_0008601_1076_2056 304
14 3300005367 Ga0070667_100062053 Ga0070667_1000620532 307
15 3300005617 Ga0068859_100365544 Ga0068859_1003655442 307
16 3300006931 Ga0097620_100365572 Ga0097620_1003655722 307
17 3300025986 Ga0207658_10083051 Ga0207658_100830513 307
18 3300031507 Ga0307509_10026592 Ga0307509_100265923 307
19 3300028794 Ga0307515_10228706 Ga0307515_102287063 308
20 3300005334 Ga0068869_100039531 Ga0068869_1000395314 309
21 3300005457 Ga0070662_100096996 Ga0070662_1000969963 309
22 3300005578 Ga0068854_100092520 Ga0068854_1000925202 309
23 3300006051 Ga0075364_10015538 Ga0075364_100155383 309
24 3300006177 Ga0075362_10002501 Ga0075362_100025019 309
25 3300013105 Ga0157369_10040614 Ga0157369_100406142 309
26 3300025933 Ga0207706_10119337 Ga0207706_101193372 309
27 3300050493 nmdc:mga0k408_49575_c1 nmdc:mga0k408_49575_c1_814_1803 309
28 3300005331 Ga0070670_100014961 Ga0070670_1000149615 310
29 3300005354 Ga0070675_100006975 Ga0070675_1000069753 310
30 3300005356 Ga0070674_100058869 Ga0070674_1000588693 310
31 3300005364 Ga0070673_100004089 Ga0070673_1000040892 310
32 3300005459 Ga0068867_100009106 Ga0068867_1000091062 310
33 3300005543 Ga0070672_100000992 Ga0070672_1000009923 310
34 3300006237 Ga0097621_100022663 Ga0097621_1000226632 310
35 3300017792 Ga0163161_10072838 Ga0163161_100728383 310
36 3300025315 Ga0207697_10045360 Ga0207697_100453603 310
37 3300025893 Ga0207682_10028970 Ga0207682_100289701 310
38 3300025940 Ga0207691_10000238 Ga0207691_100002388 310
39 3300025960 Ga0207651_10273398 Ga0207651_102733981 310
40 3300026088 Ga0207641_10203992 Ga0207641_102039922 310
41 3300026095 Ga0207676_10158120 Ga0207676_101581202 310
42 3300026118 Ga0207675_100598664 Ga0207675_1005986641 310
43 3300026121 Ga0207683_10001562 Ga0207683_100015628 310
44 3300026142 Ga0207698_10231011 Ga0207698_102310111 310
45 3300005334 Ga0068869_100050695 Ga0068869_1000506952 312
46 3300025933 Ga0207706_10077613 Ga0207706_100776133 313
47 3300047472 Ga0495686_0002956 Ga0495686_0002956_11375_12352 313
48 3300050516 nmdc:mga0sz30_15408_c1 nmdc:mga0sz30_15408_c1_1501_2448 313
49 3300047322 Ga0495680_0308665 Ga0495680_0308665_21_968 314
50 3300048907 Ga0496104_0044372 Ga0496104_0044372_1180_2163 314
51 3300048917 Ga0496114_0054474 Ga0496114_0054474_2156_3139 314
52 3300028794 Ga0307515_10266068 Ga0307515_102660681 315
53 3300053117 Ga0500593_000358 Ga0500593_000358_4881_5828 315
54 3300005356 Ga0070674_100124043 Ga0070674_1001240432 316
55 3300005456 Ga0070678_100036606 Ga0070678_1000366062 316
56 3300006048 Ga0075363_100047337 Ga0075363_1000473373 316
57 3300006051 Ga0075364_10017599 Ga0075364_100175995 316
58 3300006178 Ga0075367_10000951 Ga0075367_100009515 316
59 3300025940 Ga0207691_10180761 Ga0207691_101807612 316
60 3300026121 Ga0207683_10120477 Ga0207683_101204772 316
61 3300050493 nmdc:mga0k408_29506_c1 nmdc:mga0k408_29506_c1_1336_2289 316
62 3300050496 nmdc:mga07m45_4747_c1 nmdc:mga07m45_4747_c1_4328_5281 316
63 3300006946 Ga0079104_1000095 Ga0079104_100009518 317
64 3300009092 Ga0105250_10000479 Ga0105250_1000047911 317
65 3300025711 Ga0207696_1000661 Ga0207696_100066122 317
66 3300025935 Ga0207709_10000186 Ga0207709_1000018661 317
67 3300027111 Ga0209281_1000002 Ga0209281_100000261 317
68 iso_pu_bacteria 2643221654 2644302515 317
