F442911

General Info

Members Datasets Scaffolds Average Seq Length
433 252 866 314

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0003977|Ga0466967_0003977_924_2045
Length 361
Sequence VHDLRHEAAPDDADPDPGTVHQSSATLEKSPTLDKGNAFVQGSGRRMEPSTTAPIALLTDALEHRSLDDVLEWCAERGVEGVELGVGGYSPAPHLALDELLEDDGARAALLERLDAHGIELVALNASGNPLHPDREVAAAHSRALRGAITLAGRLGVPRVVAMSGCPGGPGGGAWPVFAEHQWRHAIAPYWRELSPWAEHEAPGVAICLELHPGTSIYNAASFAVLAEVTGDNVMVNLDPSHFWWQGIDPVSTVRALEGRIGFAHGKDTVVHRDRVALHGVLDFRWPADADTMPWHFCAVGRGRPAEEWRTLLGALADAGYDGPVSIEHEDPQLDPEAGIEASLAGLRAAQAIPVPADRGG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
248 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 0
Rhizoplane 7.39
Rhizosphere 86.37
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0003977 3300045976 Bacteria 9842
2 JGI25406J46586_10022649 3300003203 Bacteria 2498
3 JGI25165J46597_1002959 3300003214 Bacteria 4729
4 JGI25153J46596_10000042 3300003215 Bacteria 161788
5 rootH1_10173927 3300003316 Bacteria 1671
6 Ga0070658_10009660 3300005327 Bacteria 7747
7 Ga0070658_10011020 3300005327 Bacteria 7247
8 Ga0070676_10161796 3300005328 Bacteria 1441
9 Ga0070683_100023495 3300005329 Bacteria 5514
10 Ga0070683_100078762 3300005329 Bacteria 3083
11 Ga0070683_100211908 3300005329 Bacteria 1840
12 Ga0070683_100279795 3300005329 Bacteria 1587
13 Ga0068869_100016565 3300005334 Bacteria 4970
14 Ga0070682_100057495 3300005337 Bacteria 2450
15 Ga0068868_100237770 3300005338 Bacteria 1529
16 Ga0070660_100000505 3300005339 Bacteria 26077
17 Ga0070660_100262299 3300005339 Bacteria 1411
18 Ga0070691_10088920 3300005341 Bacteria 1521
19 Ga0070661_100001193 3300005344 Bacteria 18336
20 Ga0070661_100104833 3300005344 Unclassified 2107
21 Ga0070692_10013742 3300005345 Bacteria 3782
22 Ga0070668_100007109 3300005347 Bacteria 8295
23 Ga0070668_100447138 3300005347 Bacteria 1110
24 Ga0070671_100156371 3300005355 Bacteria 1926
25 Ga0070674_100067082 3300005356 Bacteria 2523
26 Ga0070673_100189116 3300005364 Bacteria 1767
27 Ga0070659_100025487 3300005366 Bacteria 4542
28 Ga0070659_100025739 3300005366 Bacteria 4524
29 Ga0070709_10040470 3300005434 Bacteria 2866
30 Ga0070709_10095632 3300005434 Bacteria 1968
31 Ga0070714_100061285 3300005435 Bacteria 3231
32 Ga0070714_100158318 3300005435 Bacteria 2047
33 Ga0070710_10065151 3300005437 Bacteria 2086
34 Ga0070711_100096657 3300005439 Bacteria 2140
35 Ga0070711_100232669 3300005439 Bacteria 1437
36 Ga0070705_100007849 3300005440 Bacteria 5271
37 Ga0070705_100059295 3300005440 Bacteria 2266
38 Ga0070700_100016623 3300005441 Bacteria 4195
39 Ga0070708_100009895 3300005445 Bacteria 7705
40 Ga0070708_100066243 3300005445 Bacteria 3241
41 Ga0070708_100068744 3300005445 Bacteria 3184
42 Ga0070678_100001947 3300005456 Bacteria 11138
43 Ga0070678_100309801 3300005456 Bacteria 1345
44 Ga0070681_10001391 3300005458 Bacteria 21212
45 Ga0068867_100096621 3300005459 Bacteria 2250
46 Ga0070685_10010936 3300005466 Bacteria 4732
47 Ga0070706_100003028 3300005467 Bacteria 16641
48 Ga0070707_100005067 3300005468 Bacteria 12354
49 Ga0070698_100004175 3300005471 Bacteria 15869
50 Ga0070679_100020920 3300005530 Bacteria 6383
51 Ga0070679_100309789 3300005530 Bacteria 1529
52 Ga0070684_100120873 3300005535 Bacteria 2356
53 Ga0070697_100321395 3300005536 Bacteria 1333
54 Ga0068853_100000840 3300005539 Bacteria 21448
55 Ga0068853_100102698 3300005539 Bacteria 2530
56 Ga0068853_100184434 3300005539 Bacteria 1893
57 Ga0070696_100122135 3300005546 Bacteria 1886
58 Ga0070693_100074340 3300005547 Bacteria 2010
59 Ga0070693_100154672 3300005547 Bacteria 1455
60 Ga0070665_100003309 3300005548 Bacteria 17257
61 Ga0070665_100079492 3300005548 Bacteria 3285
62 Ga0070665_100420035 3300005548 Bacteria 1346
63 Ga0068855_100005909 3300005563 Bacteria 14926
64 Ga0068855_100059071 3300005563 Bacteria 4488
65 Ga0068855_100117963 3300005563 Bacteria 3040
66 Ga0068855_100196813 3300005563 Bacteria 2270
67 Ga0068857_100106470 3300005577 Bacteria 2518
68 Ga0068857_100183827 3300005577 Bacteria 1902
69 Ga0068854_100007813 3300005578 Bacteria 6843
70 Ga0068854_100074102 3300005578 Bacteria 2497
