F442941

General Info

Members Datasets Scaffolds Average Seq Length
433 202 866 137

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0705235|Ga0501036_0705235_93_548
Length 151
Sequence VVAGQTLTLDGRHGAMNWLVKEEPTHYGFDALVKDRKAVWSGVRNALAQKHLRSIRKGDRVFYYHTGDEKAVVGVARAVSEPYPDPEDRSGKYTAVDLAPVERLPRPVTLAEIKADPAFADFPLVRIARLSVMPVTDAQWARIERLARKAG

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.31
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 21.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0705235 3300049572 Bacteria 834
2 Ga0065712_10470384 3300005290 Unclassified 671
3 Ga0065707_10295997 3300005295 Bacteria 1014
4 Ga0070690_101546363 3300005330 Bacteria 537
5 Ga0070670_100312118 3300005331 Unclassified 1377
6 Ga0070677_10017758 3300005333 Bacteria 2551
7 Ga0070677_10187019 3300005333 Bacteria 990
8 Ga0068869_100019386 3300005334 Bacteria 4647
9 Ga0068869_100515067 3300005334 Unclassified 1000
10 Ga0070666_10004831 3300005335 Bacteria 8236
11 Ga0070680_100266520 3300005336 Bacteria 1450
12 Ga0070660_100086741 3300005339 Bacteria 2463
13 Ga0070660_100726865 3300005339 Unclassified 833
14 Ga0070689_100165844 3300005340 Unclassified 1788
15 Ga0070689_100944798 3300005340 Bacteria 765
16 Ga0070689_101453453 3300005340 Unclassified 620
17 Ga0070692_10032367 3300005345 Unclassified 2628
18 Ga0070669_100262130 3300005353 Unclassified 1379
19 Ga0070669_100496851 3300005353 Unclassified 1011
20 Ga0070675_100141255 3300005354 Bacteria 2058
21 Ga0070675_100407298 3300005354 Unclassified 1214
22 Ga0070674_100320712 3300005356 Bacteria 1242
23 Ga0070688_100068604 3300005365 Unclassified 2261
24 Ga0070659_100149469 3300005366 Bacteria 1905
25 Ga0070703_10389984 3300005406 Bacteria 604
26 Ga0070709_10942401 3300005434 Unclassified 684
27 Ga0070701_10269054 3300005438 Unclassified 1036
28 Ga0070694_100010592 3300005444 Bacteria 5693
29 Ga0070694_100733737 3300005444 Unclassified 806
30 Ga0070708_100010212 3300005445 Bacteria 7601
31 Ga0070708_100259460 3300005445 Bacteria 1634
32 Ga0070708_100281762 3300005445 Bacteria 1564
33 Ga0070708_100520065 3300005445 Unclassified 1122
34 Ga0070663_100025294 3300005455 Bacteria 4006
35 Ga0070663_100031807 3300005455 Unclassified 3630
36 Ga0070662_100039884 3300005457 Unclassified 3342
37 Ga0068867_100082238 3300005459 Bacteria 2429
38 Ga0070685_10249072 3300005466 Unclassified 1176
39 Ga0070706_100042039 3300005467 Unclassified 4221
40 Ga0070706_100114418 3300005467 Bacteria 2512
41 Ga0070707_100476269 3300005468 Bacteria 1210
42 Ga0070707_100955442 3300005468 Unclassified 822
43 Ga0070698_100094312 3300005471 Bacteria 2972
44 Ga0070698_100297278 3300005471 Bacteria 1545
45 Ga0070698_100573127 3300005471 Bacteria 1068
46 Ga0070699_100110752 3300005518 Bacteria 2410
47 Ga0070699_100264903 3300005518 Bacteria 1537
48 Ga0070672_100114263 3300005543 Unclassified 2204
49 Ga0070686_100000424 3300005544 Bacteria 26581
50 Ga0070695_100091011 3300005545 Bacteria 2037
51 Ga0070695_100345075 3300005545 Bacteria 1114
52 Ga0070695_100389419 3300005545 Bacteria 1054
53 Ga0070696_100004691 3300005546 Bacteria 9136
54 Ga0070665_100012090 3300005548 Bacteria 8710
55 Ga0070704_100003243 3300005549 Bacteria 9299
56 Ga0070704_100096199 3300005549 Bacteria 2220
57 Ga0068855_100387348 3300005563 Unclassified 1534
58 Ga0068857_100240286 3300005577 Bacteria 1658
59 Ga0068857_101555482 3300005577 Bacteria 645
60 Ga0068854_100092578 3300005578 Bacteria 2252
61 Ga0068859_100211344 3300005617 Bacteria 2026
62 Ga0068859_100553433 3300005617 Bacteria 1245
63 Ga0068859_101026337 3300005617 Bacteria 906
64 Ga0068859_101075027 3300005617 Unclassified 885
65 Ga0068859_101100779 3300005617 Bacteria 874
66 Ga0068866_10926427 3300005718 Unclassified 614
67 Ga0068861_100103573 3300005719 Unclassified 2269
68 Ga0068861_100131359 3300005719 Bacteria 2033
69 Ga0068870_10023147 3300005840 Bacteria 3061
70 Ga0068858_100039479 3300005842 Bacteria 4377
71 Ga0068858_100362644 3300005842 Bacteria 1389
72 Ga0068860_100006147 3300005843 Bacteria 12076
73 Ga0068860_100085427 3300005843 Bacteria 3003
74 Ga0068860_100735100 3300005843 Bacteria 998
