F442939

General Info

Members Datasets Scaffolds Average Seq Length
433 253 866 145

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0376930|Ga0501031_0376930_55_582
Length 175
Sequence MSSVLLEPLGQIFALVHGHIFSLRSVMVKRRTTMDQIRPNSRGITIGFWTVTALFCLQIGFTAYAQLTLPQVAEAFARLGFPDYFRVELAWAKLLGIVLLLAPVPARLKEWAYAGFAITLVSALIAHVSIGEGPEAWGWAAGTGVLWGLSYFFWRRAEAVLETQTLSEPRNPLAA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
149 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
177 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
178 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
179 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
248 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 0
Rhizoplane 2.54
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0376930 3300049568 Bacteria 918
2 JGI25406J46586_10001149 3300003203 Bacteria 12431
3 Ga0070690_101430843 3300005330 Bacteria 557
4 Ga0070670_100078495 3300005331 Bacteria 2836
5 Ga0068869_101685268 3300005334 Bacteria 566
6 Ga0070682_100160623 3300005337 Bacteria 1551
7 Ga0070687_100053679 3300005343 Bacteria 2097
8 Ga0070668_100060498 3300005347 Bacteria 2933
9 Ga0070668_100261742 3300005347 Bacteria 1439
10 Ga0070668_100299000 3300005347 Bacteria 1349
11 Ga0070669_100028171 3300005353 Bacteria 4044
12 Ga0070669_100109493 3300005353 Bacteria 2094
13 Ga0070669_100118443 3300005353 Bacteria 2017
14 Ga0070675_100995188 3300005354 Bacteria 770
15 Ga0070675_101163376 3300005354 Bacteria 710
16 Ga0070674_100054149 3300005356 Bacteria 2774
17 Ga0070673_100039127 3300005364 Bacteria 3627
18 Ga0070673_100147199 3300005364 Bacteria 1992
19 Ga0070673_100316805 3300005364 Bacteria 1377
20 Ga0070667_100244067 3300005367 Bacteria 1604
21 Ga0070667_100985859 3300005367 Bacteria 786
22 Ga0070713_100000219 3300005436 Bacteria 38014
23 Ga0070713_100020793 3300005436 Bacteria 5038
24 Ga0070701_10131579 3300005438 Bacteria 1422
25 Ga0070711_100031442 3300005439 Bacteria 3524
26 Ga0070711_100076168 3300005439 Bacteria 2378
27 Ga0070711_101583213 3300005439 Bacteria 573
28 Ga0070705_100253969 3300005440 Bacteria 1236
29 Ga0070700_100139738 3300005441 Bacteria 1644
30 Ga0070700_100869053 3300005441 Bacteria 732
31 Ga0070694_100191812 3300005444 Bacteria 1518
32 Ga0070694_100415690 3300005444 Bacteria 1056
33 Ga0070663_100100950 3300005455 Bacteria 2153
34 Ga0070678_100126399 3300005456 Bacteria 2025
35 Ga0070662_100090338 3300005457 Bacteria 2299
36 Ga0070662_100262029 3300005457 Bacteria 1393
37 Ga0070662_100932795 3300005457 Bacteria 742
38 Ga0070681_10006263 3300005458 Bacteria 11576
39 Ga0070681_10618266 3300005458 Bacteria 998
40 Ga0070685_10012548 3300005466 Bacteria 4454
41 Ga0070706_100693541 3300005467 Bacteria 944
42 Ga0070707_100164279 3300005468 Bacteria 2163
43 Ga0070707_101754479 3300005468 Bacteria 588
44 Ga0070698_100044299 3300005471 Bacteria 4558
45 Ga0070698_100125078 3300005471 Bacteria 2528
46 Ga0070679_100329779 3300005530 Bacteria 1475
47 Ga0070697_100676834 3300005536 Bacteria 909
48 Ga0070672_100142022 3300005543 Bacteria 1981
49 Ga0070672_100205236 3300005543 Bacteria 1649
50 Ga0070686_100870988 3300005544 Bacteria 731
51 Ga0070695_100981982 3300005545 Bacteria 686
52 Ga0070696_100014900 3300005546 Bacteria 5220
53 Ga0070665_100094990 3300005548 Bacteria 2986
54 Ga0070665_100613885 3300005548 Bacteria 1100
55 Ga0070704_101676433 3300005549 Bacteria 587
56 Ga0068855_100322998 3300005563 Bacteria 1706
57 Ga0068855_100620773 3300005563 Bacteria 1164
58 Ga0068855_101519862 3300005563 Bacteria 687
59 Ga0068854_100736491 3300005578 Bacteria 854
60 Ga0070702_100264412 3300005615 Bacteria 1173
61 Ga0068852_101877135 3300005616 Bacteria 621
62 Ga0068859_100024871 3300005617 Bacteria 6010
63 Ga0068859_100149643 3300005617 Bacteria 2410
64 Ga0068864_100004928 3300005618 Bacteria 10940
65 Ga0068861_100027389 3300005719 Bacteria 4150
66 Ga0068861_100267500 3300005719 Bacteria 1466
67 Ga0068861_101735955 3300005719 Bacteria 618
68 Ga0068870_10024121 3300005840 Bacteria 3008
69 Ga0068863_101575717 3300005841 Bacteria 666
70 Ga0068858_100720881 3300005842 Bacteria 971
71 Ga0068860_100052081 3300005843 Bacteria 3893