71 Ga0068856_100068782 3300005614 Bacteria 3500
72 Ga0068856_100230218 3300005614 Bacteria 1869
73 Ga0068856_100263291 3300005614 Bacteria 1740
74 Ga0068856_100355329 3300005614 Bacteria 1484
75 Ga0070702_100165062 3300005615 Unclassified 1435
76 Ga0068852_100028968 3300005616 Bacteria 4541
77 Ga0068852_100105840 3300005616 Bacteria 2549
78 Ga0068859_100199059 3300005617 Bacteria 2088
79 Ga0068859_100472717 3300005617 Bacteria 1349
80 Ga0068864_100033343 3300005618 Bacteria 4378
81 Ga0068866_10004843 3300005718 Bacteria 5525
82 Ga0068866_10015530 3300005718 Bacteria 3383
83 Ga0068851_10047398 3300005834 Unclassified 2176
84 Ga0068851_10054294 3300005834 Bacteria 2040
85 Ga0068863_100130729 3300005841 Bacteria 2397
86 Ga0068858_100018511 3300005842 Bacteria 6521
87 Ga0068858_100056534 3300005842 Bacteria 3626
88 Ga0068858_100107305 3300005842 Bacteria 2606
89 Ga0068858_100131298 3300005842 Bacteria 2349
90 Ga0068862_100010310 3300005844 Bacteria 7710
91 Ga0081455_10054442 3300005937 Bacteria 3410
92 Ga0081539_10000926 3300005985 Bacteria 55157
93 Ga0081539_10054635 3300005985 Unclassified 2228
94 Ga0070717_10212701 3300006028 Bacteria 1697
95 Ga0070715_10003758 3300006163 Bacteria 4890
96 Ga0070716_100054775 3300006173 Bacteria 2280
97 Ga0070716_100106021 3300006173 Bacteria 1732
98 Ga0097621_100058440 3300006237 Bacteria 3155
99 Ga0097621_100068564 3300006237 Bacteria 2926
100 Ga0068871_100165891 3300006358 Bacteria 1891
101 Ga0075428_100115286 3300006844 Bacteria 2927
102 Ga0075430_100025553 3300006846 Bacteria 5026
103 Ga0068865_100107971 3300006881 Bacteria 2048
104 Ga0075436_100000565 3300006914 Bacteria 24133
105 Ga0097620_100199051 3300006931 Bacteria 2088
106 Ga0097620_100472697 3300006931 Bacteria 1349
107 Ga0099794_10021005 3300007265 Unclassified 2963
108 Ga0105240_10098031 3300009093 Bacteria 3571
109 Ga0111539_10539189 3300009094 Bacteria 1359
110 Ga0105245_10006968 3300009098 Bacteria 9912
111 Ga0105245_10031789 3300009098 Bacteria 4673
112 Ga0105245_10122536 3300009098 Bacteria 2430
113 Ga0105245_10131055 3300009098 Bacteria 2352
114 Ga0105245_10360683 3300009098 Bacteria 1442
115 Ga0105247_10015862 3300009101 Bacteria 4511
116 Ga0105247_10213101 3300009101 Bacteria 1304
117 Ga0114129_10035157 3300009147 Bacteria 7080
118 Ga0114129_10110478 3300009147 Bacteria 3794
119 Ga0114129_10118961 3300009147 Bacteria 3639
120 Ga0105243_10016438 3300009148 Bacteria 5596
121 Ga0105243_10031906 3300009148 Bacteria 4065
122 Ga0105241_10002202 3300009174 Bacteria 14667
123 Ga0105241_10045954 3300009174 Bacteria 3314
124 Ga0105241_10327370 3300009174 Bacteria 1323
125 Ga0105242_10017044 3300009176 Bacteria 5656
126 Ga0105248_10301121 3300009177 Unclassified 1805
127 Ga0105237_10000158 3300009545 Bacteria 96082
128 Ga0105237_10162342 3300009545 Bacteria 2233
129 Ga0105238_10054540 3300009551 Bacteria 4014
130 Ga0105238_10133730 3300009551 Bacteria 2458
131 Ga0105238_10153638 3300009551 Bacteria 2276
132 Ga0105238_10156096 3300009551 Bacteria 2257
133 Ga0105238_10260364 3300009551 Unclassified 1714
134 Ga0105249_10107832 3300009553 Bacteria 2629
135 Ga0105249_10189017 3300009553 Bacteria 2009
136 Ga0105239_10009578 3300010375 Bacteria 10897
137 Ga0105239_10110560 3300010375 Bacteria 3046
138 Ga0105239_10399890 3300010375 Bacteria 1554
139 Ga0105239_10497492 3300010375 Bacteria 1386
140 Ga0157371_10064297 3300013102 Bacteria 2600
141 Ga0157370_10092099 3300013104 Bacteria 2845
142 Ga0157370_10121790 3300013104 Unclassified 2435
143 Ga0157369_10020342 3300013105 Bacteria 7420
144 Ga0157369_10072604 3300013105 Bacteria 3694
145 Ga0157369_10154130 3300013105 Bacteria 2428
146 Ga0157374_10005197 3300013296 Bacteria 10915
147 Ga0157374_10080164 3300013296 Bacteria 3095
148 Ga0157378_10003453 3300013297 Bacteria 14020
149 Ga0157378_10050442 3300013297 Bacteria 3704
150 Ga0163162_10048252 3300013306 Bacteria 4266
151 Ga0157372_10023316 3300013307 Bacteria 6708
152 Ga0157372_10039718 3300013307 Bacteria 5195
153 Ga0157372_10266393 3300013307 Bacteria 1990
154 Ga0157372_10475363 3300013307 Bacteria 1457