75 Ga0068862_100088100 3300005844 Bacteria 2700
76 Ga0068862_100547870 3300005844 Bacteria 1104
77 Ga0068862_100556224 3300005844 Bacteria 1096
78 Ga0075432_10051665 3300006058 Bacteria 1451
79 Ga0070715_10367447 3300006163 Bacteria 790
80 Ga0070716_100420695 3300006173 Bacteria 966
81 Ga0068871_100424329 3300006358 Bacteria 1188
82 Ga0075428_100116770 3300006844 Bacteria 2906
83 Ga0075430_100000161 3300006846 Bacteria 44011
84 Ga0075430_100092299 3300006846 Bacteria 2532
85 Ga0075431_100007142 3300006847 Bacteria 11098
86 Ga0075431_100041872 3300006847 Bacteria 4722
87 Ga0075431_100053531 3300006847 Bacteria 4161
88 Ga0075431_100204944 3300006847 Bacteria 2017
89 Ga0075433_10000959 3300006852 Bacteria 20391
90 Ga0075433_10003024 3300006852 Bacteria 12919
91 Ga0075433_10073977 3300006852 Bacteria 2998
92 Ga0075433_10105803 3300006852 Bacteria 2493
93 Ga0075433_10116497 3300006852 Bacteria 2370
94 Ga0075433_10542246 3300006852 Bacteria 1023
95 Ga0075433_10770104 3300006852 Bacteria 841
96 Ga0075434_100052006 3300006871 Bacteria 4070
97 Ga0075434_100079589 3300006871 Bacteria 3274
98 Ga0075434_100281472 3300006871 Bacteria 1683
99 Ga0075434_100328875 3300006871 Bacteria 1549
100 Ga0075434_100383950 3300006871 Bacteria 1425
101 Ga0075434_101072838 3300006871 Unclassified 819
102 Ga0075429_100026926 3300006880 Bacteria 4992
103 Ga0075429_100031870 3300006880 Bacteria 4582
104 Ga0075429_100306314 3300006880 Bacteria 1391
105 Ga0068865_100097305 3300006881 Bacteria 2148
106 Ga0068865_102083350 3300006881 Bacteria 515
107 Ga0075436_100001984 3300006914 Bacteria 14129
108 Ga0075436_100038745 3300006914 Bacteria 3289
109 Ga0097620_100211338 3300006931 Bacteria 2026
110 Ga0097620_100553483 3300006931 Bacteria 1245
111 Ga0097620_101026685 3300006931 Bacteria 906
112 Ga0097620_101075108 3300006931 Unclassified 885
113 Ga0097620_101100911 3300006931 Bacteria 874
114 Ga0075435_100006745 3300007076 Bacteria 8145
115 Ga0075435_100584697 3300007076 Unclassified 968
116 Ga0099794_10017718 3300007265 Bacteria 3179
117 Ga0111539_10156611 3300009094 Bacteria 2666
118 Ga0111539_10350753 3300009094 Bacteria 1717
119 Ga0111539_10365111 3300009094 Bacteria 1680
120 Ga0111539_10600518 3300009094 Bacteria 1282
121 Ga0114129_10001147 3300009147 Bacteria 35062
122 Ga0114129_10005868 3300009147 Bacteria 17387
123 Ga0114129_10007724 3300009147 Bacteria 15300
124 Ga0114129_10009427 3300009147 Bacteria 13918
125 Ga0114129_10127715 3300009147 Bacteria 3494
126 Ga0114129_10151157 3300009147 Bacteria 3177
127 Ga0114129_10170297 3300009147 Bacteria 2970
128 Ga0114129_10227897 3300009147 Bacteria 2510
129 Ga0114129_10246150 3300009147 Bacteria 2402
130 Ga0114129_10306777 3300009147 Unclassified 2114
131 Ga0114129_10480250 3300009147 Bacteria 1626
132 Ga0114129_10494881 3300009147 Bacteria 1598
133 Ga0114129_11272439 3300009147 Bacteria 913
134 Ga0114129_11551370 3300009147 Bacteria 812
135 Ga0114129_11954338 3300009147 Bacteria 710
136 Ga0105243_10282788 3300009148 Unclassified 1495
137 Ga0105241_10017271 3300009174 Bacteria 5301
138 Ga0105241_10510043 3300009174 Unclassified 1074
139 Ga0105241_10598769 3300009174 Bacteria 995
140 Ga0105242_11791248 3300009176 Unclassified 652
141 Ga0105242_13051770 3300009176 Bacteria 519
142 Ga0105238_10296673 3300009551 Bacteria 1599
143 Ga0105249_10026034 3300009553 Bacteria 5268
144 Ga0105249_10743178 3300009553 Bacteria 1043
145 Ga0105249_12002722 3300009553 Bacteria 652
146 Ga0099796_10320453 3300010159 Bacteria 661
147 Ga0163162_10046938 3300013306 Unclassified 4330
148 Ga0163162_10099614 3300013306 Bacteria 2997
149 Ga0163162_11225426 3300013306 Unclassified 852
150 Ga0157375_10027392 3300013308 Bacteria 5326
151 Ga0163163_10000474 3300014325 Bacteria 36636
152 Ga0163163_10138903 3300014325 Bacteria 2472
153 Ga0163163_10694696 3300014325 Bacteria 1081
154 Ga0157380_10055478 3300014326 Bacteria 3147
155 Ga0157380_11074005 3300014326 Bacteria 843
156 Ga0157380_11078534 3300014326 Bacteria 841
157 Ga0157380_11296741 3300014326 Bacteria 775
158 Ga0157380_12550718 3300014326 Unclassified 577
159 Ga0157377_10063600 3300014745 Bacteria 2114
