metagRoot

F442905

General Info

Members	Datasets	Scaffolds	Average Seq Length
433	301	377	90

Family's Representative Sequence

Representative Sequence	3300044656\|Ga0466969_0036396\|Ga0466969_0036396_1759_2073
Length	104
Sequence	MNQQKKKARNKAEAESAVKVAWSDHAWDDYLHWQHVDMAIVREINGLLEEISRDPFRGTGKPEPLKGSLTGFWSRRITKVDRLVYIVKDGVTYVMQCRFHYTRP

Samples

	Sample ID	Description	Type	Environment
1	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
2	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
3	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
4	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
5	2582581305	Rhizorhabdus wittichii YR128	Isolate	Rhizosphere
6	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
7	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
8	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
9	2643221605	Sphingomonas sp. Root710	Isolate	Unclassified
10	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
11	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
12	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
13	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
14	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
15	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
16	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
17	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
18	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
19	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
20	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
21	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
22	2791355137	Paraburkholderia piptadeniae STM7183	Isolate	Unclassified
23	2791355266	Rhizobium sp. L43	Isolate	Nodule
24	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
25	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
26	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
27	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
28	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
29	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
30	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
31	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
32	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
33	2857547612	Janthinobacterium sp. R-74502	Isolate	Unclassified
34	2885429604	Sphingomonas sp. WZY 27	Isolate	Rhizosphere
35	2911138879	Spirosoma sp. KUDC1026	Isolate	Rhizosphere
36	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
37	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
38	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
39	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
40	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
41	2984555340	Sphingomonas sp. SORGH_AS789	Isolate	Aerial Root
42	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
43	2993356040	Sphingomonas sp. SORGH_AS742	Isolate	Aerial Root
44	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
45	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
46	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
47	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
48	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
49	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
50	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
51	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
52	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
53	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
54	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
55	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
56	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
57	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
58	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
59	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
60	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
61	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
62	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
63	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
64	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
65	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
66	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
67	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
68	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
69	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
70	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