155 Ga0157375_10046345 3300013308 Bacteria 4237
156 Ga0163163_10005216 3300014325 Bacteria 11209
157 Ga0163163_10086592 3300014325 Bacteria 3142
158 Ga0163163_10230569 3300014325 Bacteria 1901
159 Ga0157380_10069924 3300014326 Bacteria 2834
160 Ga0157377_10015421 3300014745 Bacteria 3909
161 Ga0157377_10050815 3300014745 Bacteria 2336
162 Ga0157379_10001135 3300014968 Bacteria 21791
163 Ga0157379_10006641 3300014968 Bacteria 9981
164 Ga0157379_10045069 3300014968 Bacteria 3937
165 Ga0157379_10132733 3300014968 Bacteria 2242
166 Ga0157376_10010876 3300014969 Bacteria 6683
167 Ga0157376_10025081 3300014969 Bacteria 4692
168 Ga0163161_10029016 3300017792 Bacteria 3932
169 Ga0206353_11798318 3300020082 Bacteria 1587
170 Ga0213876_10077192 3300021384 Bacteria 1759
171 Ga0209233_1000539 3300025261 Bacteria 21403
172 Ga0209758_1000110 3300025297 Bacteria 213110
173 Ga0209758_1037323 3300025297 Unclassified 1880
174 Ga0209050_1020575 3300025298 Bacteria 2449
175 Ga0207426_1015258 3300025302 Bacteria 2790
176 Ga0209257_1000376 3300025304 Bacteria 89065
177 Ga0207656_10000402 3300025321 Bacteria 14536
178 Ga0207656_10055292 3300025321 Bacteria 1727
179 Ga0207642_10066881 3300025899 Bacteria 1694
180 Ga0207688_10001943 3300025901 Bacteria 11071
181 Ga0207647_10069919 3300025904 Bacteria 2121
182 Ga0207685_10012686 3300025905 Bacteria 2580
183 Ga0207685_10030975 3300025905 Bacteria 1910
184 Ga0207699_10255409 3300025906 Bacteria 1209
185 Ga0207645_10010596 3300025907 Bacteria 6324
186 Ga0207705_10145540 3300025909 Bacteria 1772
187 Ga0207684_10000259 3300025910 Bacteria 78593
188 Ga0207654_10002642 3300025911 Bacteria 9096
189 Ga0207654_10014400 3300025911 Bacteria 4086
190 Ga0207707_10040149 3300025912 Bacteria 4088
191 Ga0207695_10027919 3300025913 Bacteria 6273
192 Ga0207671_10000795 3300025914 Bacteria 39998
193 Ga0207671_10025925 3300025914 Bacteria 4398
194 Ga0207693_10216545 3300025915 Unclassified 1505
195 Ga0207693_10264716 3300025915 Bacteria 1348
196 Ga0207663_10156861 3300025916 Bacteria 1602
197 Ga0207660_10045262 3300025917 Bacteria 3100
198 Ga0207657_10002487 3300025919 Bacteria 19926
199 Ga0207657_10026309 3300025919 Bacteria 5349
200 Ga0207649_10001642 3300025920 Bacteria 12972
201 Ga0207649_10151556 3300025920 Bacteria 1597
202 Ga0207652_10061947 3300025921 Bacteria 3232
203 Ga0207646_10000368 3300025922 Bacteria 60057
204 Ga0207646_10043934 3300025922 Bacteria 4011
205 Ga0207694_10087953 3300025924 Bacteria 2448
206 Ga0207694_10099728 3300025924 Bacteria 2300
207 Ga0207694_10378229 3300025924 Bacteria 1175
208 Ga0207650_10098588 3300025925 Bacteria 2245
209 Ga0207659_10328224 3300025926 Bacteria 1264
210 Ga0207687_10035244 3300025927 Bacteria 3403
211 Ga0207664_10112692 3300025929 Bacteria 2264
212 Ga0207664_10337462 3300025929 Bacteria 1332
213 Ga0207644_10100505 3300025931 Bacteria 2172
214 Ga0207644_10161968 3300025931 Bacteria 1740
215 Ga0207690_10088021 3300025932 Bacteria 2187
216 Ga0207690_10199730 3300025932 Bacteria 1518
217 Ga0207665_10060046 3300025939 Bacteria 2574
218 Ga0207711_10399997 3300025941 Bacteria 1276
219 Ga0207689_10216342 3300025942 Bacteria 1583
220 Ga0207661_10028946 3300025944 Bacteria 4249
221 Ga0207661_10033339 3300025944 Bacteria 3997
222 Ga0207667_10000532 3300025949 Bacteria 50220
223 Ga0207667_10199886 3300025949 Bacteria 2051
224 Ga0207712_10113952 3300025961 Bacteria 2033
225 Ga0207712_10222801 3300025961 Bacteria 1509
226 Ga0207668_10078593 3300025972 Bacteria 2383
227 Ga0207640_10032311 3300025981 Unclassified 3244
228 Ga0207640_10050418 3300025981 Bacteria 2700
229 Ga0207703_10040385 3300026035 Bacteria 3733
230 Ga0207703_10093587 3300026035 Bacteria 2531
231 Ga0207703_10093693 3300026035 Bacteria 2530
232 Ga0207639_10001963 3300026041 Bacteria 13822
233 Ga0207639_10186437 3300026041 Bacteria 1769
234 Ga0207639_10492862 3300026041 Bacteria 1118
235 Ga0207678_10000451 3300026067 Bacteria 37361
236 Ga0207708_10029185 3300026075 Bacteria 4179
237 Ga0207702_10027207 3300026078 Bacteria 4750
238 Ga0207702_10030627 3300026078 Bacteria 4483
239 Ga0207702_10078139 3300026078 Bacteria 2864