160 Ga0157379_11407425 3300014968 Bacteria 676
161 Ga0207697_10008696 3300025315 Bacteria 4426
162 Ga0207682_10011618 3300025893 Bacteria 3440
163 Ga0207688_10066726 3300025901 Bacteria 2036
164 Ga0207688_10873635 3300025901 Bacteria 570
165 Ga0207647_10064278 3300025904 Bacteria 2230
166 Ga0207645_10020913 3300025907 Bacteria 4275
167 Ga0207643_10029426 3300025908 Bacteria 3054
168 Ga0207684_10001074 3300025910 Bacteria 30608
169 Ga0207684_10252015 3300025910 Unclassified 1523
170 Ga0207684_10814150 3300025910 Bacteria 789
171 Ga0207654_10517390 3300025911 Unclassified 844
172 Ga0207660_10731923 3300025917 Bacteria 807
173 Ga0207657_10161665 3300025919 Bacteria 1818
174 Ga0207657_10897411 3300025919 Bacteria 683
175 Ga0207646_10015872 3300025922 Bacteria 7087
176 Ga0207646_10838231 3300025922 Unclassified 818
177 Ga0207681_10298202 3300025923 Bacteria 1274
178 Ga0207694_10216293 3300025924 Bacteria 1562
179 Ga0207659_10244862 3300025926 Unclassified 1452
180 Ga0207659_11614767 3300025926 Bacteria 553
181 Ga0207706_10013249 3300025933 Bacteria 7502
182 Ga0207706_10088569 3300025933 Unclassified 2721
183 Ga0207709_11221696 3300025935 Unclassified 620
184 Ga0207670_10713668 3300025936 Bacteria 831
185 Ga0207669_10217349 3300025937 Bacteria 1400
186 Ga0207704_10108132 3300025938 Bacteria 1872
187 Ga0207665_10579990 3300025939 Bacteria 874
188 Ga0207665_10888558 3300025939 Unclassified 706
189 Ga0207665_11598986 3300025939 Bacteria 517
190 Ga0207691_10000479 3300025940 Bacteria 39636
191 Ga0207691_10104211 3300025940 Unclassified 2528
192 Ga0207711_10122187 3300025941 Bacteria 2326
193 Ga0207689_10012959 3300025942 Bacteria 7121
194 Ga0207689_10334647 3300025942 Unclassified 1257
195 Ga0207640_10118570 3300025981 Unclassified 1891
196 Ga0207658_10087037 3300025986 Bacteria 2412
197 Ga0207703_10533950 3300026035 Bacteria 1105
198 Ga0207703_10695545 3300026035 Unclassified 967
199 Ga0207678_10032717 3300026067 Bacteria 4533
200 Ga0207708_10043585 3300026075 Bacteria 3419
201 Ga0207648_10003297 3300026089 Bacteria 16965
202 Ga0207676_10068164 3300026095 Bacteria 2845
203 Ga0207674_11966813 3300026116 Bacteria 550
204 Ga0207675_100015634 3300026118 Bacteria 7077
205 Ga0207675_100056263 3300026118 Bacteria 3669
206 Ga0207675_100402288 3300026118 Unclassified 1349
207 Ga0207683_10488686 3300026121 Bacteria 1136
208 Ga0207428_10313290 3300027907 Bacteria 1160
209 Ga0268266_10058154 3300028379 Bacteria 3329
210 Ga0268265_10023993 3300028380 Bacteria 4308
211 Ga0268265_10123223 3300028380 Bacteria 2140
212 Ga0268264_10077448 3300028381 Bacteria 2832
213 Ga0268264_10231312 3300028381 Unclassified 1707
214 Ga0268264_10431320 3300028381 Bacteria 1273
215 Ga0268264_10650661 3300028381 Bacteria 1043
216 Ga0307408_100009746 3300031548 Bacteria 6331
217 Ga0307408_100087856 3300031548 Bacteria 2340
218 Ga0307408_100232117 3300031548 Bacteria 1512
219 Ga0307410_10134498 3300031852 Bacteria 1821
220 Ga0307410_10990812 3300031852 Unclassified 724
221 Ga0307410_11752671 3300031852 Bacteria 551
222 Ga0307406_10418479 3300031901 Bacteria 1067
223 Ga0307409_101192493 3300031995 Bacteria 784
224 Ga0307409_102344474 3300031995 Bacteria 563
225 Ga0307411_10935168 3300032005 Bacteria 772
226 Ga0307415_102332439 3300032126 Unclassified 525
227 Ga0373936_0245749 3300035113 Bacteria 798
228 Ga0373939_0053656 3300035114 Bacteria 1260
229 Ga0373945_0083058 3300035116 Bacteria 1230
230 Ga0373943_0074055 3300035170 Bacteria 1731
231 Ga0373946_0532815 3300035171 Bacteria 604
232 Ga0373955_0116911 3300035172 Bacteria 1546
233 Ga0373955_0595744 3300035172 Unclassified 677
234 Ga0373924_0034220 3300035410 Bacteria 2056
235 Ga0373924_0190179 3300035410 Bacteria 904
236 Ga0373931_0012723 3300035691 Bacteria 4083
237 Ga0373935_0311091 3300035692 Bacteria 1116
238 Ga0373927_0566155 3300035695 Bacteria 751
239 Ga0373933_0379015 3300035724 Bacteria 921
240 Ga0373947_0010390 3300035725 Bacteria 5341
241 Ga0373947_1265677 3300035725 Bacteria 502
242 Ga0373937_0059882 3300036401 Bacteria 3499
243 Ga0373937_0083756 3300036401 Bacteria 2950
244 Ga0373925_0047576 3300037068 Unclassified 3193