71	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
72	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
73	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
74	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
75	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
76	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
77	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
78	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
79	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
80	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
81	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
82	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
83	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
84	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
85	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
86	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
87	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
88	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
89	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
90	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
91	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
92	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
93	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
94	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
95	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
97	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
98	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
99	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
100	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
101	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
102	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
103	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
104	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
105	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
106	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
107	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
108	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
109	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
110	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
111	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
112	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
113	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
114	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
115	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
116	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
117	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
118	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
119	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
120	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
121	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
122	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
123	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
124	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
125	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
126	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
127	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
128	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
129	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
130	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
131	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
132	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
133	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
172	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
176	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
177	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
178	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
179	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
180	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
181	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
182	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
183	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
184	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
185	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
186	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
187	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
188	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
189	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
190	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
191	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
192	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
193	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
194	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
195	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
196	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
197	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
198	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
199	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
200	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
201	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
202	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
203	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
204	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
205	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
206	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
207	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
208	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
209	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
210	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
211	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
212	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
213	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
214	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
215	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
216	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
217	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
218	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
219	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
220	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
221	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
222	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
223	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
224	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
225	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
226	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
227	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
228	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
229	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
230	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
231	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
232	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
233	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
234	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
235	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
236	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
237	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
238	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
239	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
240	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
241	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
242	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
243	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
244	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
246	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
247	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
248	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
249	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
251	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
253	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
254	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
255	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
256	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
257	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
258	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
259	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
260	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
261	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
262	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
263	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
264	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
265	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
266	3300053115	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere	Metagenome	Endosphere
267	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
268	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