240 Ga0207702_10245968 3300026078 Unclassified 1677
241 Ga0207648_10029722 3300026089 Bacteria 4846
242 Ga0207648_10174695 3300026089 Bacteria 1899
243 Ga0207676_10089970 3300026095 Bacteria 2517
244 Ga0207674_10027855 3300026116 Bacteria 5969
245 Ga0207674_10073830 3300026116 Bacteria 3423
246 Ga0207674_10112918 3300026116 Bacteria 2690
247 Ga0207674_10155127 3300026116 Unclassified 2245
248 Ga0207683_10000112 3300026121 Bacteria 65912
249 Ga0207698_10031803 3300026142 Bacteria 3814
250 Ga0207698_10069560 3300026142 Bacteria 2784
251 Ga0268266_10000350 3300028379 Bacteria 71708
252 Ga0268266_10018486 3300028379 Bacteria 5939
253 Ga0268266_10030678 3300028379 Bacteria 4566
254 Ga0268266_10567243 3300028379 Bacteria 1089
255 Ga0268265_10234020 3300028380 Bacteria 1616
256 Ga0265319_1021857 3300028563 Bacteria 2342
257 Ga0265319_1032338 3300028563 Bacteria 1815
258 Ga0265334_10086063 3300028573 Bacteria 1153
259 Ga0265318_10010390 3300028577 Bacteria 4057
260 Ga0265318_10033795 3300028577 Bacteria 1973
261 Ga0307517_10129411 3300028786 Bacteria 1825
262 Ga0307515_10323682 3300028794 Unclassified 1206
263 Ga0265320_10070889 3300031240 Unclassified 1642
264 Ga0265325_10010302 3300031241 Bacteria 5420
265 Ga0265325_10041962 3300031241 Bacteria 2395
266 Ga0265340_10001823 3300031247 Bacteria 12180
267 Ga0265340_10006204 3300031247 Bacteria 6590
268 Ga0265340_10009681 3300031247 Bacteria 5165
269 Ga0265340_10030122 3300031247 Unclassified 2722
270 Ga0265340_10042908 3300031247 Unclassified 2219
271 Ga0265339_10006015 3300031249 Bacteria 8019
272 Ga0265339_10032521 3300031249 Bacteria 2942
273 Ga0265339_10051148 3300031249 Bacteria 2256
274 Ga0265339_10079953 3300031249 Bacteria 1729
275 Ga0265331_10005414 3300031250 Bacteria 7709
276 Ga0265331_10111014 3300031250 Bacteria 1257
277 Ga0265327_10025728 3300031251 Bacteria 3425
278 Ga0265316_10016697 3300031344 Bacteria 6362
279 Ga0307513_10043245 3300031456 Bacteria 4951
280 Ga0265313_10000079 3300031595 Bacteria 95515
281 Ga0265313_10000517 3300031595 Bacteria 40394
282 Ga0265313_10016433 3300031595 Bacteria 4254
283 Ga0265313_10020086 3300031595 Bacteria 3697
284 Ga0265314_10025134 3300031711 Bacteria 4499
285 Ga0265314_10053024 3300031711 Bacteria 2815
286 Ga0265342_10008204 3300031712 Bacteria 7524
287 Ga0265342_10071120 3300031712 Bacteria 2028
288 Ga0373926_0005636 3300035083 Bacteria 4130
289 Ga0373931_0123053 3300035691 Bacteria 1485
290 Ga0373935_0484859 3300035692 Bacteria 896
291 Ga0373927_0251507 3300035695 Unclassified 1162
292 Ga0373937_0009408 3300036401 Bacteria 8494
293 Ga0373925_0194452 3300037068 Bacteria 1611
294 Ga0395901_0041170 3300038443 Bacteria 4786
295 Ga0395901_0148353 3300038443 Bacteria 2465
296 Ga0436365_1666566 3300039437 Bacteria 2398
297 Ga0466965_0038239 3300044683 Bacteria 2357
298 Ga0466963_0001483 3300044694 Bacteria 12682
299 Ga0466963_0003892 3300044694 Bacteria 8623
300 Ga0466963_0007287 3300044694 Bacteria 6596
301 Ga0466963_0024534 3300044694 Bacteria 3839
302 Ga0466963_0097649 3300044694 Bacteria 2007
303 Ga0466964_0045707 3300044706 Bacteria 1783
304 Ga0466971_0001178 3300044719 Bacteria 10864
305 Ga0466957_0000797 3300044842 Bacteria 16099
306 Ga0466957_0043533 3300044842 Bacteria 2719
307 Ga0466960_0030621 3300044901 Bacteria 2478
308 Ga0451576_0229229 3300045051 Bacteria 1940
309 Ga0466958_0001019 3300045836 Bacteria 12743
310 Ga0466967_0008132 3300045976 Bacteria 7655
311 Ga0466967_0016234 3300045976 Bacteria 5863
312 Ga0466967_0058817 3300045976 Bacteria 3399
313 Ga0466967_0061525 3300045976 Bacteria 3331
314 Ga0466967_0125862 3300045976 Bacteria 2373
315 Ga0466967_0177841 3300045976 Bacteria 2005
316 Ga0466967_0203592 3300045976 Bacteria 1875
317 Ga0466967_0253838 3300045976 Bacteria 1681
318 Ga0466967_0265504 3300045976 Bacteria 1643
319 Ga0466967_0330430 3300045976 Bacteria 1472
320 Ga0466967_0335616 3300045976 Bacteria 1461
321 Ga0466967_0426854 3300045976 Bacteria 1293
322 Ga0466967_0464766 3300045976 Bacteria 1238
323 Ga0466967_0658736 3300045976 Bacteria 1036
324 Ga0495592_0027249 3300046454 Bacteria 4332
325 Ga0495651_0012562 3300046462 Bacteria 6535