69 3300005353 Ga0070669_100014437 Ga0070669_1000144373 318
70 3300005364 Ga0070673_100118320 Ga0070673_1001183203 318
71 3300005456 Ga0070678_100019934 Ga0070678_1000199344 318
72 3300025923 Ga0207681_10091032 Ga0207681_100910323 318
73 3300025960 Ga0207651_10186111 Ga0207651_101861113 318
74 3300026089 Ga0207648_10094573 Ga0207648_100945732 318
75 3300026121 Ga0207683_10151938 Ga0207683_101519383 318
76 3300032002 Ga0307416_100017439 Ga0307416_1000174395 318
77 3300032126 Ga0307415_100006789 Ga0307415_1000067895 318
78 3300046539 Ga0495621_0001506 Ga0495621_0001506_3075_4055 318
79 3300050493 nmdc:mga0k408_21229_c1 nmdc:mga0k408_21229_c1_173_1174 318
80 3300005354 Ga0070675_100029340 Ga0070675_1000293404 319
81 3300006844 Ga0075428_100247845 Ga0075428_1002478452 319
82 3300006846 Ga0075430_100086702 Ga0075430_1000867022 319
83 3300006880 Ga0075429_100389871 Ga0075429_1003898711 319
84 3300044901 Ga0466960_0095322 Ga0466960_0095322_183_1163 319
85 iso_pu_bacteria 2894023352 2894025471 319
86 3300005456 Ga0070678_100166993 Ga0070678_1001669933 320
87 3300005937 Ga0081455_10146116 Ga0081455_101461163 320
88 3300009147 Ga0114129_10019915 Ga0114129_100199154 320
89 3300026118 Ga0207675_100002706 Ga0207675_10000270620 320
90 3300028794 Ga0307515_10006232 Ga0307515_1000623213 320
91 3300031251 Ga0265327_10000049 Ga0265327_10000049163 320
92 3300031548 Ga0307408_100116920 Ga0307408_1001169201 320
93 3300047443 Ga0495687_004851 Ga0495687_004851_2675_3643 320
94 3300050509 nmdc:mga0qj67_178886_c1 nmdc:mga0qj67_178886_c1_696_1667 320
95 3300005334 Ga0068869_100093638 Ga0068869_1000936382 321
96 3300005353 Ga0070669_100024776 Ga0070669_1000247765 321
97 3300005459 Ga0068867_100074393 Ga0068867_1000743932 321
98 3300005543 Ga0070672_100091214 Ga0070672_1000912142 321
99 3300005563 Ga0068855_100300338 Ga0068855_1003003382 321
100 3300005719 Ga0068861_100002558 Ga0068861_1000025585 321
101 3300005842 Ga0068858_100277314 Ga0068858_1002773142 321
102 3300005843 Ga0068860_100002228 Ga0068860_1000022282 321
103 3300005844 Ga0068862_100015591 Ga0068862_1000155912 321
104 3300006846 Ga0075430_100125886 Ga0075430_1001258862 321
105 3300006881 Ga0068865_100008657 Ga0068865_1000086573 321
106 3300009174 Ga0105241_10555747 Ga0105241_105557471 321
107 3300009553 Ga0105249_10014093 Ga0105249_100140939 321
108 3300013297 Ga0157378_10096900 Ga0157378_100969002 321
109 3300013306 Ga0163162_10209672 Ga0163162_102096723 321
110 3300017792 Ga0163161_10133353 Ga0163161_101333532 321
111 3300025899 Ga0207642_10059457 Ga0207642_100594572 321
112 3300025923 Ga0207681_10122088 Ga0207681_101220882 321
113 3300026035 Ga0207703_10137465 Ga0207703_101374652 321
114 3300026089 Ga0207648_10000432 Ga0207648_1000043244 321
115 3300026116 Ga0207674_10182845 Ga0207674_101828453 321
116 3300028380 Ga0268265_10027073 Ga0268265_100270735 321
117 3300028381 Ga0268264_10345674 Ga0268264_103456742 321
118 3300041999 Ga0439433_0035824 Ga0439433_0035824_153_1124 321
119 3300042876 Ga0451577_0011750 Ga0451577_0011750_7277_8251 321
120 3300044684 Ga0466966_0071160 Ga0466966_0071160_76_1053 321
121 3300044693 Ga0466961_0007027 Ga0466961_0007027_2736_3713 321
122 3300045051 Ga0451576_0153294 Ga0451576_0153294_264_1238 321
123 3300050508 nmdc:mga09592_267644_c1 nmdc:mga09592_267644_c1_418_1389 321