72 Ga0068860_101421919 3300005843 Bacteria 715
73 Ga0068862_100000683 3300005844 Bacteria 34668
74 Ga0068862_100104936 3300005844 Bacteria 2476
75 Ga0068862_100156391 3300005844 Bacteria 2032
76 Ga0068862_100863179 3300005844 Bacteria 888
77 Ga0068862_101355559 3300005844 Bacteria 714
78 Ga0081455_10030240 3300005937 Bacteria 4923
79 Ga0081539_10000329 3300005985 Bacteria 105307
80 Ga0070717_10003026 3300006028 Bacteria 11975
81 Ga0070717_10141943 3300006028 Bacteria 2072
82 Ga0075368_10070049 3300006042 Bacteria 1415
83 Ga0075364_10012874 3300006051 Bacteria 5131
84 Ga0075364_10029055 3300006051 Bacteria 3543
85 Ga0070712_100011885 3300006175 Bacteria 5532
86 Ga0075362_10000363 3300006177 Bacteria 13081
87 Ga0075362_10302383 3300006177 Bacteria 794
88 Ga0075367_10056615 3300006178 Bacteria 2329
89 Ga0075366_10022348 3300006195 Bacteria 3678
90 Ga0097621_100121565 3300006237 Bacteria 2215
91 Ga0097621_100709399 3300006237 Bacteria 927
92 Ga0075370_10024212 3300006353 Bacteria 3352
93 Ga0068871_100505678 3300006358 Bacteria 1090
94 Ga0075428_100007291 3300006844 Bacteria 12248
95 Ga0075428_100019143 3300006844 Bacteria 7572
96 Ga0075428_100036382 3300006844 Bacteria 5422
97 Ga0075428_100094929 3300006844 Bacteria 3251
98 Ga0075428_100190126 3300006844 Bacteria 2220
99 Ga0075428_100256797 3300006844 Bacteria 1882
100 Ga0075428_100277855 3300006844 Bacteria 1802
101 Ga0075428_102072166 3300006844 Bacteria 589
102 Ga0075430_100092864 3300006846 Bacteria 2523
103 Ga0075430_101461804 3300006846 Bacteria 562
104 Ga0075431_100000029 3300006847 Bacteria 73283
105 Ga0075431_100023022 3300006847 Bacteria 6368
106 Ga0075431_100216945 3300006847 Bacteria 1952
107 Ga0075431_100283084 3300006847 Bacteria 1678
108 Ga0075431_100380506 3300006847 Bacteria 1416
109 Ga0075431_100649419 3300006847 Bacteria 1035
110 Ga0075431_101373097 3300006847 Bacteria 666
111 Ga0075433_10034996 3300006852 Bacteria 4317
112 Ga0075433_10211833 3300006852 Bacteria 1722
113 Ga0075433_10236213 3300006852 Bacteria 1623
114 Ga0075433_10355421 3300006852 Bacteria 1294
115 Ga0075434_100001078 3300006871 Bacteria 22324
116 Ga0075434_100393445 3300006871 Bacteria 1407
117 Ga0075429_100142525 3300006880 Bacteria 2098
118 Ga0075429_100145995 3300006880 Bacteria 2071
119 Ga0075429_100250347 3300006880 Bacteria 1551
120 Ga0075429_101034776 3300006880 Bacteria 718
121 Ga0068865_100281376 3300006881 Bacteria 1324
122 Ga0068865_101242315 3300006881 Bacteria 661
123 Ga0075436_100001235 3300006914 Bacteria 17363
124 Ga0075436_100124526 3300006914 Bacteria 1805
125 Ga0075436_100440121 3300006914 Bacteria 948
126 Ga0097620_100024872 3300006931 Bacteria 6010
127 Ga0097620_100149629 3300006931 Bacteria 2410
128 Ga0097620_101529341 3300006931 Bacteria 737
129 Ga0075435_100000255 3300007076 Bacteria 33098
130 Ga0075435_100039837 3300007076 Bacteria 3750
131 Ga0075435_100046864 3300007076 Bacteria 3469
132 Ga0075435_100146091 3300007076 Bacteria 1986
133 Ga0105240_10001049 3300009093 Bacteria 48973
134 Ga0105240_10059121 3300009093 Bacteria 4785
135 Ga0111539_10000734 3300009094 Bacteria 42621
136 Ga0111539_10015238 3300009094 Bacteria 9576
137 Ga0111539_10160253 3300009094 Bacteria 2631
138 Ga0111539_10197188 3300009094 Bacteria 2348
139 Ga0111539_12219164 3300009094 Bacteria 637
140 Ga0114129_10044959 3300009147 Bacteria 6210
141 Ga0114129_10230393 3300009147 Bacteria 2495
142 Ga0114129_10237904 3300009147 Bacteria 2449
143 Ga0114129_10596316 3300009147 Bacteria 1432
144 Ga0105243_10079892 3300009148 Bacteria 2666
145 Ga0105242_10095366 3300009176 Bacteria 2511
146 Ga0105248_10090967 3300009177 Bacteria 3437
147 Ga0105248_10697352 3300009177 Bacteria 1146
148 Ga0105248_11619993 3300009177 Bacteria 733
149 Ga0105238_10008209 3300009551 Bacteria 10445
150 Ga0105249_10184200 3300009553 Bacteria 2034
151 Ga0105249_11534190 3300009553 Bacteria 739
152 Ga0105249_12946590 3300009553 Bacteria 546
153 Ga0105239_10674109 3300010375 Bacteria 1182
154 Ga0157374_10062004 3300013296 Bacteria 3503
155 Ga0157374_12333346 3300013296 Bacteria 562
156 Ga0157378_11086830 3300013297 Bacteria 836
157 Ga0157378_12319791 3300013297 Bacteria 588