326 Ga0495608_0022794 3300046511 Bacteria 4295
327 Ga0495652_0036825 3300046529 Bacteria 4249
328 Ga0495640_0016327 3300046533 Bacteria 5557
329 Ga0495587_0009515 3300046536 Bacteria 6224
330 Ga0495667_0018526 3300046559 Bacteria 4703
331 Ga0495624_0088356 3300046690 Bacteria 1913
332 Ga0495600_0019182 3300046809 Bacteria 4364
333 Ga0495674_0055308 3300047319 Bacteria 3481
334 Ga0495676_0144714 3300047321 Bacteria 1699
335 Ga0495675_0119095 3300047444 Bacteria 1644
336 Ga0495684_0206776 3300047471 Unclassified 1445
337 Ga0495686_0053258 3300047472 Bacteria 2536
338 Ga0495686_0101076 3300047472 Unclassified 1739
339 Ga0495593_0043268 3300047673 Bacteria 2414
340 Ga0496101_0044009 3300048904 Bacteria 3193
341 Ga0496101_0187412 3300048904 Bacteria 1595
342 Ga0496101_0295576 3300048904 Bacteria 1268
343 Ga0496102_0209135 3300048905 Unclassified 1840
344 Ga0496102_0314212 3300048905 Unclassified 1476
345 Ga0496102_0412716 3300048905 Bacteria 1268
346 Ga0496103_0273728 3300048906 Bacteria 1086
347 Ga0496104_0002139 3300048907 Bacteria 17151
348 Ga0496104_0009074 3300048907 Bacteria 8841
349 Ga0496104_0012522 3300048907 Bacteria 7628
350 Ga0496105_0007390 3300048908 Bacteria 8506
351 Ga0496105_0023461 3300048908 Bacteria 5004
352 Ga0496106_0023728 3300048909 Bacteria 4558
353 Ga0496106_0028438 3300048909 Unclassified 4165
354 Ga0496106_0034723 3300048909 Bacteria 3768
355 Ga0496106_0045381 3300048909 Bacteria 3301
356 Ga0496108_0011199 3300048911 Bacteria 7288
357 Ga0496108_0011305 3300048911 Bacteria 7252
358 Ga0496108_0122662 3300048911 Bacteria 2230
359 Ga0496109_0087643 3300048912 Bacteria 2875
360 Ga0496110_0016110 3300048913 Bacteria 6234
361 Ga0496111_0024269 3300048914 Bacteria 4267
362 Ga0496111_0043750 3300048914 Bacteria 3219
363 Ga0496111_0143774 3300048914 Bacteria 1768
364 Ga0496112_0158659 3300048915 Bacteria 2229
365 Ga0496112_0184705 3300048915 Bacteria 2049
366 Ga0496112_0343056 3300048915 Bacteria 1437
367 Ga0496112_0655264 3300048915 Unclassified 979
368 Ga0496113_0051339 3300048916 Bacteria 3077
369 Ga0496114_0011168 3300048917 Bacteria 7171
370 Ga0496114_0019275 3300048917 Bacteria 5527
371 Ga0496114_0186127 3300048917 Bacteria 1815
372 Ga0501034_0160469 3300049571 Bacteria 2220
373 Ga0501036_0078005 3300049572 Bacteria 2802
374 Ga0501038_0055247 3300049574 Bacteria 3412
375 Ga0501038_0221577 3300049574 Bacteria 1509
376 Ga0501040_0080228 3300049576 Unclassified 2260
377 Ga0501041_0039720 3300049577 Bacteria 2856
378 Ga0501043_0052788 3300049579 Bacteria 3192
379 Ga0501043_0283263 3300049579 Bacteria 1270
380 Ga0501046_0183403 3300049580 Bacteria 1564
381 Ga0501047_0024496 3300049581 Bacteria 5791
382 Ga0501047_0147024 3300049581 Bacteria 2233
383 Ga0501047_0279172 3300049581 Bacteria 1515
384 Ga0501048_0062302 3300049582 Bacteria 2640
385 Ga0501069_0043723 3300049585 Bacteria 2480
386 Ga0501070_0058120 3300049586 Bacteria 3206
387 Ga0501070_0203865 3300049586 Bacteria 1624
388 Ga0501070_0248235 3300049586 Bacteria 1456
389 Ga0501073_0119927 3300049589 Unclassified 1823
390 Ga0501073_0271584 3300049589 Unclassified 1170
391 Ga0501075_0029906 3300049591 Bacteria 4030
392 Ga0501076_0299776 3300049592 Bacteria 1318
393 Ga0501077_0002086 3300049593 Bacteria 12051
394 Ga0501077_0093013 3300049593 Bacteria 1911
395 Ga0501079_0020075 3300049741 Bacteria 5105
396 Ga0501079_0034627 3300049741 Bacteria 3886
397 Ga0501079_0250259 3300049741 Bacteria 1385
398 Ga0501080_0013710 3300049742 Bacteria 7462
399 Ga0501080_0216398 3300049742 Unclassified 1754
400 Ga0501080_0329697 3300049742 Bacteria 1380
401 Ga0501081_0090729 3300049743 Unclassified 2148
402 Ga0501083_0323301 3300049744 Bacteria 1003
403 Ga0501035_0167477 3300049822 Bacteria 1900
404 Ga0501035_0199680 3300049822 Bacteria 1716
405 Ga0501045_0001322 3300049824 Bacteria 16441
406 nmdc:mga05p37_376194_c1 3300050507 Unclassified 1665
407 nmdc:mga05p37_76665_c1 3300050507 Bacteria 4115
408 nmdc:mga0qj67_24644_c1 3300050509 Bacteria 4641
409 nmdc:mga06r32_35169_c1 3300050510 Bacteria 4727
410 nmdc:mga08y16_525272_c1 3300050511 Bacteria 1200