124 3300050509 nmdc:mga0qj67_115370_c1 nmdc:mga0qj67_115370_c1_716_1690 321
125 iso_pu_bacteria 2721755523 2722886460 321
126 iso_pu_bacteria 2928115317 2928117676 321
127 3300005289 Ga0065704_10085452 Ga0065704_100854523 322
128 3300005548 Ga0070665_100091417 Ga0070665_1000914173 322
129 3300005563 Ga0068855_100281679 Ga0068855_1002816793 322
130 3300014969 Ga0157376_10008216 Ga0157376_100082164 322
131 3300025927 Ga0207687_10263009 Ga0207687_102630092 322
132 3300025942 Ga0207689_10095641 Ga0207689_100956412 322
133 3300025949 Ga0207667_10215667 Ga0207667_102156673 322
134 3300028379 Ga0268266_10051532 Ga0268266_100515322 322
135 3300048925 Ga0496122_0021978 Ga0496122_0021978_1019_2017 322
136 3300048926 Ga0496123_0038314 Ga0496123_0038314_199_1197 322
137 3300006195 Ga0075366_10098890 Ga0075366_100988903 323
138 3300042876 Ga0451577_0387762 Ga0451577_0387762_233_1252 323
139 3300048927 Ga0496124_0116246 Ga0496124_0116246_850_1830 323
140 3300005328 Ga0070676_10001200 Ga0070676_100012008 324
141 3300005334 Ga0068869_100008919 Ga0068869_1000089193 324
142 3300005335 Ga0070666_10012809 Ga0070666_100128094 324
143 3300005338 Ga0068868_100035696 Ga0068868_1000356964 324
144 3300005343 Ga0070687_100012070 Ga0070687_1000120703 324
145 3300005347 Ga0070668_100009867 Ga0070668_1000098673 324
146 3300005353 Ga0070669_100014655 Ga0070669_1000146552 324
147 3300005354 Ga0070675_100012061 Ga0070675_1000120613 324
148 3300005356 Ga0070674_100001581 Ga0070674_1000015816 324
149 3300005364 Ga0070673_100355201 Ga0070673_1003552011 324
150 3300005367 Ga0070667_100003754 Ga0070667_1000037545 324
151 3300005438 Ga0070701_10136666 Ga0070701_101366662 324
152 3300005441 Ga0070700_100054377 Ga0070700_1000543772 324
153 3300005456 Ga0070678_100082016 Ga0070678_1000820163 324
154 3300005457 Ga0070662_100002267 Ga0070662_1000022676 324
155 3300005459 Ga0068867_100002937 Ga0068867_1000029373 324
156 3300005543 Ga0070672_100005495 Ga0070672_1000054952 324
157 3300005544 Ga0070686_100179098 Ga0070686_1001790982 324
158 3300005617 Ga0068859_100069661 Ga0068859_1000696613 324
159 3300005718 Ga0068866_10001423 Ga0068866_100014232 324
160 3300005719 Ga0068861_100001280 Ga0068861_10000128011 324
161 3300005841 Ga0068863_100001215 Ga0068863_10000121523 324
162 3300005842 Ga0068858_100018161 Ga0068858_1000181615 324
163 3300005843 Ga0068860_100001001 Ga0068860_10000100121 324
164 3300005844 Ga0068862_100005383 Ga0068862_1000053832 324
165 3300006195 Ga0075366_10000873 Ga0075366_1000087310 324
166 3300006881 Ga0068865_100089048 Ga0068865_1000890482 324
167 3300006931 Ga0097620_100069659 Ga0097620_1000696593 324
168 3300009098 Ga0105245_10197018 Ga0105245_101970183 324
169 3300009148 Ga0105243_10010477 Ga0105243_100104776 324
170 3300009176 Ga0105242_10308865 Ga0105242_103088652 324
171 3300009177 Ga0105248_10051792 Ga0105248_100517923 324
172 3300009553 Ga0105249_10003739 Ga0105249_100037393 324
173 3300013306 Ga0163162_10007379 Ga0163162_100073794 324
174 3300013308 Ga0157375_10024552 Ga0157375_100245524 324
175 3300014326 Ga0157380_10009064 Ga0157380_100090645 324
176 3300014968 Ga0157379_10008414 Ga0157379_100084143 324
177 3300017792 Ga0163161_10004347 Ga0163161_100043473 324
178 3300021361 Ga0213872_10000648 Ga0213872_100006485 324