158 Ga0163162_10016849 3300013306 Bacteria 7142
159 Ga0163162_10862340 3300013306 Bacteria 1020
160 Ga0163162_12469722 3300013306 Bacteria 597
161 Ga0163163_10017128 3300014325 Bacteria 6750
162 Ga0163163_10035659 3300014325 Bacteria 4827
163 Ga0163163_10211709 3300014325 Bacteria 1987
164 Ga0163163_12279463 3300014325 Bacteria 600
165 Ga0157380_10119470 3300014326 Bacteria 2230
166 Ga0157380_10965850 3300014326 Bacteria 883
167 Ga0157377_10301959 3300014745 Bacteria 1057
168 Ga0157379_10035819 3300014968 Bacteria 4425
169 Ga0157379_10562518 3300014968 Bacteria 1062
170 Ga0157376_10005067 3300014969 Bacteria 9190
171 Ga0157376_10953718 3300014969 Bacteria 878
172 Ga0182005_1042836 3300015265 Bacteria 1230
173 Ga0163161_11137074 3300017792 Bacteria 673
174 Ga0207697_10154181 3300025315 Bacteria 1000
175 Ga0207697_10324173 3300025315 Bacteria 684
176 Ga0207642_10116856 3300025899 Bacteria 1369
177 Ga0207680_10644553 3300025903 Bacteria 758
178 Ga0207647_10078711 3300025904 Bacteria 1980
179 Ga0207699_10106622 3300025906 Bacteria 1788
180 Ga0207645_10016151 3300025907 Bacteria 4945
181 Ga0207643_10147998 3300025908 Bacteria 1406
182 Ga0207707_10030220 3300025912 Bacteria 4739
183 Ga0207707_10784641 3300025912 Bacteria 795
184 Ga0207695_10003747 3300025913 Bacteria 21137
185 Ga0207695_10007040 3300025913 Bacteria 14431
186 Ga0207671_10002278 3300025914 Bacteria 20762
187 Ga0207671_10188117 3300025914 Bacteria 1609
188 Ga0207693_10019292 3300025915 Bacteria 5426
189 Ga0207663_10154127 3300025916 Bacteria 1615
190 Ga0207662_10062024 3300025918 Bacteria 2246
191 Ga0207646_10153518 3300025922 Bacteria 2076
192 Ga0207681_10280668 3300025923 Bacteria 1311
193 Ga0207694_10004840 3300025924 Bacteria 10452
194 Ga0207659_10152448 3300025926 Bacteria 1806
195 Ga0207700_10000651 3300025928 Bacteria 20300
196 Ga0207700_10407329 3300025928 Bacteria 1192
197 Ga0207664_10089661 3300025929 Bacteria 2519
198 Ga0207664_10470478 3300025929 Bacteria 1123
199 Ga0207706_10039407 3300025933 Bacteria 4188
200 Ga0207706_10188564 3300025933 Bacteria 1810
201 Ga0207709_10328226 3300025935 Bacteria 1148
202 Ga0207669_10053277 3300025937 Bacteria 2436
203 Ga0207691_10007316 3300025940 Bacteria 10650
204 Ga0207691_10040324 3300025940 Bacteria 4315
205 Ga0207691_10173330 3300025940 Bacteria 1888
206 Ga0207711_10011937 3300025941 Bacteria 7221
207 Ga0207689_10087950 3300025942 Bacteria 2552
208 Ga0207689_10864534 3300025942 Bacteria 763
209 Ga0207661_10145197 3300025944 Bacteria 2046
210 Ga0207667_10246777 3300025949 Bacteria 1827
211 Ga0207667_10546578 3300025949 Bacteria 1172
212 Ga0207667_10728503 3300025949 Bacteria 992
213 Ga0207651_10221662 3300025960 Bacteria 1529
214 Ga0207712_10567653 3300025961 Bacteria 978
215 Ga0207668_10187057 3300025972 Bacteria 1638
216 Ga0207668_10234126 3300025972 Bacteria 1482
217 Ga0207640_10080112 3300025981 Bacteria 2228
218 Ga0207658_10083248 3300025986 Bacteria 2459
219 Ga0207677_10053474 3300026023 Bacteria 2749
220 Ga0207703_11417030 3300026035 Bacteria 668
221 Ga0207676_10701000 3300026095 Bacteria 981
222 Ga0207676_12466298 3300026095 Bacteria 517
223 Ga0207675_100291889 3300026118 Bacteria 1586
224 Ga0207675_101509477 3300026118 Bacteria 693
225 Ga0207683_10030550 3300026121 Bacteria 4668
226 Ga0207683_10253500 3300026121 Bacteria 1606
227 Ga0207698_11551884 3300026142 Bacteria 677
228 Ga0209813_10089935 3300027866 Bacteria 1029
229 Ga0207428_10052216 3300027907 Bacteria 3266
230 Ga0207428_10194910 3300027907 Bacteria 1526
231 Ga0268266_10063008 3300028379 Bacteria 3201
232 Ga0268265_10000223 3300028380 Bacteria 65865
233 Ga0268265_10000844 3300028380 Bacteria 28784
234 Ga0268265_10286469 3300028380 Bacteria 1476
235 Ga0268265_10866895 3300028380 Bacteria 884
236 Ga0265337_1017619 3300028556 Bacteria 2287
237 Ga0265326_10027949 3300028558 Unclassified 1608
238 Ga0265338_10069739 3300028800 Bacteria 3018
239 Ga0265324_10000126 3300029957 Bacteria 60652
240 Ga0265325_10029737 3300031241 Bacteria 2934
241 Ga0265339_10000001 3300031249 Bacteria 613713
242 Ga0265339_10005596 3300031249 Bacteria 8345
243 Ga0307408_100309400 3300031548 Bacteria 1327