411 nmdc:mga0n895_500904_c1 3300050512 Bacteria 1223
412 nmdc:mga08x19_150932_c1 3300050514 Unclassified 1573
413 nmdc:mga08x19_56499_c1 3300050514 Bacteria 2533
414 Ga0495612_0000106 3300053078 Bacteria 35725
415 Ga0500578_0021449 3300053086 Bacteria 4150
416 Ga0500578_0320438 3300053086 Unclassified 914
417 Ga0500646_0003090 3300053090 Bacteria 4270
418 Ga0500651_0010391 3300053093 Bacteria 5578
419 Ga0500650_0071553 3300053098 Bacteria 1621
420 Ga0500595_000692 3300053119 Bacteria 20111
421 Ga0500642_0002024 3300053130 Bacteria 5882
422 Ga0500568_0013050 3300053139 Bacteria 3800
423 Ga0500588_0008311 3300053146 Bacteria 2420
424 Ga0500604_0005513 3300053151 Bacteria 3342
425 Ga0500616_0000936 3300053153 Bacteria 31848
426 Ga0500609_000084 3300053731 Bacteria 12148
427 Ga0500587_009907 3300053739 Unclassified 1212
428 Ga0501084_0120961 3300054114 Bacteria 2201
429 Ga0501082_0034139 3300060353 Bacteria 4388
430 Ga0501082_0082536 3300060353 Bacteria 2773
431 Ga0501082_0113656 3300060353 Unclassified 2344
432 Ga0466962_0125040 3300061719 Bacteria 1242
433 Ga0530510_0011544 3300061734 Bacteria 6199
434 Ga0466967_0003977
435 JGI25406J46586_10022649
436 JGI25165J46597_1002959
437 JGI25153J46596_10000042
438 rootH1_10173927
439 Ga0070658_10009660
440 Ga0070658_10011020
441 Ga0070676_10161796
442 Ga0070683_100023495
443 Ga0070683_100078762
444 Ga0070683_100211908
445 Ga0070683_100279795
446 Ga0068869_100016565
447 Ga0070682_100057495
448 Ga0068868_100237770
449 Ga0070660_100000505
450 Ga0070660_100262299
451 Ga0070691_10088920
452 Ga0070661_100001193
453 Ga0070661_100104833
454 Ga0070692_10013742
455 Ga0070668_100007109
456 Ga0070668_100447138
457 Ga0070671_100156371
458 Ga0070674_100067082
459 Ga0070673_100189116
460 Ga0070659_100025487
461 Ga0070659_100025739
462 Ga0070709_10040470
463 Ga0070709_10095632
464 Ga0070714_100061285
465 Ga0070714_100158318
466 Ga0070710_10065151
467 Ga0070711_100096657
468 Ga0070711_100232669
469 Ga0070705_100007849
470 Ga0070705_100059295
471 Ga0070700_100016623
472 Ga0070708_100009895
473 Ga0070708_100066243
474 Ga0070708_100068744
475 Ga0070678_100001947
476 Ga0070678_100309801
477 Ga0070681_10001391
478 Ga0068867_100096621
479 Ga0070685_10010936
480 Ga0070706_100003028
481 Ga0070707_100005067
482 Ga0070698_100004175
483 Ga0070679_100020920
484 Ga0070679_100309789
485 Ga0070684_100120873
486 Ga0070697_100321395
487 Ga0068853_100000840
488 Ga0068853_100102698
489 Ga0068853_100184434
490 Ga0070696_100122135
491 Ga0070693_100074340
492 Ga0070693_100154672
493 Ga0070665_100003309
494 Ga0070665_100079492
495 Ga0070665_100420035
496 Ga0068855_100005909
497 Ga0068855_100059071
498 Ga0068855_100117963
499 Ga0068855_100196813
500 Ga0068857_100106470
501 Ga0068857_100183827
502 Ga0068854_100007813
503 Ga0068854_100074102
504 Ga0068856_100068782
505 Ga0068856_100230218
506 Ga0068856_100263291
507 Ga0068856_100355329
508 Ga0070702_100165062
509 Ga0068852_100028968
510 Ga0068852_100105840
511 Ga0068859_100199059
512 Ga0068859_100472717
513 Ga0068864_100033343
514 Ga0068866_10004843
515 Ga0068866_10015530
516 Ga0068851_10047398
517 Ga0068851_10054294
518 Ga0068863_100130729
519 Ga0068858_100018511
520 Ga0068858_100056534
521 Ga0068858_100107305
522 Ga0068858_100131298
523 Ga0068862_100010310
524 Ga0081455_10054442
525 Ga0081539_10000926
526 Ga0081539_10054635
527 Ga0070717_10212701
528 Ga0070715_10003758
529 Ga0070716_100054775
530 Ga0070716_100106021
531 Ga0097621_100058440
532 Ga0097621_100068564
533 Ga0068871_100165891
534 Ga0075428_100115286
535 Ga0075430_100025553
536 Ga0068865_100107971
537 Ga0075436_100000565
538 Ga0097620_100199051
539 Ga0097620_100472697
540 Ga0099794_10021005
541 Ga0105240_10098031
542 Ga0111539_10539189
543 Ga0105245_10006968
544 Ga0105245_10031789
545 Ga0105245_10122536
546 Ga0105245_10131055
547 Ga0105245_10360683
548 Ga0105247_10015862
549 Ga0105247_10213101
550 Ga0114129_10035157
551 Ga0114129_10110478
552 Ga0114129_10118961
553 Ga0105243_10016438
554 Ga0105243_10031906
555 Ga0105241_10002202
556 Ga0105241_10045954
557 Ga0105241_10327370
558 Ga0105242_10017044
559 Ga0105248_10301121