179 3300025899 Ga0207642_10083298 Ga0207642_100832982 324
180 3300025907 Ga0207645_10000522 Ga0207645_1000052221 324
181 3300025923 Ga0207681_10008389 Ga0207681_100083894 324
182 3300025927 Ga0207687_10186297 Ga0207687_101862972 324
183 3300025933 Ga0207706_10004369 Ga0207706_100043698 324
184 3300025934 Ga0207686_10277998 Ga0207686_102779982 324
185 3300025935 Ga0207709_10036876 Ga0207709_100368763 324
186 3300025937 Ga0207669_10010215 Ga0207669_100102154 324
187 3300025938 Ga0207704_10000478 Ga0207704_1000047812 324
188 3300025940 Ga0207691_10009260 Ga0207691_100092603 324
189 3300025941 Ga0207711_10024252 Ga0207711_100242523 324
190 3300025942 Ga0207689_10002255 Ga0207689_1000225520 324
191 3300025986 Ga0207658_10002981 Ga0207658_100029812 324
192 3300026035 Ga0207703_10065515 Ga0207703_100655153 324
193 3300026075 Ga0207708_10012900 Ga0207708_100129004 324
194 3300026088 Ga0207641_10003675 Ga0207641_100036755 324
195 3300026089 Ga0207648_10006190 Ga0207648_1000619010 324
196 3300026095 Ga0207676_10247005 Ga0207676_102470052 324
197 3300026118 Ga0207675_100002790 Ga0207675_1000027908 324
198 3300027876 Ga0209974_10011220 Ga0209974_100112202 324
199 3300028380 Ga0268265_10006247 Ga0268265_100062473 324
200 3300028381 Ga0268264_10002889 Ga0268264_100028899 324
201 3300039447 Ga0436361_1179952 Ga0436361_1179952_29375_30352 324
202 3300050493 nmdc:mga0k408_556_c1 nmdc:mga0k408_556_c1_14752_15729 324
203 3300028380 Ga0268265_10322515 Ga0268265_103225152 325
204 3300005535 Ga0070684_100006427 Ga0070684_1000064275 326
205 3300005564 Ga0070664_100079881 Ga0070664_1000798813 326
206 3300005577 Ga0068857_100160702 Ga0068857_1001607022 326
207 3300005614 Ga0068856_100212190 Ga0068856_1002121902 326
208 3300005616 Ga0068852_100002398 Ga0068852_1000023984 326
209 3300005834 Ga0068851_10014026 Ga0068851_100140263 326
210 3300005841 Ga0068863_100175446 Ga0068863_1001754462 326
211 3300009551 Ga0105238_10037959 Ga0105238_100379594 326
212 3300013307 Ga0157372_10016369 Ga0157372_100163695 326
213 3300025920 Ga0207649_10009622 Ga0207649_100096225 326
214 3300025924 Ga0207694_10049947 Ga0207694_100499472 326
215 3300025932 Ga0207690_10016568 Ga0207690_100165684 326
216 3300025944 Ga0207661_10008899 Ga0207661_100088994 326
217 3300026116 Ga0207674_10113128 Ga0207674_101131282 326
218 3300031456 Ga0307513_10009567 Ga0307513_100095678 326
219 3300031456 Ga0307513_10033659 Ga0307513_100336593 326
220 3300031456 Ga0307513_10068314 Ga0307513_100683144 326
221 3300046526 Ga0495666_0041721 Ga0495666_0041721_321_1310 326
222 3300047321 Ga0495676_0034475 Ga0495676_0034475_2587_3576 326
223 3300053139 Ga0500568_0080460 Ga0500568_0080460_186_1172 326
224 3300053145 Ga0500586_022335 Ga0500586_022335_524_1510 326
225 3300005327 Ga0070658_10058310 Ga0070658_100583102 327
226 3300005329 Ga0070683_100070006 Ga0070683_1000700063 327
227 3300005331 Ga0070670_100016883 Ga0070670_1000168832 327
228 3300005334 Ga0068869_100096408 Ga0068869_1000964082 327
229 3300005339 Ga0070660_100020129 Ga0070660_1000201292 327
230 3300005354 Ga0070675_100002601 Ga0070675_1000026013 327
231 3300005354 Ga0070675_100006604 Ga0070675_1000066042 327
232 3300005355 Ga0070671_100175690 Ga0070671_1001756902 327
233 3300005364 Ga0070673_100005182 Ga0070673_1000051823 327
234 3300005366 Ga0070659_100096019 Ga0070659_1000960193 327