269	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
270	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
271	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
272	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
273	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
274	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
275	3300053144	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere	Metagenome	Endosphere
276	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
277	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
278	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
279	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
280	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
281	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
282	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
283	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
284	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
285	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
286	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
287	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
288	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
289	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
290	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
291	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
292	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
293	8005382845	Rhizobium sp. R634	Isolate	Nodule
294	8005395548	Rhizobium sp. R339	Isolate	Nodule
295	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
296	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
297	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
298	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
299	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
300	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
301	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	84.3
Metatranscriptomes	2.77
Isolates	12.93

Biome Distribution

Category	Percentage (%)
Aerial Root	0.46
Bulb	0
Endosphere	13.63
Nodule	8.08
Rhizoplane	1.62
Rhizosphere	66.28
Stem	0
Stem Tuber	0
Unclassified	9.93

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24736J21556_1029935	3300001904	Bacteria	842
2	JGI24740J21852_10018592	3300001979	Bacteria	2460
3	JGI24740J21852_10034538	3300001979	Unclassified	1593
4	JGI24739J22299_10012983	3300001989	Bacteria	3049
5	JGI24739J22299_10020791	3300001989	Bacteria	2343
6	JGI24737J22298_10103560	3300001990	Bacteria	843
7	JGI24735J21928_10000847	3300002067	Bacteria	10900
8	JGI25151J46595_10007626	3300003187	Bacteria	5283
9	JGI25406J46586_10182053	3300003203	Bacteria	613
10	rootH2_10268919	3300003320	Bacteria	1260
11	rootL2_10000246	3300003322	Bacteria	2537
12	rootL2_10001723	3300003322	Bacteria	3366
13	rootL2_10302176	3300003322	Bacteria	1183
14	rootH1_10192654	3300003323	Bacteria	1183
15	Ga0055526_1024131	3300003771	Bacteria	2002
16	Ga0055524_1018388	3300003775	Bacteria	2428
17	Ga0055536_1000169	3300003781	Bacteria	54648
18	Ga0055540_1010979	3300003792	Bacteria	2967
19	Ga0055531_10010592	3300003794	Bacteria	4559
20	Ga0065712_10620627	3300005290	Unclassified	581
21	Ga0065707_10109305	3300005295	Bacteria	2474
22	Ga0070658_10004537	3300005327	Bacteria	11285
23	Ga0070658_10016474	3300005327	Bacteria	5916
24	Ga0070658_11209006	3300005327	Unclassified	657
25	Ga0070658_11602064	3300005327	Unclassified	564
26	Ga0070683_101110445	3300005329	Bacteria	760
27	Ga0070670_100000423	3300005331	Bacteria	34885
28	Ga0070670_100040769	3300005331	Bacteria	3991
29	Ga0070677_10000237	3300005333	Bacteria	19120
30	Ga0070680_100085727	3300005336	Bacteria	2602
31	Ga0070660_100000402	3300005339	Bacteria	28811
32	Ga0070660_100003391	3300005339	Bacteria	10961
33	Ga0070660_100727668	3300005339	Bacteria	833
34	Ga0070689_100029405	3300005340	Bacteria	4159
35	Ga0070661_101416054	3300005344	Unclassified	585
36	Ga0070668_100046677	3300005347	Bacteria	3327
37	Ga0070669_100000076	3300005353	Bacteria	97334
38	Ga0070671_100000007	3300005355	Bacteria	250397
39	Ga0070671_100011365	3300005355	Bacteria	7158
40	Ga0070688_100003165	3300005365	Bacteria	8427
41	Ga0070659_100031801	3300005366	Bacteria	4089
42	Ga0070659_100131749	3300005366	Bacteria	2031
43	Ga0070659_100952248	3300005366	Bacteria	752
44	Ga0070667_100000017	3300005367	Bacteria	230531
45	Ga0070663_100593828	3300005455	Bacteria	930
46	Ga0070662_100120213	3300005457	Bacteria	2012