560 Ga0105237_10000158
561 Ga0105237_10162342
562 Ga0105238_10054540
563 Ga0105238_10133730
564 Ga0105238_10153638
565 Ga0105238_10156096
566 Ga0105238_10260364
567 Ga0105249_10107832
568 Ga0105249_10189017
569 Ga0105239_10009578
570 Ga0105239_10110560
571 Ga0105239_10399890
572 Ga0105239_10497492
573 Ga0157371_10064297
574 Ga0157370_10092099
575 Ga0157370_10121790
576 Ga0157369_10020342
577 Ga0157369_10072604
578 Ga0157369_10154130
579 Ga0157374_10005197
580 Ga0157374_10080164
581 Ga0157378_10003453
582 Ga0157378_10050442
583 Ga0163162_10048252
584 Ga0157372_10023316
585 Ga0157372_10039718
586 Ga0157372_10266393
587 Ga0157372_10475363
588 Ga0157375_10046345
589 Ga0163163_10005216
590 Ga0163163_10086592
591 Ga0163163_10230569
592 Ga0157380_10069924
593 Ga0157377_10015421
594 Ga0157377_10050815
595 Ga0157379_10001135
596 Ga0157379_10006641
597 Ga0157379_10045069
598 Ga0157379_10132733
599 Ga0157376_10010876
600 Ga0157376_10025081
601 Ga0163161_10029016
602 Ga0206353_11798318
603 Ga0213876_10077192
604 Ga0209233_1000539
605 Ga0209758_1000110
606 Ga0209758_1037323
607 Ga0209050_1020575
608 Ga0207426_1015258
609 Ga0209257_1000376
610 Ga0207656_10000402
611 Ga0207656_10055292
612 Ga0207642_10066881
613 Ga0207688_10001943
614 Ga0207647_10069919
615 Ga0207685_10012686
616 Ga0207685_10030975
617 Ga0207699_10255409
618 Ga0207645_10010596
619 Ga0207705_10145540
620 Ga0207684_10000259
621 Ga0207654_10002642
622 Ga0207654_10014400
623 Ga0207707_10040149
624 Ga0207695_10027919
625 Ga0207671_10000795
626 Ga0207671_10025925
627 Ga0207693_10216545
628 Ga0207693_10264716
629 Ga0207663_10156861
630 Ga0207660_10045262
631 Ga0207657_10002487
632 Ga0207657_10026309
633 Ga0207649_10001642
634 Ga0207649_10151556
635 Ga0207652_10061947
636 Ga0207646_10000368
637 Ga0207646_10043934
638 Ga0207694_10087953
639 Ga0207694_10099728
640 Ga0207694_10378229
641 Ga0207650_10098588
642 Ga0207659_10328224
643 Ga0207687_10035244
644 Ga0207664_10112692
645 Ga0207664_10337462
646 Ga0207644_10100505
647 Ga0207644_10161968
648 Ga0207690_10088021
649 Ga0207690_10199730
650 Ga0207665_10060046
651 Ga0207711_10399997
652 Ga0207689_10216342
653 Ga0207661_10028946
654 Ga0207661_10033339
655 Ga0207667_10000532
656 Ga0207667_10199886
657 Ga0207712_10113952
658 Ga0207712_10222801
659 Ga0207668_10078593
660 Ga0207640_10032311
661 Ga0207640_10050418
662 Ga0207703_10040385
663 Ga0207703_10093587
664 Ga0207703_10093693
665 Ga0207639_10001963
666 Ga0207639_10186437
667 Ga0207639_10492862
668 Ga0207678_10000451
669 Ga0207708_10029185
670 Ga0207702_10027207
671 Ga0207702_10030627
672 Ga0207702_10078139
673 Ga0207702_10245968
674 Ga0207648_10029722
675 Ga0207648_10174695
676 Ga0207676_10089970
677 Ga0207674_10027855
678 Ga0207674_10073830
679 Ga0207674_10112918
680 Ga0207674_10155127
681 Ga0207683_10000112
682 Ga0207698_10031803
683 Ga0207698_10069560
684 Ga0268266_10000350
685 Ga0268266_10018486
686 Ga0268266_10030678
687 Ga0268266_10567243
688 Ga0268265_10234020
689 Ga0265319_1021857
690 Ga0265319_1032338
691 Ga0265334_10086063
692 Ga0265318_10010390
693 Ga0265318_10033795
694 Ga0307517_10129411
695 Ga0307515_10323682
696 Ga0265320_10070889
697 Ga0265325_10010302
698 Ga0265325_10041962
699 Ga0265340_10001823
700 Ga0265340_10006204
701 Ga0265340_10009681
702 Ga0265340_10030122
703 Ga0265340_10042908
704 Ga0265339_10006015
705 Ga0265339_10032521
706 Ga0265339_10051148
707 Ga0265339_10079953
708 Ga0265331_10005414
709 Ga0265331_10111014
710 Ga0265327_10025728
711 Ga0265316_10016697
712 Ga0307513_10043245
713 Ga0265313_10000079
714 Ga0265313_10000517
715 Ga0265313_10016433
716 Ga0265313_10020086
717 Ga0265314_10025134
718 Ga0265314_10053024
719 Ga0265342_10008204
720 Ga0265342_10071120
721 Ga0373926_0005636
722 Ga0373931_0123053
723 Ga0373935_0484859
724 Ga0373927_0251507
725 Ga0373937_0009408
726 Ga0373925_0194452
727 Ga0395901_0041170
728 Ga0395901_0148353
729 Ga0436365_1666566
730 Ga0466965_0038239
731 Ga0466963_0001483
732 Ga0466963_0003892
733 Ga0466963_0007287
734 Ga0466963_0024534
735 Ga0466963_0097649
736 Ga0466964_0045707
737 Ga0466971_0001178
738 Ga0466957_0000797