244 Ga0307408_101298907 3300031548 Bacteria 682
245 Ga0265313_10016418 3300031595 Bacteria 4256
246 Ga0265313_10017091 3300031595 Bacteria 4139
247 Ga0307413_10039283 3300031824 Bacteria 2751
248 Ga0307410_10362229 3300031852 Bacteria 1161
249 Ga0307406_10440836 3300031901 Bacteria 1042
250 Ga0307406_10563549 3300031901 Bacteria 934
251 Ga0307407_10043852 3300031903 Bacteria 2517
252 Ga0307416_101498111 3300032002 Bacteria 780
253 Ga0307414_10029767 3300032004 Bacteria 3558
254 Ga0307414_10069117 3300032004 Bacteria 2538
255 Ga0307414_10522163 3300032004 Bacteria 1054
256 Ga0307411_10053013 3300032005 Bacteria 2655
257 Ga0307411_10970207 3300032005 Bacteria 759
258 Ga0307415_100114117 3300032126 Bacteria 2011
259 Ga0307415_100229489 3300032126 Bacteria 1494
260 Ga0373930_0000190 3300034816 Bacteria 7423
261 Ga0373950_0110703 3300034818 Bacteria 599
262 Ga0373958_0001725 3300034819 Bacteria 2969
263 Ga0373959_0002213 3300034820 Bacteria 3100
264 Ga0373938_0009388 3300034957 Bacteria 1771
265 Ga0373928_0016570 3300035084 Bacteria 1509
266 Ga0373929_0002028 3300035085 Bacteria 3770
267 Ga0373940_0002904 3300035088 Bacteria 3415
268 Ga0373944_0214359 3300035089 Bacteria 701
269 Ga0373949_0003873 3300035090 Bacteria 3477
270 Ga0373951_0000928 3300035091 Bacteria 7886
271 Ga0373952_0000354 3300035092 Bacteria 7749
272 Ga0373932_0000157 3300035112 Bacteria 19830
273 Ga0373939_0000138 3300035114 Bacteria 20969
274 Ga0373941_0006216 3300035115 Bacteria 2865
275 Ga0373960_0001327 3300035121 Bacteria 5444
276 Ga0373943_0008200 3300035170 Bacteria 4689
277 Ga0373943_0149179 3300035170 Bacteria 1266
278 Ga0373955_0610120 3300035172 Bacteria 668
279 Ga0373942_0001220 3300035207 Bacteria 6767
280 Ga0373942_0297095 3300035207 Bacteria 560
281 Ga0373961_0031744 3300035241 Bacteria 1477
282 Ga0373962_0000383 3300035242 Bacteria 9648
283 Ga0373931_0003364 3300035691 Bacteria 7168
284 Ga0373933_0518930 3300035724 Bacteria 781
285 Ga0373947_0949708 3300035725 Bacteria 587
286 Ga0373925_0071106 3300037068 Bacteria 2631
287 Ga0373925_0177483 3300037068 Bacteria 1684
288 Ga0395901_0120935 3300038443 Bacteria 2752
289 Ga0451802_2053456 3300041460 Bacteria 737
290 Ga0451807_1769661 3300041486 Unclassified 734
291 Ga0439462_0200794 3300042015 Bacteria 568
292 Ga0450896_019437 3300042133 Bacteria 989
293 Ga0450898_097736 3300042134 Bacteria 611
294 Ga0450906_076011 3300042145 Bacteria 604
295 Ga0450908_002292 3300042184 Bacteria 3743
296 Ga0439435_0253314 3300042436 Bacteria 593
297 Ga0450918_010044 3300042531 Bacteria 1653
298 Ga0453683_0367828 3300044673 Bacteria 925
299 Ga0453684_0021955 3300044712 Bacteria 9499
300 Ga0451576_0009094 3300045051 Bacteria 11560
301 Ga0451576_1615297 3300045051 Unclassified 672
302 Ga0466958_0019340 3300045836 Bacteria 3965
303 Ga0466967_0077797 3300045976 Bacteria 2987
304 Ga0495651_0877779 3300046462 Bacteria 550
305 Ga0495580_0964159 3300046472 Bacteria 545
306 Ga0495628_0312971 3300046516 Bacteria 1160
307 Ga0495666_0277294 3300046526 Bacteria 760
308 Ga0495652_0367849 3300046529 Bacteria 1026
309 Ga0495640_0382660 3300046533 Bacteria 866
310 Ga0495586_0054521 3300046535 Bacteria 2167
311 Ga0495598_0164983 3300046537 Bacteria 782
312 Ga0495645_0199419 3300046543 Bacteria 1359
313 Ga0495645_0214800 3300046543 Bacteria 1297
314 Ga0495623_0493549 3300046679 Bacteria 647
315 Ga0495646_0348017 3300046680 Bacteria 777
316 Ga0495674_0001925 3300047319 Bacteria 20491
317 Ga0495680_0407558 3300047322 Bacteria 937
318 Ga0495684_0304710 3300047471 Bacteria 1143
319 Ga0495684_0523661 3300047471 Bacteria 811
320 Ga0496101_0416384 3300048904 Bacteria 1059
321 Ga0496102_0323435 3300048905 Bacteria 1453
322 Ga0496102_0418003 3300048905 Bacteria 1259
323 Ga0496103_0298599 3300048906 Bacteria 1036
324 Ga0496107_0182537 3300048910 Bacteria 1558
325 Ga0496108_0117500 3300048911 Bacteria 2279
326 Ga0496111_0351753 3300048914 Bacteria 1091
327 Ga0496112_0077645 3300048915 Bacteria 3284
328 Ga0496113_0132094 3300048916 Bacteria 1960
329 Ga0496126_0857246 3300048929 Unclassified 692
330 Ga0501036_0233526 3300049572 Bacteria 1543
331 Ga0501036_0714652 3300049572 Bacteria 828
332 Ga0501036_1167298 3300049572 Bacteria 628