245 Ga0395899_0046075 3300037312 Bacteria 3248
246 Ga0395900_0037435 3300037418 Bacteria 5002
247 Ga0395900_0753519 3300037418 Bacteria 904
248 Ga0395898_0002370 3300037466 Bacteria 22395
249 Ga0395898_1055507 3300037466 Bacteria 747
250 Ga0395905_0096944 3300037471 Bacteria 2769
251 Ga0395905_0650343 3300037471 Bacteria 956
252 Ga0395901_0051997 3300038443 Bacteria 4259
253 Ga0395901_0546640 3300038443 Bacteria 1174
254 Ga0242420_067877 3300038996 Bacteria 721
255 Ga0451577_0119433 3300042876 Unclassified 2361
256 Ga0451577_0192471 3300042876 Bacteria 1840
257 Ga0453684_0904811 3300044712 Bacteria 945
258 Ga0453684_0955883 3300044712 Bacteria 914
259 Ga0451576_0198582 3300045051 Bacteria 2095
260 Ga0451576_1013810 3300045051 Unclassified 870
261 Ga0451576_1336849 3300045051 Unclassified 747
262 Ga0495603_0406742 3300046455 Bacteria 780
263 Ga0495629_0533249 3300046459 Unclassified 789
264 Ga0495629_0546309 3300046459 Unclassified 778
265 Ga0495618_0062613 3300046514 Unclassified 2361
266 Ga0495618_0453790 3300046514 Unclassified 778
267 Ga0495628_0220120 3300046516 Unclassified 1426
268 Ga0495628_0628094 3300046516 Unclassified 765
269 Ga0495666_0556878 3300046526 Bacteria 511
270 Ga0495642_0211860 3300046528 Bacteria 845
271 Ga0495665_0172384 3300046531 Bacteria 1126
272 Ga0495640_0250601 3300046533 Unclassified 1109
273 Ga0495640_0446563 3300046533 Bacteria 790
274 Ga0495586_0031740 3300046535 Unclassified 2831
275 Ga0495586_0368712 3300046535 Unclassified 825
276 Ga0495667_0004611 3300046559 Bacteria 9320
277 Ga0495656_0625280 3300046615 Unclassified 577
278 Ga0495634_0212203 3300046642 Unclassified 1198
279 Ga0495657_0000260 3300046675 Bacteria 48233
280 Ga0495647_0012668 3300046681 Unclassified 2908
281 Ga0495647_0025551 3300046681 Unclassified 2159
282 Ga0495647_0164142 3300046681 Bacteria 959
283 Ga0495658_0023897 3300046683 Bacteria 3249
284 Ga0495658_0252092 3300046683 Unclassified 1110
285 Ga0495613_0015081 3300046689 Bacteria 5738
286 Ga0495581_0192797 3300047315 Bacteria 1192
287 Ga0495674_0016129 3300047319 Bacteria 6972
288 Ga0495680_0886988 3300047322 Unclassified 577
289 Ga0495684_0074832 3300047471 Bacteria 2573
290 Ga0495684_0691989 3300047471 Unclassified 677
291 Ga0495593_0388564 3300047673 Unclassified 698
292 Ga0496102_0154746 3300048905 Unclassified 2155
293 Ga0496102_0290744 3300048905 Bacteria 1540
294 Ga0496103_0071125 3300048906 Bacteria 2177
295 Ga0496103_0354438 3300048906 Bacteria 943
296 Ga0496103_1003743 3300048906 Bacteria 520
297 Ga0496106_0046722 3300048909 Unclassified 3256
298 Ga0496106_0288223 3300048909 Bacteria 1316
299 Ga0496107_0874590 3300048910 Bacteria 656
300 Ga0496107_1231506 3300048910 Bacteria 537
301 Ga0496112_1051133 3300048915 Unclassified 733
302 Ga0501032_1073748 3300049569 Unclassified 505
303 Ga0501033_0037573 3300049570 Bacteria 3624
304 Ga0501036_0170076 3300049572 Unclassified 1836
305 Ga0501036_0217219 3300049572 Bacteria 1606
306 Ga0501036_0361782 3300049572 Bacteria 1211
307 Ga0501037_0193306 3300049573 Bacteria 1440
308 Ga0501038_0329791 3300049574 Bacteria 1192
309 Ga0501038_0547516 3300049574 Bacteria 880
310 Ga0501039_0245717 3300049575 Bacteria 1407
311 Ga0501039_0711048 3300049575 Bacteria 785
312 Ga0501040_0034264 3300049576 Bacteria 3441
313 Ga0501040_0071624 3300049576 Bacteria 2393
314 Ga0501040_0409459 3300049576 Bacteria 974
315 Ga0501040_1112901 3300049576 Bacteria 573
316 Ga0501040_1264700 3300049576 Unclassified 535
317 Ga0501041_0035408 3300049577 Unclassified 3024
318 Ga0501041_0036734 3300049577 Bacteria 2967
319 Ga0501041_0242745 3300049577 Bacteria 1132
320 Ga0501042_0062626 3300049578 Unclassified 2658
321 Ga0501042_0674153 3300049578 Bacteria 752
322 Ga0501046_0023411 3300049580 Bacteria 5083
323 Ga0501048_0058362 3300049582 Bacteria 2735
324 Ga0501048_0067680 3300049582 Bacteria 2524
325 Ga0501048_0430606 3300049582 Bacteria 944
326 Ga0501068_0114234 3300049584 Bacteria 1681
327 Ga0501071_0040954 3300049587 Bacteria 3317
328 Ga0501071_0260095 3300049587 Bacteria 1311
329 Ga0501071_0473678 3300049587 Bacteria 959
330 Ga0501072_0026798 3300049588 Bacteria 4496