235 3300005455 Ga0070663_100094309 Ga0070663_1000943092 327
236 3300005456 Ga0070678_100004125 Ga0070678_1000041256 327
237 3300005539 Ga0068853_100030819 Ga0068853_1000308192 327
238 3300005543 Ga0070672_100001573 Ga0070672_10000157313 327
239 3300005543 Ga0070672_100016863 Ga0070672_1000168635 327
240 3300005563 Ga0068855_100063329 Ga0068855_1000633292 327
241 3300005616 Ga0068852_100081205 Ga0068852_1000812052 327
242 3300005618 Ga0068864_100050563 Ga0068864_1000505632 327
243 3300005719 Ga0068861_100003571 Ga0068861_1000035714 327
244 3300005834 Ga0068851_10068709 Ga0068851_100687092 327
245 3300005841 Ga0068863_100206645 Ga0068863_1002066451 327
246 3300005842 Ga0068858_100008449 Ga0068858_1000084493 327
247 3300005843 Ga0068860_100016552 Ga0068860_1000165522 327
248 3300006237 Ga0097621_100059042 Ga0097621_1000590422 327
249 3300006237 Ga0097621_100063152 Ga0097621_1000631524 327
250 3300006237 Ga0097621_100172020 Ga0097621_1001720203 327
251 3300009551 Ga0105238_10052121 Ga0105238_100521212 327
252 3300014326 Ga0157380_10005014 Ga0157380_100050146 327
253 3300014745 Ga0157377_10000667 Ga0157377_100006673 327
254 3300014969 Ga0157376_10005055 Ga0157376_100050552 327
255 3300014969 Ga0157376_10005738 Ga0157376_100057385 327
256 3300025315 Ga0207697_10028537 Ga0207697_100285372 327
257 3300025893 Ga0207682_10056127 Ga0207682_100561271 327
258 3300025903 Ga0207680_10143355 Ga0207680_101433552 327
259 3300025909 Ga0207705_10083595 Ga0207705_100835952 327
260 3300025919 Ga0207657_10003562 Ga0207657_100035622 327
261 3300025925 Ga0207650_10015893 Ga0207650_100158932 327
262 3300025925 Ga0207650_10068263 Ga0207650_100682631 327
263 3300025926 Ga0207659_10001489 Ga0207659_100014898 327
264 3300025931 Ga0207644_10166204 Ga0207644_101662042 327
265 3300025935 Ga0207709_10045810 Ga0207709_100458103 327
266 3300025940 Ga0207691_10007224 Ga0207691_100072247 327
267 3300025940 Ga0207691_10009267 Ga0207691_1000926711 327
268 3300025942 Ga0207689_10000393 Ga0207689_1000039330 327
269 3300025960 Ga0207651_10035126 Ga0207651_100351262 327
270 3300026023 Ga0207677_10009028 Ga0207677_100090286 327
271 3300026067 Ga0207678_10015576 Ga0207678_100155765 327
272 3300026088 Ga0207641_10092317 Ga0207641_100923171 327
273 3300026095 Ga0207676_10030489 Ga0207676_100304892 327
274 3300026121 Ga0207683_10008607 Ga0207683_100086072 327
275 3300026142 Ga0207698_10262305 Ga0207698_102623052 327
276 3300028381 Ga0268264_10003826 Ga0268264_100038265 327
277 3300028794 Ga0307515_10169117 Ga0307515_101691172 327
278 3300028794 Ga0307515_10270896 Ga0307515_102708961 327
279 3300031456 Ga0307513_10000066 Ga0307513_10000066121 327
280 3300031456 Ga0307513_10002919 Ga0307513_100029197 327
281 3300031649 Ga0307514_10002224 Ga0307514_100022244 327
282 3300031730 Ga0307516_10000689 Ga0307516_1000068914 327
283 3300031730 Ga0307516_10195276 Ga0307516_101952763 327
284 3300031730 Ga0307516_10256966 Ga0307516_102569661 327
285 3300032004 Ga0307414_10003801 Ga0307414_100038015 327
286 3300033180 Ga0307510_10208294 Ga0307510_102082942 327
287 3300035120 Ga0373957_0072949 Ga0373957_0072949_32_1027 327
288 3300035170 Ga0373943_0101282 Ga0373943_0101282_299_1294 327
289 3300035691 Ga0373931_0000504 Ga0373931_0000504_14154_15152 327