333 Ga0501036_1273976 3300049572 Bacteria 598
334 Ga0501038_0336040 3300049574 Bacteria 1179
335 Ga0501039_0025800 3300049575 Bacteria 4517
336 Ga0501039_1307099 3300049575 Bacteria 559
337 Ga0501040_0104084 3300049576 Bacteria 1982
338 Ga0501041_0194489 3300049577 Bacteria 1271
339 Ga0501041_0238820 3300049577 Bacteria 1142
340 Ga0501048_0380191 3300049582 Bacteria 1008
341 Ga0501071_0102753 3300049587 Bacteria 2108
342 Ga0501071_0131604 3300049587 Bacteria 1859
343 Ga0501072_0143339 3300049588 Bacteria 1905
344 Ga0501072_1212826 3300049588 Bacteria 586
345 Ga0501073_0943246 3300049589 Bacteria 594
346 Ga0501074_0459553 3300049590 Bacteria 902
347 Ga0501074_0723646 3300049590 Bacteria 702
348 Ga0501075_0117591 3300049591 Bacteria 2021
349 Ga0501075_0459599 3300049591 Bacteria 971
350 Ga0501076_0211235 3300049592 Bacteria 1586
351 Ga0501076_0315840 3300049592 Bacteria 1282
352 Ga0501076_0440943 3300049592 Bacteria 1072
353 Ga0501077_0031805 3300049593 Bacteria 3358
354 Ga0501077_0400191 3300049593 Bacteria 878
355 Ga0501077_0458821 3300049593 Bacteria 816
356 Ga0501236_021678 3300049670 Bacteria 955
357 Ga0501079_0267575 3300049741 Bacteria 1336
358 Ga0501079_0346859 3300049741 Bacteria 1163
359 Ga0501080_1163708 3300049742 Bacteria 664
360 Ga0501081_0560496 3300049743 Bacteria 854
361 Ga0501083_0607778 3300049744 Bacteria 711
362 Ga0501083_0864595 3300049744 Bacteria 588
363 Ga0501045_0041166 3300049824 Bacteria 3362
364 Ga0501045_0381733 3300049824 Bacteria 1049
365 nmdc:mga00v17_1424_c1 3300050491 Bacteria 12554
366 nmdc:mga00v17_256248_c1 3300050491 Bacteria 1135
367 nmdc:mga0k408_148341_c1 3300050493 Bacteria 1396
368 nmdc:mga0k408_209842_c1 3300050493 Bacteria 1163
369 nmdc:mga0k408_28201_c1 3300050493 Bacteria 3192
370 nmdc:mga06z11_16515_c1 3300050494 Bacteria 3327
371 nmdc:mga04h51_34907_c1 3300050495 Bacteria 1609
372 nmdc:mga07m45_133461_c1 3300050496 Bacteria 1437
373 nmdc:mga05p37_1101066_c1 3300050507 Bacteria 832
374 nmdc:mga05p37_131573_c1 3300050507 Bacteria 3070
375 nmdc:mga05p37_19171_c1 3300050507 Bacteria 8274
376 nmdc:mga05p37_313611_c1 3300050507 Bacteria 1858
377 nmdc:mga05p37_340485_c1 3300050507 Bacteria 1769
378 nmdc:mga05p37_590248_c1 3300050507 Bacteria 1256
379 nmdc:mga05p37_84029_c1 3300050507 Bacteria 3922
380 nmdc:mga09592_112479_c1 3300050508 Bacteria 2336
381 nmdc:mga09592_1170138_c1 3300050508 Bacteria 637
382 nmdc:mga09592_284977_c1 3300050508 Bacteria 1432
383 nmdc:mga09592_30655_c1 3300050508 Bacteria 4475
384 nmdc:mga0qj67_104575_c1 3300050509 Bacteria 2284
385 nmdc:mga0qj67_381392_c1 3300050509 Bacteria 1138
386 nmdc:mga0qj67_66578_c1 3300050509 Bacteria 2869
387 nmdc:mga06r32_1016134_c1 3300050510 Bacteria 781
388 nmdc:mga06r32_1105170_c1 3300050510 Bacteria 742
389 nmdc:mga06r32_125621_c1 3300050510 Bacteria 2533
390 nmdc:mga06r32_240521_c1 3300050510 Bacteria 1798
391 nmdc:mga06r32_291898_c1 3300050510 Bacteria 1617
392 nmdc:mga06r32_316616_c1 3300050510 Bacteria 1546
393 nmdc:mga06r32_499036_c1 3300050510 Bacteria 1194
394 nmdc:mga06r32_85_c1 3300050510 Bacteria 64050
395 nmdc:mga06r32_881769_c1 3300050510 Bacteria 852
396 nmdc:mga08y16_1153311_c1 3300050511 Bacteria 748
397 nmdc:mga08y16_20283_c1 3300050511 Bacteria 7016
398 nmdc:mga08y16_31596_c1 3300050511 Bacteria 5568
399 nmdc:mga08y16_388933_c1 3300050511 Bacteria 1429
400 nmdc:mga08y16_4052_c1 3300050511 Bacteria 15291
401 nmdc:mga0n895_17367_c1 3300050512 Bacteria 6631
402 nmdc:mga0n895_176185_c1 3300050512 Bacteria 2169
403 nmdc:mga0n895_214543_c1 3300050512 Bacteria 1954
404 nmdc:mga0n895_515900_c1 3300050512 Bacteria 1203
405 nmdc:mga0n895_699835_c1 3300050512 Bacteria 1009
406 nmdc:mga0n895_69_c1 3300050512 Bacteria 59717
407 nmdc:mga0rr50_112684_c1 3300050513 Bacteria 2155
408 nmdc:mga0rr50_19325_c1 3300050513 Bacteria 4596
409 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
410 nmdc:mga08x19_1007_c1 3300050514 Bacteria 17598
411 nmdc:mga08x19_145332_c1 3300050514 Bacteria 1604
412 nmdc:mga08x19_321812_c1 3300050514 Bacteria 1076
413 nmdc:mga0a205_1165752_c1 3300050515 Bacteria 618
414 nmdc:mga0a205_12922_c1 3300050515 Bacteria 7746