331 Ga0501072_0197105 3300049588 Unclassified 1606
332 Ga0501072_0551844 3300049588 Bacteria 910
333 Ga0501072_0992809 3300049588 Unclassified 654
334 Ga0501073_0058971 3300049589 Bacteria 2682
335 Ga0501073_0230428 3300049589 Bacteria 1280
336 Ga0501075_0014483 3300049591 Bacteria 5651
337 Ga0501075_0028066 3300049591 Bacteria 4152
338 Ga0501075_0041992 3300049591 Bacteria 3429
339 Ga0501075_0188000 3300049591 Bacteria 1575
340 Ga0501075_0302942 3300049591 Bacteria 1218
341 Ga0501076_0000490 3300049592 Bacteria 24947
342 Ga0501076_0008039 3300049592 Bacteria 7707
343 Ga0501076_0635642 3300049592 Bacteria 881
344 Ga0501077_0002198 3300049593 Bacteria 11771
345 Ga0501077_0005181 3300049593 Bacteria 7917
346 Ga0501077_0050076 3300049593 Bacteria 2655
347 Ga0501077_0523361 3300049593 Bacteria 761
348 Ga0501077_0554247 3300049593 Unclassified 738
349 Ga0501079_0018012 3300049741 Bacteria 5393
350 Ga0501079_0019491 3300049741 Bacteria 5182
351 Ga0501079_0078627 3300049741 Bacteria 2551
352 Ga0501079_0108355 3300049741 Bacteria 2157
353 Ga0501079_0246085 3300049741 Bacteria 1397
354 Ga0501079_0453884 3300049741 Bacteria 1007
355 Ga0501080_1307184 3300049742 Unclassified 621
356 Ga0501081_0000166 3300049743 Bacteria 30602
357 Ga0501081_0019648 3300049743 Bacteria 4501
358 Ga0501081_0039471 3300049743 Unclassified 3230
359 Ga0501081_0131829 3300049743 Bacteria 1786
360 Ga0501081_0695270 3300049743 Unclassified 763
361 Ga0501081_0772427 3300049743 Unclassified 722
362 Ga0501081_0957127 3300049743 Bacteria 646
363 Ga0501035_0352538 3300049822 Unclassified 1231
364 Ga0501045_0055173 3300049824 Bacteria 2906
365 Ga0501045_0473037 3300049824 Bacteria 931
366 Ga0501045_0662314 3300049824 Bacteria 771
367 Ga0501045_1195245 3300049824 Bacteria 555
368 nmdc:mga05p37_104049_c1 3300050507 Bacteria 3493
369 nmdc:mga05p37_14694_c1 3300050507 Bacteria 9406
370 nmdc:mga05p37_17509_c1 3300050507 Bacteria 8650
371 nmdc:mga05p37_1767795_c1 3300050507 Bacteria 599
372 nmdc:mga05p37_189343_c1 3300050507 Bacteria 2499
373 nmdc:mga05p37_252876_c1 3300050507 Unclassified 2113
374 nmdc:mga05p37_306691_c1 3300050507 Bacteria 1883
375 nmdc:mga05p37_442997_c1 3300050507 Bacteria 1506
376 nmdc:mga05p37_5615_c1 3300050507 Bacteria 14743
377 nmdc:mga05p37_659414_c1 3300050507 Bacteria 1170
378 nmdc:mga05p37_665066_c1 3300050507 Bacteria 1164
379 nmdc:mga05p37_836080_c1 3300050507 Bacteria 1002
380 nmdc:mga05p37_8370_c1 3300050507 Bacteria 12229
381 nmdc:mga09592_168218_c1 3300050508 Bacteria 1895
382 nmdc:mga09592_239862_c1 3300050508 Bacteria 1571
383 nmdc:mga09592_6567_c1 3300050508 Bacteria 9470
384 nmdc:mga09592_780342_c1 3300050508 Bacteria 809
385 nmdc:mga0qj67_211053_c1 3300050509 Bacteria 1577
386 nmdc:mga0qj67_372353_c1 3300050509 Bacteria 1154
387 nmdc:mga0qj67_95879_c1 3300050509 Bacteria 2388
388 nmdc:mga06r32_15523_c1 3300050510 Bacteria 6917
389 nmdc:mga06r32_1719300_c1 3300050510 Bacteria 564
390 nmdc:mga06r32_247557_c1 3300050510 Bacteria 1770
391 nmdc:mga06r32_290326_c1 3300050510 Bacteria 1622
392 nmdc:mga06r32_4828_c1 3300050510 Bacteria 12139
393 nmdc:mga06r32_81173_c1 3300050510 Bacteria 3158
394 nmdc:mga08y16_1910299_c1 3300050511 Bacteria 544
395 nmdc:mga08y16_235155_c1 3300050511 Bacteria 1895
396 nmdc:mga08y16_292549_c1 3300050511 Unclassified 1679
397 nmdc:mga08y16_600967_c1 3300050511 Unclassified 1109
398 nmdc:mga0n895_1475014_c1 3300050512 Bacteria 647
399 nmdc:mga0n895_2239547_c1 3300050512 Bacteria 501
400 nmdc:mga0n895_396578_c1 3300050512 Bacteria 1396
401 nmdc:mga0n895_609213_c1 3300050512 Bacteria 1094
402 nmdc:mga0n895_95363_c1 3300050512 Bacteria 2979
403 nmdc:mga0rr50_1069_c1 3300050513 Bacteria 14897
404 nmdc:mga0rr50_116156_c1 3300050513 Bacteria 2124
405 nmdc:mga08x19_1322_c1 3300050514 Bacteria 15370
406 nmdc:mga08x19_187652_c1 3300050514 Bacteria 1413
407 nmdc:mga08x19_23860_c1 3300050514 Bacteria 3796
408 nmdc:mga08x19_283213_c1 3300050514 Bacteria 1149
409 nmdc:mga0a205_1299938_c1 3300050515 Bacteria 575
410 nmdc:mga0a205_250567_c1 3300050515 Bacteria 1650
411 nmdc:mga0a205_427101_c1 3300050515 Bacteria 1187