47	Ga0070662_100307056	3300005457	Bacteria	1290
48	Ga0070685_10010068	3300005466	Bacteria	4905
49	Ga0068853_100674042	3300005539	Bacteria	985
50	Ga0068853_101467001	3300005539	Bacteria	660
51	Ga0070696_100198383	3300005546	Unclassified	1497
52	Ga0070665_100000019	3300005548	Bacteria	413972
53	Ga0070665_100102734	3300005548	Bacteria	2862
54	Ga0068855_100007988	3300005563	Bacteria	12782
55	Ga0068855_101813488	3300005563	Unclassified	620
56	Ga0070664_100095837	3300005564	Bacteria	2574
57	Ga0068854_100470321	3300005578	Bacteria	1053
58	Ga0068854_100593291	3300005578	Bacteria	945
59	Ga0068856_100158345	3300005614	Bacteria	2275
60	Ga0068852_100202156	3300005616	Bacteria	1880
61	Ga0068852_100307502	3300005616	Bacteria	1536
62	Ga0068852_100340232	3300005616	Bacteria	1462
63	Ga0068852_100596627	3300005616	Bacteria	1108
64	Ga0068859_100004346	3300005617	Bacteria	14457
65	Ga0068864_100001109	3300005618	Bacteria	22495
66	Ga0068864_100001179	3300005618	Bacteria	21773
67	Ga0068864_100012637	3300005618	Bacteria	6981
68	Ga0068864_100545048	3300005618	Bacteria	1120
69	Ga0068864_100563001	3300005618	Bacteria	1103
70	Ga0068861_100062909	3300005719	Bacteria	2851
71	Ga0068863_100000069	3300005841	Bacteria	116525
72	Ga0068863_100103612	3300005841	Bacteria	2706
73	Ga0068863_100159361	3300005841	Bacteria	2161
74	Ga0068858_100000103	3300005842	Bacteria	88754
75	Ga0068858_100000964	3300005842	Bacteria	29822
76	Ga0068858_100035604	3300005842	Bacteria	4617
77	Ga0068858_102254347	3300005842	Bacteria	538
78	Ga0068860_100000056	3300005843	Bacteria	202751
79	Ga0068860_100070722	3300005843	Bacteria	3317
80	Ga0075368_10012658	3300006042	Bacteria	3090
81	Ga0075364_10593379	3300006051	Bacteria	757
82	Ga0075367_10005638	3300006178	Bacteria	6246
83	Ga0097621_101519015	3300006237	Bacteria	636
84	Ga0097620_100004346	3300006931	Bacteria	14457
85	Ga0097620_102235304	3300006931	Unclassified	603
86	Ga0099794_10332468	3300007265	Bacteria	789
87	Ga0105251_10292273	3300009011	Bacteria	738
88	Ga0105240_10002204	3300009093	Bacteria	31762
89	Ga0105240_10191082	3300009093	Unclassified	2408
90	Ga0105240_10233335	3300009093	Bacteria	2137
91	Ga0105245_11704654	3300009098	Bacteria	682
92	Ga0105247_10021798	3300009101	Bacteria	3854
93	Ga0105241_10011335	3300009174	Bacteria	6535
94	Ga0105241_10043979	3300009174	Bacteria	3383
95	Ga0105248_10018782	3300009177	Bacteria	7645
96	Ga0105248_10433122	3300009177	Bacteria	1481
97	Ga0105237_10003832	3300009545	Bacteria	17683
98	Ga0105237_10306767	3300009545	Bacteria	1590
99	Ga0105237_11087409	3300009545	Bacteria	806
100	Ga0105238_10025275	3300009551	Bacteria	6052
101	Ga0105238_10119625	3300009551	Bacteria	2614
102	Ga0105238_10196139	3300009551	Bacteria	1995
103	Ga0105238_11819758	3300009551	Bacteria	641
104	Ga0105249_10834638	3300009553	Bacteria	987
105	Ga0105239_10218247	3300010375	Bacteria	2138
106	Ga0105239_10743415	3300010375	Bacteria	1122
107	Ga0105239_11015468	3300010375	Bacteria	954
108	Ga0105239_11563170	3300010375	Bacteria	763
109	Ga0157326_1000035	3300012513	Bacteria	11769
110	Ga0157326_1055621	3300012513	Bacteria	592
111	Ga0157373_10002990	3300013100	Bacteria	12787
112	Ga0157373_10063171	3300013100	Bacteria	2622
113	Ga0157371_10017590	3300013102	Bacteria	5307
114	Ga0157371_10176400	3300013102	Unclassified	1528
115	Ga0157370_10005400	3300013104	Bacteria	14336
116	Ga0157370_10101380	3300013104	Bacteria	2696
117	Ga0157370_10380626	3300013104	Bacteria	1300
118	Ga0157370_11141364	3300013104	Bacteria	704
119	Ga0157369_10002832	3300013105	Bacteria	20700
120	Ga0157369_10018420	3300013105	Bacteria	7829
121	Ga0157369_10374136	3300013105	Bacteria	1479
122	Ga0157369_10421971	3300013105	Bacteria	1383
123	Ga0157369_12613143	3300013105	Bacteria	510
124	Ga0157369_12633462	3300013105	Unclassified	508
125	Ga0157374_10000049	3300013296	Bacteria	136428
126	Ga0157374_10177608	3300013296	Unclassified	2078
127	Ga0163162_10011507	3300013306	Bacteria	8629
128	Ga0163162_10558427	3300013306	Bacteria	1273
129	Ga0163162_12660261	3300013306	Unclassified	576
130	Ga0157372_10001561	3300013307	Bacteria	24936
131	Ga0163163_10534628	3300014325	Unclassified	1235
132	Ga0163163_10663226	3300014325	Bacteria	1107
133	Ga0163163_10795650	3300014325	Bacteria	1009
134	Ga0182008_10005830	3300014497	Bacteria	6963
135	Ga0182008_10102315	3300014497	Bacteria	1417
136	Ga0157379_10055350	3300014968	Bacteria	3544
137	Ga0182006_1000007	3300015261	Bacteria	452190
138	Ga0182006_1093937	3300015261	Bacteria	1074