415 nmdc:mga0a205_21106_c1 3300050515 Bacteria 6159
416 nmdc:mga0a205_431364_c1 3300050515 Bacteria 1179
417 nmdc:mga0a205_479800_c1 3300050515 Bacteria 1102
418 Ga0495595_0048398 3300053084 Bacteria 1963
419 Ga0500578_0254020 3300053086 Bacteria 1058
420 Ga0500614_017155 3300053123 Bacteria 1633
421 Ga0500645_001347 3300053730 Bacteria 12702
422 Ga0500599_001005 3300053736 Bacteria 3166
423 Ga0590071_015057 3300059421 Bacteria 1814
424 Ga0590074_012069 3300059423 Bacteria 1451
425 Ga0590074_050530 3300059423 Bacteria 760
426 Ga0590075_016305 3300059424 Bacteria 1827
427 Ga0590075_028504 3300059424 Bacteria 1410
428 Ga0590077_000532 3300059426 Bacteria 10521
429 Ga0590077_006849 3300059426 Bacteria 2334
430 Ga0501082_0207893 3300060353 Bacteria 1703
431 Ga0501082_1120507 3300060353 Bacteria 688
432 Ga0501082_1187906 3300060353 Bacteria 667
433 Ga0530510_0494356 3300061734 Bacteria 927
434 Ga0501031_0376930
435 JGI25406J46586_10001149
436 Ga0070690_101430843
437 Ga0070670_100078495
438 Ga0068869_101685268
439 Ga0070682_100160623
440 Ga0070687_100053679
441 Ga0070668_100060498
442 Ga0070668_100261742
443 Ga0070668_100299000
444 Ga0070669_100028171
445 Ga0070669_100109493
446 Ga0070669_100118443
447 Ga0070675_100995188
448 Ga0070675_101163376
449 Ga0070674_100054149
450 Ga0070673_100039127
451 Ga0070673_100147199
452 Ga0070673_100316805
453 Ga0070667_100244067
454 Ga0070667_100985859
455 Ga0070713_100000219
456 Ga0070713_100020793
457 Ga0070701_10131579
458 Ga0070711_100031442
459 Ga0070711_100076168
460 Ga0070711_101583213
461 Ga0070705_100253969
462 Ga0070700_100139738
463 Ga0070700_100869053
464 Ga0070694_100191812
465 Ga0070694_100415690
466 Ga0070663_100100950
467 Ga0070678_100126399
468 Ga0070662_100090338
469 Ga0070662_100262029
470 Ga0070662_100932795
471 Ga0070681_10006263
472 Ga0070681_10618266
473 Ga0070685_10012548
474 Ga0070706_100693541
475 Ga0070707_100164279
476 Ga0070707_101754479
477 Ga0070698_100044299
478 Ga0070698_100125078
479 Ga0070679_100329779
480 Ga0070697_100676834
481 Ga0070672_100142022
482 Ga0070672_100205236
483 Ga0070686_100870988
484 Ga0070695_100981982
485 Ga0070696_100014900
486 Ga0070665_100094990
487 Ga0070665_100613885
488 Ga0070704_101676433
489 Ga0068855_100322998
490 Ga0068855_100620773
491 Ga0068855_101519862
492 Ga0068854_100736491
493 Ga0070702_100264412
494 Ga0068852_101877135
495 Ga0068859_100024871
496 Ga0068859_100149643
497 Ga0068864_100004928
498 Ga0068861_100027389
499 Ga0068861_100267500
500 Ga0068861_101735955
501 Ga0068870_10024121
502 Ga0068863_101575717
503 Ga0068858_100720881
504 Ga0068860_100052081
505 Ga0068860_101421919
506 Ga0068862_100000683
507 Ga0068862_100104936
508 Ga0068862_100156391
509 Ga0068862_100863179
510 Ga0068862_101355559
511 Ga0081455_10030240
512 Ga0081539_10000329
513 Ga0070717_10003026
514 Ga0070717_10141943
515 Ga0075368_10070049
516 Ga0075364_10012874
517 Ga0075364_10029055
518 Ga0070712_100011885
519 Ga0075362_10000363
520 Ga0075362_10302383
521 Ga0075367_10056615
522 Ga0075366_10022348
523 Ga0097621_100121565
524 Ga0097621_100709399
525 Ga0075370_10024212
526 Ga0068871_100505678
527 Ga0075428_100007291
528 Ga0075428_100019143
529 Ga0075428_100036382
530 Ga0075428_100094929
531 Ga0075428_100190126
532 Ga0075428_100256797
533 Ga0075428_100277855
534 Ga0075428_102072166
535 Ga0075430_100092864
536 Ga0075430_101461804
537 Ga0075431_100000029
538 Ga0075431_100023022
539 Ga0075431_100216945
540 Ga0075431_100283084
541 Ga0075431_100380506
542 Ga0075431_100649419
543 Ga0075431_101373097
544 Ga0075433_10034996
545 Ga0075433_10211833
546 Ga0075433_10236213
547 Ga0075433_10355421
548 Ga0075434_100001078
549 Ga0075434_100393445
550 Ga0075429_100142525
551 Ga0075429_100145995
552 Ga0075429_100250347
553 Ga0075429_101034776
554 Ga0068865_100281376
555 Ga0068865_101242315
556 Ga0075436_100001235
557 Ga0075436_100124526
558 Ga0075436_100440121
559 Ga0097620_100024872
560 Ga0097620_100149629
561 Ga0097620_101529341
562 Ga0075435_100000255
563 Ga0075435_100039837
564 Ga0075435_100046864
565 Ga0075435_100146091
566 Ga0105240_10001049
567 Ga0105240_10059121
568 Ga0111539_10000734
569 Ga0111539_10015238
570 Ga0111539_10160253