290 3300035692 Ga0373935_0229245 Ga0373935_0229245_98_1093 327
291 3300036401 Ga0373937_0134607 Ga0373937_0134607_1286_2281 327
292 3300045051 Ga0451576_0055690 Ga0451576_0055690_1441_2436 327
293 3300046459 Ga0495629_0013373 Ga0495629_0013373_118_1113 327
294 3300046543 Ga0495645_0085088 Ga0495645_0085088_803_1798 327
295 3300046683 Ga0495658_0103222 Ga0495658_0103222_50_1045 327
296 3300048904 Ga0496101_0070423 Ga0496101_0070423_1014_2012 327
297 3300048905 Ga0496102_0112752 Ga0496102_0112752_1255_2253 327
298 3300048911 Ga0496108_0105743 Ga0496108_0105743_482_1480 327
299 3300048911 Ga0496108_0211866 Ga0496108_0211866_483_1478 327
300 3300048912 Ga0496109_0112302 Ga0496109_0112302_1491_2489 327
301 3300048913 Ga0496110_0006940 Ga0496110_0006940_7905_8903 327
302 3300048916 Ga0496113_0063150 Ga0496113_0063150_1163_2161 327
303 3300048918 Ga0496115_0018868 Ga0496115_0018868_3464_4462 327
304 3300048929 Ga0496126_0033237 Ga0496126_0033237_3453_4448 327
305 3300049687 Ga0501258_006730 Ga0501258_006730_112_1098 327
306 3300053730 Ga0500645_000533 Ga0500645_000533_4328_5311 327
307 iso_pu_bacteria 2511231002 2511242478 327
308 iso_pu_bacteria 2834641062 2834644262 327
309 3300005328 Ga0070676_10001498 Ga0070676_100014984 328
310 3300005354 Ga0070675_100046367 Ga0070675_1000463673 328
311 3300005355 Ga0070671_100043122 Ga0070671_1000431222 328
312 3300005364 Ga0070673_100054562 Ga0070673_1000545622 328
313 3300005366 Ga0070659_100157926 Ga0070659_1001579262 328
314 3300005367 Ga0070667_100066958 Ga0070667_1000669582 328
315 3300005457 Ga0070662_100289861 Ga0070662_1002898611 328
316 3300005459 Ga0068867_100017743 Ga0068867_1000177434 328
317 3300005543 Ga0070672_100004340 Ga0070672_1000043402 328
318 3300005577 Ga0068857_100015394 Ga0068857_1000153945 328
319 3300005577 Ga0068857_100052013 Ga0068857_1000520133 328
320 3300005616 Ga0068852_100011496 Ga0068852_1000114963 328
321 3300005616 Ga0068852_100034450 Ga0068852_1000344502 328
322 3300005616 Ga0068852_100405080 Ga0068852_1004050802 328
323 3300005840 Ga0068870_10094406 Ga0068870_100944062 328
324 3300006195 Ga0075366_10001902 Ga0075366_100019022 328
325 3300006195 Ga0075366_10129545 Ga0075366_101295453 328
326 3300006353 Ga0075370_10018715 Ga0075370_100187153 328
327 3300009093 Ga0105240_10026714 Ga0105240_100267147 328
328 3300009098 Ga0105245_10095483 Ga0105245_100954833 328
329 3300009545 Ga0105237_10005901 Ga0105237_1000590111 328
330 3300010375 Ga0105239_10011876 Ga0105239_100118769 328
331 3300011119 Ga0105246_10070029 Ga0105246_100700292 328
332 3300025908 Ga0207643_10021678 Ga0207643_100216784 328
333 3300025925 Ga0207650_10013551 Ga0207650_100135514 328
334 3300025926 Ga0207659_10052187 Ga0207659_100521872 328
335 3300025931 Ga0207644_10036252 Ga0207644_100362523 328
336 3300025931 Ga0207644_10325828 Ga0207644_103258282 328
337 3300025933 Ga0207706_10302836 Ga0207706_103028362 328
338 3300025935 Ga0207709_10043246 Ga0207709_100432463 328
339 3300025940 Ga0207691_10006870 Ga0207691_100068702 328
340 3300025942 Ga0207689_10008356 Ga0207689_100083564 328
341 3300025960 Ga0207651_10034152 Ga0207651_100341521 328
342 3300025986 Ga0207658_10059319 Ga0207658_100593193 328
343 3300026067 Ga0207678_10056716 Ga0207678_100567163 328
344 3300026078 Ga0207702_10344379 Ga0207702_103443791 328