412 nmdc:mga0a205_531719_c1 3300050515 Unclassified 1032
413 nmdc:mga0a205_56749_c1 3300050515 Bacteria 3781
414 nmdc:mga0a205_570_c1 3300050515 Bacteria 29248
415 nmdc:mga0a205_828855_c1 3300050515 Bacteria 772
416 Ga0501084_0002937 3300054114 Bacteria 13813
417 Ga0501084_0057275 3300054114 Bacteria 3261
418 Ga0501084_0181276 3300054114 Bacteria 1778
419 Ga0501084_0934799 3300054114 Bacteria 729
420 Ga0501084_1333962 3300054114 Bacteria 601
421 Ga0501084_1591086 3300054114 Bacteria 546
422 Ga0590071_084389 3300059421 Bacteria 791
423 Ga0501082_0006682 3300060353 Bacteria 9980
424 Ga0501082_0034737 3300060353 Bacteria 4346
425 Ga0501082_0309425 3300060353 Bacteria 1376
426 Ga0501082_1443099 3300060353 Bacteria 601
427 Ga0501082_1895208 3300060353 Bacteria 520
428 Ga0530510_0003128 3300061734 Bacteria 11360
429 Ga0530510_0025392 3300061734 Bacteria 4236
430 Ga0530510_0197705 3300061734 Bacteria 1493
431 Ga0530510_0216803 3300061734 Bacteria 1422
432 Ga0530510_0481207 3300061734 Bacteria 940
433 Ga0530510_1215772 3300061734 Bacteria 578
434 Ga0501036_0705235
435 Ga0065712_10470384
436 Ga0065707_10295997
437 Ga0070690_101546363
438 Ga0070670_100312118
439 Ga0070677_10017758
440 Ga0070677_10187019
441 Ga0068869_100019386
442 Ga0068869_100515067
443 Ga0070666_10004831
444 Ga0070680_100266520
445 Ga0070660_100086741
446 Ga0070660_100726865
447 Ga0070689_100165844
448 Ga0070689_100944798
449 Ga0070689_101453453
450 Ga0070692_10032367
451 Ga0070669_100262130
452 Ga0070669_100496851
453 Ga0070675_100141255
454 Ga0070675_100407298
455 Ga0070674_100320712
456 Ga0070688_100068604
457 Ga0070659_100149469
458 Ga0070703_10389984
459 Ga0070709_10942401
460 Ga0070701_10269054
461 Ga0070694_100010592
462 Ga0070694_100733737
463 Ga0070708_100010212
464 Ga0070708_100259460
465 Ga0070708_100281762
466 Ga0070708_100520065
467 Ga0070663_100025294
468 Ga0070663_100031807
469 Ga0070662_100039884
470 Ga0068867_100082238
471 Ga0070685_10249072
472 Ga0070706_100042039
473 Ga0070706_100114418
474 Ga0070707_100476269
475 Ga0070707_100955442
476 Ga0070698_100094312
477 Ga0070698_100297278
478 Ga0070698_100573127
479 Ga0070699_100110752
480 Ga0070699_100264903
481 Ga0070672_100114263
482 Ga0070686_100000424
483 Ga0070695_100091011
484 Ga0070695_100345075
485 Ga0070695_100389419
486 Ga0070696_100004691
487 Ga0070665_100012090
488 Ga0070704_100003243
489 Ga0070704_100096199
490 Ga0068855_100387348
491 Ga0068857_100240286
492 Ga0068857_101555482
493 Ga0068854_100092578
494 Ga0068859_100211344
495 Ga0068859_100553433
496 Ga0068859_101026337
497 Ga0068859_101075027
498 Ga0068859_101100779
499 Ga0068866_10926427
500 Ga0068861_100103573
501 Ga0068861_100131359
502 Ga0068870_10023147
503 Ga0068858_100039479
504 Ga0068858_100362644
505 Ga0068860_100006147
506 Ga0068860_100085427
507 Ga0068860_100735100
508 Ga0068862_100088100
509 Ga0068862_100547870
510 Ga0068862_100556224
511 Ga0075432_10051665
512 Ga0070715_10367447
513 Ga0070716_100420695
514 Ga0068871_100424329
515 Ga0075428_100116770
516 Ga0075430_100000161
517 Ga0075430_100092299
518 Ga0075431_100007142
519 Ga0075431_100041872
520 Ga0075431_100053531
521 Ga0075431_100204944
522 Ga0075433_10000959
523 Ga0075433_10003024
524 Ga0075433_10073977
525 Ga0075433_10105803
526 Ga0075433_10116497
527 Ga0075433_10542246
528 Ga0075433_10770104
529 Ga0075434_100052006
530 Ga0075434_100079589
531 Ga0075434_100281472
532 Ga0075434_100328875
533 Ga0075434_100383950
534 Ga0075434_101072838
535 Ga0075429_100026926
536 Ga0075429_100031870
537 Ga0075429_100306314
538 Ga0068865_100097305
539 Ga0068865_102083350
540 Ga0075436_100001984
541 Ga0075436_100038745
542 Ga0097620_100211338
543 Ga0097620_100553483
544 Ga0097620_101026685
545 Ga0097620_101075108
546 Ga0097620_101100911
547 Ga0075435_100006745
548 Ga0075435_100584697
549 Ga0099794_10017718
550 Ga0111539_10156611
551 Ga0111539_10350753
552 Ga0111539_10365111
553 Ga0111539_10600518
554 Ga0114129_10001147
555 Ga0114129_10005868
556 Ga0114129_10007724
557 Ga0114129_10009427
558 Ga0114129_10127715
559 Ga0114129_10151157
560 Ga0114129_10170297
561 Ga0114129_10227897
562 Ga0114129_10246150
563 Ga0114129_10306777