571 Ga0111539_10197188
572 Ga0111539_12219164
573 Ga0114129_10044959
574 Ga0114129_10230393
575 Ga0114129_10237904
576 Ga0114129_10596316
577 Ga0105243_10079892
578 Ga0105242_10095366
579 Ga0105248_10090967
580 Ga0105248_10697352
581 Ga0105248_11619993
582 Ga0105238_10008209
583 Ga0105249_10184200
584 Ga0105249_11534190
585 Ga0105249_12946590
586 Ga0105239_10674109
587 Ga0157374_10062004
588 Ga0157374_12333346
589 Ga0157378_11086830
590 Ga0157378_12319791
591 Ga0163162_10016849
592 Ga0163162_10862340
593 Ga0163162_12469722
594 Ga0163163_10017128
595 Ga0163163_10035659
596 Ga0163163_10211709
597 Ga0163163_12279463
598 Ga0157380_10119470
599 Ga0157380_10965850
600 Ga0157377_10301959
601 Ga0157379_10035819
602 Ga0157379_10562518
603 Ga0157376_10005067
604 Ga0157376_10953718
605 Ga0182005_1042836
606 Ga0163161_11137074
607 Ga0207697_10154181
608 Ga0207697_10324173
609 Ga0207642_10116856
610 Ga0207680_10644553
611 Ga0207647_10078711
612 Ga0207699_10106622
613 Ga0207645_10016151
614 Ga0207643_10147998
615 Ga0207707_10030220
616 Ga0207707_10784641
617 Ga0207695_10003747
618 Ga0207695_10007040
619 Ga0207671_10002278
620 Ga0207671_10188117
621 Ga0207693_10019292
622 Ga0207663_10154127
623 Ga0207662_10062024
624 Ga0207646_10153518
625 Ga0207681_10280668
626 Ga0207694_10004840
627 Ga0207659_10152448
628 Ga0207700_10000651
629 Ga0207700_10407329
630 Ga0207664_10089661
631 Ga0207664_10470478
632 Ga0207706_10039407
633 Ga0207706_10188564
634 Ga0207709_10328226
635 Ga0207669_10053277
636 Ga0207691_10007316
637 Ga0207691_10040324
638 Ga0207691_10173330
639 Ga0207711_10011937
640 Ga0207689_10087950
641 Ga0207689_10864534
642 Ga0207661_10145197
643 Ga0207667_10246777
644 Ga0207667_10546578
645 Ga0207667_10728503
646 Ga0207651_10221662
647 Ga0207712_10567653
648 Ga0207668_10187057
649 Ga0207668_10234126
650 Ga0207640_10080112
651 Ga0207658_10083248
652 Ga0207677_10053474
653 Ga0207703_11417030
654 Ga0207676_10701000
655 Ga0207676_12466298
656 Ga0207675_100291889
657 Ga0207675_101509477
658 Ga0207683_10030550
659 Ga0207683_10253500
660 Ga0207698_11551884
661 Ga0209813_10089935
662 Ga0207428_10052216
663 Ga0207428_10194910
664 Ga0268266_10063008
665 Ga0268265_10000223
666 Ga0268265_10000844
667 Ga0268265_10286469
668 Ga0268265_10866895
669 Ga0265337_1017619
670 Ga0265326_10027949
671 Ga0265338_10069739
672 Ga0265324_10000126
673 Ga0265325_10029737
674 Ga0265339_10000001
675 Ga0265339_10005596
676 Ga0307408_100309400
677 Ga0307408_101298907
678 Ga0265313_10016418
679 Ga0265313_10017091
680 Ga0307413_10039283
681 Ga0307410_10362229
682 Ga0307406_10440836
683 Ga0307406_10563549
684 Ga0307407_10043852
685 Ga0307416_101498111
686 Ga0307414_10029767
687 Ga0307414_10069117
688 Ga0307414_10522163
689 Ga0307411_10053013
690 Ga0307411_10970207
691 Ga0307415_100114117
692 Ga0307415_100229489
693 Ga0373930_0000190
694 Ga0373950_0110703
695 Ga0373958_0001725
696 Ga0373959_0002213
697 Ga0373938_0009388
698 Ga0373928_0016570
699 Ga0373929_0002028
700 Ga0373940_0002904
701 Ga0373944_0214359
702 Ga0373949_0003873
703 Ga0373951_0000928
704 Ga0373952_0000354
705 Ga0373932_0000157
706 Ga0373939_0000138
707 Ga0373941_0006216
708 Ga0373960_0001327
709 Ga0373943_0008200
710 Ga0373943_0149179
711 Ga0373955_0610120
712 Ga0373942_0001220
713 Ga0373942_0297095
714 Ga0373961_0031744
715 Ga0373962_0000383
716 Ga0373931_0003364
717 Ga0373933_0518930
718 Ga0373947_0949708
719 Ga0373925_0071106
720 Ga0373925_0177483
721 Ga0395901_0120935
722 Ga0451802_2053456
723 Ga0451807_1769661
724 Ga0439462_0200794
725 Ga0450896_019437
726 Ga0450898_097736
727 Ga0450906_076011
728 Ga0450908_002292
729 Ga0439435_0253314
730 Ga0450918_010044
731 Ga0453683_0367828
732 Ga0453684_0021955
733 Ga0451576_0009094
734 Ga0451576_1615297
735 Ga0466958_0019340
736 Ga0466967_0077797
737 Ga0495651_0877779
738 Ga0495580_0964159
739 Ga0495628_0312971
740 Ga0495666_0277294
741 Ga0495652_0367849
742 Ga0495640_0382660
743 Ga0495586_0054521
744 Ga0495598_0164983
745 Ga0495645_0199419
746 Ga0495645_0214800
747 Ga0495623_0493549
748 Ga0495646_0348017
749 Ga0495674_0001925
750 Ga0495680_0407558
751 Ga0495684_0304710
752 Ga0495684_0523661
753 Ga0496101_0416384