345 3300026089 Ga0207648_10019114 Ga0207648_100191146 328
346 3300026116 Ga0207674_10017057 Ga0207674_100170576 328
347 3300026116 Ga0207674_10063257 Ga0207674_100632574 328
348 3300047443 Ga0495687_000548 Ga0495687_000548_6600_7589 328
349 3300048926 Ga0496123_0012770 Ga0496123_0012770_2974_3972 328
350 3300048928 Ga0496125_0009307 Ga0496125_0009307_3094_4092 328
351 3300050496 nmdc:mga07m45_81642_c1 nmdc:mga07m45_81642_c1_784_1773 328
352 iso_pu_bacteria 8003400568 8003401973 328
353 3300005367 Ga0070667_100013733 Ga0070667_1000137333 329
354 3300006177 Ga0075362_10027525 Ga0075362_100275253 329
355 3300006177 Ga0075362_10092231 Ga0075362_100922312 329
356 3300031456 Ga0307513_10102261 Ga0307513_101022612 329
357 3300046506 Ga0495583_0036364 Ga0495583_0036364_19_1011 329
358 3300046519 Ga0495632_0099983 Ga0495632_0099983_106_1098 329
359 3300046660 Ga0495625_0077875 Ga0495625_0077875_997_1989 329
360 3300005548 Ga0070665_100038031 Ga0070665_1000380315 330
361 3300005841 Ga0068863_100015545 Ga0068863_1000155453 330
362 3300009176 Ga0105242_10058886 Ga0105242_100588862 330
363 3300013297 Ga0157378_10122191 Ga0157378_101221913 330
364 3300025940 Ga0207691_10165847 Ga0207691_101658473 330
365 3300026023 Ga0207677_10189893 Ga0207677_101898932 330
366 3300028379 Ga0268266_10046246 Ga0268266_100462462 330
367 3300046692 Ga0495671_0110099 Ga0495671_0110099_94_1092 330
368 3300053730 Ga0500645_024091 Ga0500645_024091_52_1044 330
369 3300002987 JGI25159J45721_1001007 JGI25159J45721_10010078 331
370 3300003354 JGI25160J50197_1000576 JGI25160J50197_10005766 331
371 3300003374 JGI25161J50226_1000384 JGI25161J50226_100038417 331
372 3300003771 Ga0055526_1002868 Ga0055526_10028689 331
373 3300003771 Ga0055526_1003895 Ga0055526_10038959 331
374 3300003773 Ga0055537_1000006 Ga0055537_10000067 331
375 3300003773 Ga0055537_1000445 Ga0055537_100044521 331
376 3300003775 Ga0055524_1000032 Ga0055524_1000032137 331
377 3300003790 Ga0055528_1002479 Ga0055528_100247910 331
378 3300003791 Ga0055530_10003406 Ga0055530_100034066 331
379 3300003791 Ga0055530_10029739 Ga0055530_100297391 331
380 3300003792 Ga0055540_1000046 Ga0055540_1000046108 331
381 3300003794 Ga0055531_10012109 Ga0055531_100121092 331
382 3300004625 Ga0055543_1001191 Ga0055543_10011917 331
383 3300005262 Ga0065165_1011967 Ga0065165_10119672 331
384 3300005355 Ga0070671_100005450 Ga0070671_1000054502 331
385 3300005456 Ga0070678_100029268 Ga0070678_1000292682 331
386 3300005616 Ga0068852_100299733 Ga0068852_1002997332 331
387 3300005618 Ga0068864_100153258 Ga0068864_1001532583 331
388 3300005618 Ga0068864_100412271 Ga0068864_1004122712 331
389 3300006358 Ga0068871_100167575 Ga0068871_1001675752 331
390 3300013308 Ga0157375_10007837 Ga0157375_100078375 331
391 3300014325 Ga0163163_10120764 Ga0163163_101207643 331
392 3300025245 Ga0207425_1013695 Ga0207425_10136952 331
393 3300025263 Ga0209565_1000016 Ga0209565_1000016143 331
394 3300025263 Ga0209565_1000336 Ga0209565_100033646 331
395 3300025273 Ga0209673_1000073 Ga0209673_1000073135 331
396 3300025284 Ga0209130_1000040 Ga0209130_1000040103 331
397 3300025284 Ga0209130_1000210 Ga0209130_100021060 331
398 3300025291 Ga0209675_1000080 Ga0209675_100008054 331
399 3300025291 Ga0209675_1002302 Ga0209675_100230210 331
400 3300025292 Ga0209676_1000165 Ga0209676_100016561 331