564 Ga0114129_10480250
565 Ga0114129_10494881
566 Ga0114129_11272439
567 Ga0114129_11551370
568 Ga0114129_11954338
569 Ga0105243_10282788
570 Ga0105241_10017271
571 Ga0105241_10510043
572 Ga0105241_10598769
573 Ga0105242_11791248
574 Ga0105242_13051770
575 Ga0105238_10296673
576 Ga0105249_10026034
577 Ga0105249_10743178
578 Ga0105249_12002722
579 Ga0099796_10320453
580 Ga0163162_10046938
581 Ga0163162_10099614
582 Ga0163162_11225426
583 Ga0157375_10027392
584 Ga0163163_10000474
585 Ga0163163_10138903
586 Ga0163163_10694696
587 Ga0157380_10055478
588 Ga0157380_11074005
589 Ga0157380_11078534
590 Ga0157380_11296741
591 Ga0157380_12550718
592 Ga0157377_10063600
593 Ga0157379_11407425
594 Ga0207697_10008696
595 Ga0207682_10011618
596 Ga0207688_10066726
597 Ga0207688_10873635
598 Ga0207647_10064278
599 Ga0207645_10020913
600 Ga0207643_10029426
601 Ga0207684_10001074
602 Ga0207684_10252015
603 Ga0207684_10814150
604 Ga0207654_10517390
605 Ga0207660_10731923
606 Ga0207657_10161665
607 Ga0207657_10897411
608 Ga0207646_10015872
609 Ga0207646_10838231
610 Ga0207681_10298202
611 Ga0207694_10216293
612 Ga0207659_10244862
613 Ga0207659_11614767
614 Ga0207706_10013249
615 Ga0207706_10088569
616 Ga0207709_11221696
617 Ga0207670_10713668
618 Ga0207669_10217349
619 Ga0207704_10108132
620 Ga0207665_10579990
621 Ga0207665_10888558
622 Ga0207665_11598986
623 Ga0207691_10000479
624 Ga0207691_10104211
625 Ga0207711_10122187
626 Ga0207689_10012959
627 Ga0207689_10334647
628 Ga0207640_10118570
629 Ga0207658_10087037
630 Ga0207703_10533950
631 Ga0207703_10695545
632 Ga0207678_10032717
633 Ga0207708_10043585
634 Ga0207648_10003297
635 Ga0207676_10068164
636 Ga0207674_11966813
637 Ga0207675_100015634
638 Ga0207675_100056263
639 Ga0207675_100402288
640 Ga0207683_10488686
641 Ga0207428_10313290
642 Ga0268266_10058154
643 Ga0268265_10023993
644 Ga0268265_10123223
645 Ga0268264_10077448
646 Ga0268264_10231312
647 Ga0268264_10431320
648 Ga0268264_10650661
649 Ga0307408_100009746
650 Ga0307408_100087856
651 Ga0307408_100232117
652 Ga0307410_10134498
653 Ga0307410_10990812
654 Ga0307410_11752671
655 Ga0307406_10418479
656 Ga0307409_101192493
657 Ga0307409_102344474
658 Ga0307411_10935168
659 Ga0307415_102332439
660 Ga0373936_0245749
661 Ga0373939_0053656
662 Ga0373945_0083058
663 Ga0373943_0074055
664 Ga0373946_0532815
665 Ga0373955_0116911
666 Ga0373955_0595744
667 Ga0373924_0034220
668 Ga0373924_0190179
669 Ga0373931_0012723
670 Ga0373935_0311091
671 Ga0373927_0566155
672 Ga0373933_0379015
673 Ga0373947_0010390
674 Ga0373947_1265677
675 Ga0373937_0059882
676 Ga0373937_0083756
677 Ga0373925_0047576
678 Ga0395899_0046075
679 Ga0395900_0037435
680 Ga0395900_0753519
681 Ga0395898_0002370
682 Ga0395898_1055507
683 Ga0395905_0096944
684 Ga0395905_0650343
685 Ga0395901_0051997
686 Ga0395901_0546640
687 Ga0242420_067877
688 Ga0451577_0119433
689 Ga0451577_0192471
690 Ga0453684_0904811
691 Ga0453684_0955883
692 Ga0451576_0198582
693 Ga0451576_1013810
694 Ga0451576_1336849
695 Ga0495603_0406742
696 Ga0495629_0533249
697 Ga0495629_0546309
698 Ga0495618_0062613
699 Ga0495618_0453790
700 Ga0495628_0220120
701 Ga0495628_0628094
702 Ga0495666_0556878
703 Ga0495642_0211860
704 Ga0495665_0172384
705 Ga0495640_0250601
706 Ga0495640_0446563
707 Ga0495586_0031740
708 Ga0495586_0368712
709 Ga0495667_0004611
710 Ga0495656_0625280
711 Ga0495634_0212203
712 Ga0495657_0000260
713 Ga0495647_0012668
714 Ga0495647_0025551
715 Ga0495647_0164142
716 Ga0495658_0023897
717 Ga0495658_0252092
718 Ga0495613_0015081
719 Ga0495581_0192797
720 Ga0495674_0016129
721 Ga0495680_0886988
722 Ga0495684_0074832
723 Ga0495684_0691989
724 Ga0495593_0388564
725 Ga0496102_0154746
726 Ga0496102_0290744
727 Ga0496103_0071125
728 Ga0496103_0354438
729 Ga0496103_1003743
730 Ga0496106_0046722
731 Ga0496106_0288223
732 Ga0496107_0874590
733 Ga0496107_1231506
734 Ga0496112_1051133
735 Ga0501032_1073748
736 Ga0501033_0037573
737 Ga0501036_0170076
738 Ga0501036_0217219
739 Ga0501036_0361782
740 Ga0501037_0193306
741 Ga0501038_0329791
742 Ga0501038_0547516
743 Ga0501039_0245717
744 Ga0501039_0711048
745 Ga0501040_0034264