139	Ga0182006_1165311	3300015261	Bacteria	744
140	Ga0182007_10000022	3300015262	Bacteria	189018
141	Ga0182005_1000010	3300015265	Bacteria	434103
142	Ga0163161_10313973	3300017792	Bacteria	1237
143	Ga0163161_10770442	3300017792	Bacteria	806
144	Ga0197907_11494566	3300020069	Bacteria	946
145	Ga0206349_1485105	3300020075	Bacteria	682
146	Ga0206355_1153817	3300020076	Bacteria	861
147	Ga0206351_10943377	3300020077	Bacteria	581
148	Ga0206352_11157109	3300020078	Bacteria	576
149	Ga0206350_10253049	3300020080	Bacteria	806
150	Ga0206354_10147980	3300020081	Bacteria	721
151	Ga0206354_10439898	3300020081	Bacteria	4708
152	Ga0206353_10691668	3300020082	Unclassified	856
153	Ga0206353_11734250	3300020082	Bacteria	541
154	Ga0213875_10000275	3300021388	Bacteria	50853
155	Ga0224712_10056085	3300022467	Bacteria	1552
156	Ga0224712_10260566	3300022467	Bacteria	803
157	Ga0209676_1000462	3300025292	Bacteria	68390
158	Ga0209025_1011831	3300025294	Bacteria	5685
159	Ga0209025_1027753	3300025294	Bacteria	2796
160	Ga0209051_1004696	3300025303	Bacteria	8308
161	Ga0207713_1015837	3300025735	Bacteria	3853
162	Ga0207713_1224433	3300025735	Unclassified	565
163	Ga0207682_10001098	3300025893	Bacteria	12509
164	Ga0207710_10074802	3300025900	Bacteria	1560
165	Ga0207647_10000461	3300025904	Bacteria	33000
166	Ga0207705_10068895	3300025909	Bacteria	2562
167	Ga0207705_10094075	3300025909	Bacteria	2197
168	Ga0207705_11082420	3300025909	Bacteria	618
169	Ga0207654_10075682	3300025911	Bacteria	2012
170	Ga0207654_10198976	3300025911	Bacteria	1318
171	Ga0207695_10011287	3300025913	Bacteria	10831
172	Ga0207695_10066263	3300025913	Unclassified	3710
173	Ga0207671_10540864	3300025914	Bacteria	929
174	Ga0207671_10727787	3300025914	Bacteria	788
175	Ga0207657_10004791	3300025919	Bacteria	14278
176	Ga0207657_10340928	3300025919	Bacteria	1183
177	Ga0207652_10703398	3300025921	Bacteria	902
178	Ga0207681_10000088	3300025923	Bacteria	80059
179	Ga0207694_10067838	3300025924	Bacteria	2785
180	Ga0207694_10221332	3300025924	Bacteria	1544
181	Ga0207694_10563935	3300025924	Bacteria	956
182	Ga0207650_10000235	3300025925	Bacteria	61521
183	Ga0207650_10028937	3300025925	Bacteria	3978
184	Ga0207687_10060824	3300025927	Bacteria	2665
185	Ga0207687_10623869	3300025927	Bacteria	910
186	Ga0207664_10409485	3300025929	Bacteria	1207
187	Ga0207644_10000002	3300025931	Bacteria	942221
188	Ga0207690_10019450	3300025932	Bacteria	4182
189	Ga0207690_10835724	3300025932	Bacteria	762
190	Ga0207706_10402019	3300025933	Bacteria	1187
191	Ga0207706_11486005	3300025933	Bacteria	553
192	Ga0207670_10002319	3300025936	Bacteria	9977
193	Ga0207711_10038433	3300025941	Bacteria	4070
194	Ga0207679_10126404	3300025945	Bacteria	2044
195	Ga0207667_10024538	3300025949	Bacteria	6618
196	Ga0207667_10273473	3300025949	Bacteria	1727
197	Ga0207712_12077894	3300025961	Bacteria	508
198	Ga0207668_10027115	3300025972	Bacteria	3729
199	Ga0207640_10834270	3300025981	Bacteria	801
200	Ga0207640_10856925	3300025981	Bacteria	791
201	Ga0207658_10000011	3300025986	Bacteria	239620
202	Ga0207703_10000691	3300026035	Bacteria	33391
203	Ga0207703_10012001	3300026035	Bacteria	6748
204	Ga0207703_10016505	3300026035	Bacteria	5758
205	Ga0207639_10610498	3300026041	Bacteria	1007
206	Ga0207639_11020159	3300026041	Bacteria	775
207	Ga0207639_11336650	3300026041	Bacteria	673
208	Ga0207678_10830424	3300026067	Bacteria	816
209	Ga0207702_10142339	3300026078	Bacteria	2172
210	Ga0207641_10000112	3300026088	Bacteria	120365
211	Ga0207641_10012777	3300026088	Bacteria	6883
212	Ga0207641_10249793	3300026088	Bacteria	1656
213	Ga0207641_10264667	3300026088	Bacteria	1611
214	Ga0207676_10000945	3300026095	Bacteria	22424
215	Ga0207676_10011373	3300026095	Bacteria	6361
216	Ga0207676_10013472	3300026095	Bacteria	5874
217	Ga0207676_11215220	3300026095	Bacteria	747
218	Ga0207674_10703388	3300026116	Bacteria	976
219	Ga0207675_100003316	3300026118	Bacteria	15757
220	Ga0207698_10947947	3300026142	Unclassified	870
221	Ga0207698_11059265	3300026142	Bacteria	823
222	Ga0209813_10000087	3300027866	Bacteria	34252
223	Ga0268266_10000025	3300028379	Bacteria	477143
224	Ga0268266_10110212	3300028379	Bacteria	2438
225	Ga0268265_10062194	3300028380	Bacteria	2867
226	Ga0268264_10000089	3300028381	Bacteria	234760
227	Ga0268264_10000288	3300028381	Bacteria	84755
228	Ga0265338_10026310	3300028800	Bacteria	5872
229	Ga0265328_10028076	3300031239	Bacteria	2107
230	Ga0307408_101945556	3300031548	Unclassified	564