401 3300025294 Ga0209025_1001656 Ga0209025_100165616 331
402 3300025294 Ga0209025_1002837 Ga0209025_10028374 331
403 3300025294 Ga0209025_1005592 Ga0209025_10055924 331
404 3300025294 Ga0209025_1010891 Ga0209025_10108917 331
405 3300025295 Ga0209564_1000165 Ga0209564_100016532 331
406 3300025295 Ga0209564_1002785 Ga0209564_10027859 331
407 3300025298 Ga0209050_1000084 Ga0209050_1000084193 331
408 3300025298 Ga0209050_1001772 Ga0209050_10017727 331
409 3300025299 Ga0209256_1000110 Ga0209256_1000110135 331
410 3300025302 Ga0207426_1000188 Ga0207426_1000188103 331
411 3300025302 Ga0207426_1002104 Ga0207426_100210411 331
412 3300025303 Ga0209051_1000058 Ga0209051_1000058193 331
413 3300025304 Ga0209257_1000092 Ga0209257_1000092193 331
414 3300025931 Ga0207644_10000466 Ga0207644_1000046612 331
415 3300026023 Ga0207677_10018512 Ga0207677_100185125 331
416 3300026088 Ga0207641_10027120 Ga0207641_100271205 331
417 3300026095 Ga0207676_10396658 Ga0207676_103966582 331
418 3300026121 Ga0207683_10036202 Ga0207683_100362023 331
419 3300031901 Ga0307406_10018188 Ga0307406_100181882 331
420 3300046616 Ga0495668_0065734 Ga0495668_0065734_60_1061 331
421 3300049579 Ga0501043_0000020 Ga0501043_0000020_37065_38063 331
422 3300049580 Ga0501046_0000039 Ga0501046_0000039_37103_38101 331
423 3300049581 Ga0501047_0000028 Ga0501047_0000028_37077_38075 331
424 3300049824 Ga0501045_0003924 Ga0501045_0003924_454_1452 331
425 3300050489 nmdc:mga03683_29757_c1 nmdc:mga03683_29757_c1_569_1564 331
426 3300053077 Ga0495601_0230503 Ga0495601_0230503_104_1099 331
427 3300002705 JGI25156J39149_1000134 JGI25156J39149_100013452 333
428 3300002738 JGI25154J39366_1000151 JGI25154J39366_10001517 333
429 3300002741 JGI25157J39369_1000173 JGI25157J39369_10001738 333
430 3300025206 Ga0209435_100002 Ga0209435_100002580 333
431 3300025246 Ga0209646_1000001 Ga0209646_10000012723 333
432 3300025250 Ga0209026_1000040 Ga0209026_100004052 333
433 3300025256 Ga0209759_1000001 Ga0209759_10000012354 333
434 3300049587 Ga0501071_0047767 Ga0501071_0047767_726_2051 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

71

343

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9611 41 333
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9594 38 333
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9583 37 333
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.949 37 333
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.947 38 333
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9347 138 258 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9338 138 253 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9062 138 258 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9048 138 253 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9044 138 258 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6P2EN17-F1-model_v4 Argininosuccinate lyase 0.9845 36 333 GO:0016829
AF-A0A6P2EN17-F1-model_v4 Argininosuccinate lyase 0.978 36 333 GO:0016829
AF-A0A537CM98-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9658 27 333
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.965 46 333
AF-A0A4Q2US51-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9615 58 277

Feature Viewer

pLDDT pTM Quality
90.41 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map