739 Ga0466957_0043533
740 Ga0466960_0030621
741 Ga0451576_0229229
742 Ga0466958_0001019
743 Ga0466967_0008132
744 Ga0466967_0016234
745 Ga0466967_0058817
746 Ga0466967_0061525
747 Ga0466967_0125862
748 Ga0466967_0177841
749 Ga0466967_0203592
750 Ga0466967_0253838
751 Ga0466967_0265504
752 Ga0466967_0330430
753 Ga0466967_0335616
754 Ga0466967_0426854
755 Ga0466967_0464766
756 Ga0466967_0658736
757 Ga0495592_0027249
758 Ga0495651_0012562
759 Ga0495608_0022794
760 Ga0495652_0036825
761 Ga0495640_0016327
762 Ga0495587_0009515
763 Ga0495667_0018526
764 Ga0495624_0088356
765 Ga0495600_0019182
766 Ga0495674_0055308
767 Ga0495676_0144714
768 Ga0495675_0119095
769 Ga0495684_0206776
770 Ga0495686_0053258
771 Ga0495686_0101076
772 Ga0495593_0043268
773 Ga0496101_0044009
774 Ga0496101_0187412
775 Ga0496101_0295576
776 Ga0496102_0209135
777 Ga0496102_0314212
778 Ga0496102_0412716
779 Ga0496103_0273728
780 Ga0496104_0002139
781 Ga0496104_0009074
782 Ga0496104_0012522
783 Ga0496105_0007390
784 Ga0496105_0023461
785 Ga0496106_0023728
786 Ga0496106_0028438
787 Ga0496106_0034723
788 Ga0496106_0045381
789 Ga0496108_0011199
790 Ga0496108_0011305
791 Ga0496108_0122662
792 Ga0496109_0087643
793 Ga0496110_0016110
794 Ga0496111_0024269
795 Ga0496111_0043750
796 Ga0496111_0143774
797 Ga0496112_0158659
798 Ga0496112_0184705
799 Ga0496112_0343056
800 Ga0496112_0655264
801 Ga0496113_0051339
802 Ga0496114_0011168
803 Ga0496114_0019275
804 Ga0496114_0186127
805 Ga0501034_0160469
806 Ga0501036_0078005
807 Ga0501038_0055247
808 Ga0501038_0221577
809 Ga0501040_0080228
810 Ga0501041_0039720
811 Ga0501043_0052788
812 Ga0501043_0283263
813 Ga0501046_0183403
814 Ga0501047_0024496
815 Ga0501047_0147024
816 Ga0501047_0279172
817 Ga0501048_0062302
818 Ga0501069_0043723
819 Ga0501070_0058120
820 Ga0501070_0203865
821 Ga0501070_0248235
822 Ga0501073_0119927
823 Ga0501073_0271584
824 Ga0501075_0029906
825 Ga0501076_0299776
826 Ga0501077_0002086
827 Ga0501077_0093013
828 Ga0501079_0020075
829 Ga0501079_0034627
830 Ga0501079_0250259
831 Ga0501080_0013710
832 Ga0501080_0216398
833 Ga0501080_0329697
834 Ga0501081_0090729
835 Ga0501083_0323301
836 Ga0501035_0167477
837 Ga0501035_0199680
838 Ga0501045_0001322
839 nmdc:mga05p37_376194_c1
840 nmdc:mga05p37_76665_c1
841 nmdc:mga0qj67_24644_c1
842 nmdc:mga06r32_35169_c1
843 nmdc:mga08y16_525272_c1
844 nmdc:mga0n895_500904_c1
845 nmdc:mga08x19_150932_c1
846 nmdc:mga08x19_56499_c1
847 Ga0495612_0000106
848 Ga0500578_0021449
849 Ga0500578_0320438
850 Ga0500646_0003090
851 Ga0500651_0010391
852 Ga0500650_0071553
853 Ga0500595_000692
854 Ga0500642_0002024
855 Ga0500568_0013050
856 Ga0500588_0008311
857 Ga0500604_0005513
858 Ga0500616_0000936
859 Ga0500609_000084
860 Ga0500587_009907
861 Ga0501084_0120961
862 Ga0501082_0034139
863 Ga0501082_0082536
864 Ga0501082_0113656
865 Ga0466962_0125040
866 Ga0530510_0011544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

71

350

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.837 1 310
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.8058 1 309
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.7937 1 309
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.7877 1 310
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.7863 1 309
ID Description Score Start End Superfamily
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9184 1 310 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.907 1 310 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8241 2 310 3.20.20.150
2zdsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7806 2 306 3.20.20.150
5h1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7791 16 311 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A6N8W8Y4-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9789 1 120 GO:0016853
AF-X1KP94-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9788 1 100
AF-A0A535P2N7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.977 1 206 GO:0016853
AF-A0A536NBC1-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9764 1 313 GO:0016853
AF-A0A2V7X479-F1-model_v4 Xylose isomerase 0.9759 1 116 GO:0016853

Map