231	Ga0307410_11543897	3300031852	Bacteria	586
232	Ga0307406_10101724	3300031901	Bacteria	1959
233	Ga0307406_10119498	3300031901	Bacteria	1829
234	Ga0307412_10082839	3300031911	Bacteria	2222
235	Ga0307412_11158423	3300031911	Bacteria	690
236	Ga0307411_12254245	3300032005	Bacteria	511
237	Ga0373955_0051311	3300035172	Bacteria	2246
238	Ga0373927_0065817	3300035695	Bacteria	2344
239	Ga0395899_0301581	3300037312	Unclassified	1084
240	Ga0395900_0385344	3300037418	Bacteria	1369
241	Ga0395900_0530344	3300037418	Bacteria	1124
242	Ga0395900_0766988	3300037418	Unclassified	894
243	Ga0395898_0003342	3300037466	Bacteria	17996
244	Ga0395898_1614538	3300037466	Bacteria	572
245	Ga0395905_0000314	3300037471	Bacteria	70335
246	Ga0436364_0011659	3300037853	Bacteria	94648
247	Ga0395901_0000017	3300038443	Bacteria	345003
248	Ga0395901_0207710	3300038443	Bacteria	2050
249	Ga0395901_0311362	3300038443	Bacteria	1630
250	Ga0395901_0475094	3300038443	Bacteria	1276
251	Ga0395901_0716618	3300038443	Bacteria	996
252	Ga0395901_1092288	3300038443	Unclassified	769
253	Ga0436365_0870050	3300039437	Bacteria	799
254	Ga0436363_0647589	3300039450	Unclassified	678
255	Ga0439436_0037530	3300041404	Bacteria	1395
256	Ga0439461_0004669	3300041410	Bacteria	2299
257	Ga0439466_0058573	3300041411	Bacteria	1246
258	Ga0439465_0005170	3300041413	Bacteria	4186
259	Ga0451793_1823492	3300041452	Bacteria	700
260	Ga0451806_498320	3300041462	Unclassified	626
261	Ga0451841_0644503	3300041498	Bacteria	683
262	Ga0451853_1737656	3300041512	Unclassified	541
263	Ga0439431_0000114	3300041997	Bacteria	13898
264	Ga0439433_0052815	3300041999	Bacteria	960
265	Ga0439442_010357	3300042002	Bacteria	1890
266	Ga0439445_0001641	3300042004	Bacteria	4897
267	Ga0439448_0052168	3300042005	Bacteria	1340
268	Ga0439432_000864	3300042006	Bacteria	11327
269	Ga0439432_145316	3300042006	Bacteria	697
270	Ga0439452_020856	3300042010	Bacteria	1714
271	Ga0439457_039798	3300042014	Bacteria	1047
272	Ga0439457_165055	3300042014	Bacteria	537
273	Ga0439462_0000602	3300042015	Bacteria	7170
274	Ga0439434_0000382	3300042435	Bacteria	12602
275	Ga0466969_0036396	3300044656	Bacteria	2486
276	Ga0466972_0012483	3300044658	Bacteria	4271
277	Ga0466966_0170548	3300044684	Bacteria	1322
278	Ga0466961_0137680	3300044693	Bacteria	1529
279	Ga0466959_0018737	3300045049	Bacteria	5084
280	Ga0466958_0181032	3300045836	Bacteria	1337
281	Ga0495638_0059382	3300046460	Bacteria	2368
282	Ga0495585_0112787	3300046492	Bacteria	1444
283	Ga0495585_0509526	3300046492	Bacteria	571
284	Ga0495607_0009554	3300046501	Bacteria	6553
285	Ga0495606_0059545	3300046507	Bacteria	2449
286	Ga0495632_0144316	3300046519	Bacteria	1103
287	Ga0495643_0014096	3300046522	Bacteria	4766
288	Ga0495643_0078087	3300046522	Bacteria	1729
289	Ga0495648_0062951	3300046524	Bacteria	2194
290	Ga0495633_0012226	3300046558	Bacteria	4577
291	Ga0495668_0024908	3300046616	Bacteria	3401
292	Ga0495661_0344803	3300046665	Bacteria	735
293	Ga0495670_0125072	3300046691	Bacteria	1338
294	Ga0495660_0292895	3300046810	Bacteria	740
295	Ga0495673_0000053	3300047469	Bacteria	254433
296	Ga0495686_0000359	3300047472	Bacteria	73907
297	Ga0495686_0027104	3300047472	Bacteria	3744
298	Ga0496100_0460913	3300048903	Unclassified	975
299	Ga0496110_0996272	3300048913	Bacteria	745
300	Ga0496111_0254715	3300048914	Bacteria	1302
301	Ga0496112_0653311	3300048915	Bacteria	981
302	Ga0496116_0164697	3300048919	Bacteria	1211
303	Ga0496116_0166259	3300048919	Bacteria	1202
304	Ga0496116_0438924	3300048919	Unclassified	563
305	Ga0496117_0299751	3300048920	Bacteria	851
306	Ga0496118_0230121	3300048921	Bacteria	1070
307	Ga0496119_0042052	3300048922	Bacteria	2902
308	Ga0496121_0006942	3300048924	Bacteria	13800
309	Ga0496121_0904615	3300048924	Bacteria	507
310	Ga0496122_0002165	3300048925	Bacteria	28789
311	Ga0496122_0258057	3300048925	Bacteria	969
312	Ga0496122_0535660	3300048925	Bacteria	561
313	Ga0496123_0001145	3300048926	Bacteria	39589
314	Ga0496123_0276051	3300048926	Bacteria	815
315	Ga0496124_0001448	3300048927	Bacteria	35062
316	Ga0496124_0067801	3300048927	Bacteria	2968
317	Ga0496124_0270732	3300048927	Bacteria	1244
318	Ga0496125_0233016	3300048928	Bacteria	1176
319	Ga0496125_0243004	3300048928	Bacteria	1141
320	Ga0496126_0573471	3300048929	Bacteria	892
321	Ga0501033_0000038	3300049570	Bacteria	144438
322	Ga0501034_0301160	3300049571	Unclassified	1540
323	Ga0501034_1423062	3300049571	Bacteria	568
324	Ga0501047_0184535	3300049581	Bacteria	1952