754 Ga0496102_0323435
755 Ga0496102_0418003
756 Ga0496103_0298599
757 Ga0496107_0182537
758 Ga0496108_0117500
759 Ga0496111_0351753
760 Ga0496112_0077645
761 Ga0496113_0132094
762 Ga0496126_0857246
763 Ga0501036_0233526
764 Ga0501036_0714652
765 Ga0501036_1167298
766 Ga0501036_1273976
767 Ga0501038_0336040
768 Ga0501039_0025800
769 Ga0501039_1307099
770 Ga0501040_0104084
771 Ga0501041_0194489
772 Ga0501041_0238820
773 Ga0501048_0380191
774 Ga0501071_0102753
775 Ga0501071_0131604
776 Ga0501072_0143339
777 Ga0501072_1212826
778 Ga0501073_0943246
779 Ga0501074_0459553
780 Ga0501074_0723646
781 Ga0501075_0117591
782 Ga0501075_0459599
783 Ga0501076_0211235
784 Ga0501076_0315840
785 Ga0501076_0440943
786 Ga0501077_0031805
787 Ga0501077_0400191
788 Ga0501077_0458821
789 Ga0501236_021678
790 Ga0501079_0267575
791 Ga0501079_0346859
792 Ga0501080_1163708
793 Ga0501081_0560496
794 Ga0501083_0607778
795 Ga0501083_0864595
796 Ga0501045_0041166
797 Ga0501045_0381733
798 nmdc:mga00v17_1424_c1
799 nmdc:mga00v17_256248_c1
800 nmdc:mga0k408_148341_c1
801 nmdc:mga0k408_209842_c1
802 nmdc:mga0k408_28201_c1
803 nmdc:mga06z11_16515_c1
804 nmdc:mga04h51_34907_c1
805 nmdc:mga07m45_133461_c1
806 nmdc:mga05p37_1101066_c1
807 nmdc:mga05p37_131573_c1
808 nmdc:mga05p37_19171_c1
809 nmdc:mga05p37_313611_c1
810 nmdc:mga05p37_340485_c1
811 nmdc:mga05p37_590248_c1
812 nmdc:mga05p37_84029_c1
813 nmdc:mga09592_112479_c1
814 nmdc:mga09592_1170138_c1
815 nmdc:mga09592_284977_c1
816 nmdc:mga09592_30655_c1
817 nmdc:mga0qj67_104575_c1
818 nmdc:mga0qj67_381392_c1
819 nmdc:mga0qj67_66578_c1
820 nmdc:mga06r32_1016134_c1
821 nmdc:mga06r32_1105170_c1
822 nmdc:mga06r32_125621_c1
823 nmdc:mga06r32_240521_c1
824 nmdc:mga06r32_291898_c1
825 nmdc:mga06r32_316616_c1
826 nmdc:mga06r32_499036_c1
827 nmdc:mga06r32_85_c1
828 nmdc:mga06r32_881769_c1
829 nmdc:mga08y16_1153311_c1
830 nmdc:mga08y16_20283_c1
831 nmdc:mga08y16_31596_c1
832 nmdc:mga08y16_388933_c1
833 nmdc:mga08y16_4052_c1
834 nmdc:mga0n895_17367_c1
835 nmdc:mga0n895_176185_c1
836 nmdc:mga0n895_214543_c1
837 nmdc:mga0n895_515900_c1
838 nmdc:mga0n895_699835_c1
839 nmdc:mga0n895_69_c1
840 nmdc:mga0rr50_112684_c1
841 nmdc:mga0rr50_19325_c1
842 nmdc:mga0rr50_4_c1
843 nmdc:mga08x19_1007_c1
844 nmdc:mga08x19_145332_c1
845 nmdc:mga08x19_321812_c1
846 nmdc:mga0a205_1165752_c1
847 nmdc:mga0a205_12922_c1
848 nmdc:mga0a205_21106_c1
849 nmdc:mga0a205_431364_c1
850 nmdc:mga0a205_479800_c1
851 Ga0495595_0048398
852 Ga0500578_0254020
853 Ga0500614_017155
854 Ga0500645_001347
855 Ga0500599_001005
856 Ga0590071_015057
857 Ga0590074_012069
858 Ga0590074_050530
859 Ga0590075_016305
860 Ga0590075_028504
861 Ga0590077_000532
862 Ga0590077_006849
863 Ga0501082_0207893
864 Ga0501082_1120507
865 Ga0501082_1187906
866 Ga0530510_0494356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13564

DoxX_2

DoxX-like family

50

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5492 24 145
2yfb-assembly1.cif.gz_A x-ray structure of mcps ligand binding domain in complex with succinate 0.5486 27 145
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5314 24 145
6ek9-assembly1.cif.gz_A cytosolic copper storage protein csp from streptomyces lividans: cu loaded form 0.5202 28 143
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.5117 27 139
ID Description Score Start End Superfamily
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7891 37 134 1.20.120.550
af_P37147_6_115_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6853 31 89 1.10.1760.20
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.68 27 144 1.20.120.550
af_Q9SKX2_35_174_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.655 10 139 1.20.140.40
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.654 37 134 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7K1TAW6-F1-model_v4 DoxX family protein 0.9791 28 142 GO:0016020
AF-A0A534Y8E3-F1-model_v4 DoxX family protein 0.9736 27 145 GO:0016020
AF-A0A4V2AIN1-F1-model_v4 DoxX family protein 0.9704 27 143 GO:0016020
AF-A0A7G8BS25-F1-model_v4 DoxX family protein 0.9694 28 144 GO:0016020
AF-A0A5C7AXV0-F1-model_v4 DoxX family protein 0.966 29 143 GO:0016020

Map