746 Ga0501040_0071624
747 Ga0501040_0409459
748 Ga0501040_1112901
749 Ga0501040_1264700
750 Ga0501041_0035408
751 Ga0501041_0036734
752 Ga0501041_0242745
753 Ga0501042_0062626
754 Ga0501042_0674153
755 Ga0501046_0023411
756 Ga0501048_0058362
757 Ga0501048_0067680
758 Ga0501048_0430606
759 Ga0501068_0114234
760 Ga0501071_0040954
761 Ga0501071_0260095
762 Ga0501071_0473678
763 Ga0501072_0026798
764 Ga0501072_0197105
765 Ga0501072_0551844
766 Ga0501072_0992809
767 Ga0501073_0058971
768 Ga0501073_0230428
769 Ga0501075_0014483
770 Ga0501075_0028066
771 Ga0501075_0041992
772 Ga0501075_0188000
773 Ga0501075_0302942
774 Ga0501076_0000490
775 Ga0501076_0008039
776 Ga0501076_0635642
777 Ga0501077_0002198
778 Ga0501077_0005181
779 Ga0501077_0050076
780 Ga0501077_0523361
781 Ga0501077_0554247
782 Ga0501079_0018012
783 Ga0501079_0019491
784 Ga0501079_0078627
785 Ga0501079_0108355
786 Ga0501079_0246085
787 Ga0501079_0453884
788 Ga0501080_1307184
789 Ga0501081_0000166
790 Ga0501081_0019648
791 Ga0501081_0039471
792 Ga0501081_0131829
793 Ga0501081_0695270
794 Ga0501081_0772427
795 Ga0501081_0957127
796 Ga0501035_0352538
797 Ga0501045_0055173
798 Ga0501045_0473037
799 Ga0501045_0662314
800 Ga0501045_1195245
801 nmdc:mga05p37_104049_c1
802 nmdc:mga05p37_14694_c1
803 nmdc:mga05p37_17509_c1
804 nmdc:mga05p37_1767795_c1
805 nmdc:mga05p37_189343_c1
806 nmdc:mga05p37_252876_c1
807 nmdc:mga05p37_306691_c1
808 nmdc:mga05p37_442997_c1
809 nmdc:mga05p37_5615_c1
810 nmdc:mga05p37_659414_c1
811 nmdc:mga05p37_665066_c1
812 nmdc:mga05p37_836080_c1
813 nmdc:mga05p37_8370_c1
814 nmdc:mga09592_168218_c1
815 nmdc:mga09592_239862_c1
816 nmdc:mga09592_6567_c1
817 nmdc:mga09592_780342_c1
818 nmdc:mga0qj67_211053_c1
819 nmdc:mga0qj67_372353_c1
820 nmdc:mga0qj67_95879_c1
821 nmdc:mga06r32_15523_c1
822 nmdc:mga06r32_1719300_c1
823 nmdc:mga06r32_247557_c1
824 nmdc:mga06r32_290326_c1
825 nmdc:mga06r32_4828_c1
826 nmdc:mga06r32_81173_c1
827 nmdc:mga08y16_1910299_c1
828 nmdc:mga08y16_235155_c1
829 nmdc:mga08y16_292549_c1
830 nmdc:mga08y16_600967_c1
831 nmdc:mga0n895_1475014_c1
832 nmdc:mga0n895_2239547_c1
833 nmdc:mga0n895_396578_c1
834 nmdc:mga0n895_609213_c1
835 nmdc:mga0n895_95363_c1
836 nmdc:mga0rr50_1069_c1
837 nmdc:mga0rr50_116156_c1
838 nmdc:mga08x19_1322_c1
839 nmdc:mga08x19_187652_c1
840 nmdc:mga08x19_23860_c1
841 nmdc:mga08x19_283213_c1
842 nmdc:mga0a205_1299938_c1
843 nmdc:mga0a205_250567_c1
844 nmdc:mga0a205_427101_c1
845 nmdc:mga0a205_531719_c1
846 nmdc:mga0a205_56749_c1
847 nmdc:mga0a205_570_c1
848 nmdc:mga0a205_828855_c1
849 Ga0501084_0002937
850 Ga0501084_0057275
851 Ga0501084_0181276
852 Ga0501084_0934799
853 Ga0501084_1333962
854 Ga0501084_1591086
855 Ga0590071_084389
856 Ga0501082_0006682
857 Ga0501082_0034737
858 Ga0501082_0309425
859 Ga0501082_1443099
860 Ga0501082_1895208
861 Ga0530510_0003128
862 Ga0530510_0025392
863 Ga0530510_0197705
864 Ga0530510_0216803
865 Ga0530510_0481207
866 Ga0530510_1215772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

16

146

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.939 2 133
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9297 2 132
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9191 2 133
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9189 1 132
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9102 1 132
ID Description Score Start End Superfamily
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9245 2 134 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9159 2 133 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9114 2 134 3.10.590.10
3eopB00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9091 1 133 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8964 2 133 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A534X573-F1-model_v4 EVE domain-containing protein 0.9801 22 134 GO:0016829
AF-A0A521R1Z5-F1-model_v4 EVE domain-containing protein 0.9762 20 134
AF-A0A357N7U1-F1-model_v4 EVE domain-containing protein 0.976 40 133
AF-A0A161I736-F1-model_v4 Ubiquinol-cytochrome C reductase 0.973 22 134
AF-A0A1F2VKM4-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9711 2 134

Map