325	Ga0501069_0020997	3300049585	Bacteria	3541
326	Ga0501070_0080166	3300049586	Bacteria	2701
327	Ga0501075_0837624	3300049591	Unclassified	700
328	Ga0501269_032001	3300049766	Bacteria	678
329	Ga0501035_0000367	3300049822	Bacteria	52067
330	Ga0501044_0573797	3300049823	Bacteria	1023
331	Ga0501044_1336112	3300049823	Bacteria	583
332	nmdc:mga06z11_1001_c1	3300050494	Bacteria	10304
333	nmdc:mga04h51_839_c1	3300050495	Bacteria	7104
334	nmdc:mga07m45_626911_c1	3300050496	Bacteria	620
335	Ga0500643_000314	3300053087	Bacteria	39359
336	Ga0500643_001512	3300053087	Bacteria	13304
337	Ga0500643_007506	3300053087	Bacteria	4382
338	Ga0500643_016184	3300053087	Bacteria	2533
339	Ga0500643_026054	3300053087	Bacteria	1836
340	Ga0500643_064748	3300053087	Bacteria	1021
341	Ga0500646_0080801	3300053090	Bacteria	991
342	Ga0500647_0279958	3300053091	Bacteria	721
343	Ga0500566_0000008	3300053094	Bacteria	143641
344	Ga0500640_005167	3300053095	Bacteria	4830
345	Ga0500641_0001456	3300053096	Bacteria	8435
346	Ga0500556_0010197	3300053104	Bacteria	2751
347	Ga0500557_048942	3300053105	Bacteria	1349
348	Ga0500562_034700	3300053108	Bacteria	1335
349	Ga0500562_115700	3300053108	Bacteria	730
350	Ga0500572_019578	3300053111	Bacteria	1769
351	Ga0500591_113988	3300053115	Bacteria	1126
352	Ga0500608_021366	3300053122	Bacteria	2990
353	Ga0500614_001835	3300053123	Bacteria	4909
354	Ga0500618_000007	3300053125	Bacteria	226268
355	Ga0500655_000172	3300053133	Bacteria	15912
356	Ga0500658_0427065	3300053134	Bacteria	605
357	Ga0500559_0002991	3300053136	Bacteria	8472
358	Ga0500568_0280719	3300053139	Bacteria	605
359	Ga0500568_0304324	3300053139	Bacteria	578
360	Ga0500573_0068360	3300053140	Bacteria	2029
361	Ga0500585_182276	3300053144	Bacteria	712
362	Ga0500590_000500	3300053148	Bacteria	13522
363	Ga0500603_000805	3300053150	Bacteria	7507
364	Ga0500616_0050690	3300053153	Bacteria	2191
365	Ga0500616_0062785	3300053153	Unclassified	1917
366	Ga0500622_0018265	3300053156	Bacteria	3729
367	Ga0500630_000498	3300053159	Bacteria	17442
368	Ga0500638_043729	3300053162	Bacteria	2175
369	Ga0500639_000010	3300053163	Bacteria	136747
370	Ga0500639_344143	3300053163	Bacteria	532
371	Ga0500636_0339541	3300053177	Bacteria	722
372	Ga0500637_0044960	3300053178	Bacteria	2503
373	Ga0500645_000262	3300053730	Bacteria	37926
374	Ga0500645_000404	3300053730	Bacteria	30239
375	Ga0500596_000632	3300053735	Bacteria	6765
376	Ga0500601_001667	3300053737	Bacteria	2397
377	Ga0501082_0683869	3300060353	Bacteria	898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042006	Ga0439432_145316	Ga0439432_145316_429_650	69
2	3300042014	Ga0439457_165055	Ga0439457_165055_237_458	69
3	3300007265	Ga0099794_10332468	Ga0099794_103324682	75
4	iso_pu_bacteria	2885429604	2885432190	76
5	3300001979	JGI24740J21852_10018592	JGI24740J21852_100185924	79
6	3300005455	Ga0070663_100593828	Ga0070663_1005938282	79
7	3300005457	Ga0070662_100307056	Ga0070662_1003070562	79
8	3300005564	Ga0070664_100095837	Ga0070664_1000958372	79
9	3300005578	Ga0068854_100470321	Ga0068854_1004703212	79
10	3300009174	Ga0105241_10011335	Ga0105241_100113359	79
11	3300009551	Ga0105238_10025275	Ga0105238_100252759	79
12	3300010375	Ga0105239_10218247	Ga0105239_102182474	79
13	3300025911	Ga0207654_10198976	Ga0207654_101989762	79
14	3300025924	Ga0207694_10067838	Ga0207694_100678385	79
15	3300025933	Ga0207706_10402019	Ga0207706_104020192	79
16	3300025945	Ga0207679_10126404	Ga0207679_101264042	79
17	3300025981	Ga0207640_10834270	Ga0207640_108342702	79
18	3300026041	Ga0207639_11020159	Ga0207639_110201592	79
19	3300026067	Ga0207678_10830424	Ga0207678_108304242	79
20	iso_pu_bacteria	2513237084	2513569777	80
21	iso_pu_bacteria	2515075009	2515115396	80
22	iso_pu_bacteria	2517287029	2517410702	80
23	iso_pu_bacteria	2582581304	2585258271	80
24	iso_pu_bacteria	2582581305	2585261714	80
25	iso_pu_bacteria	2600254933	2600373596	80
26	iso_pu_bacteria	2643221583	2643922436	80
27	iso_pu_bacteria	2643221584	2643929733	80
28	iso_pu_bacteria	2643221605	2644039078	80
29	iso_pu_bacteria	2643221653	2644296984	80
30	iso_pu_bacteria	2643221719	2644655238	80
31	iso_pu_bacteria	2718218232	2720611014	80
32	iso_pu_bacteria	2718218233	2720616182	80
33	iso_pu_bacteria	2718218235	2720629263	80
34	iso_pu_bacteria	2718218269	2720771835	80
35	iso_pu_bacteria	2721755556	2723029239	80
36	iso_pu_bacteria	2721755684	2723562872	80
37	iso_pu_bacteria	2721755685	2723570862	80
38	iso_pu_bacteria	2721755819	2724086655	80
39	iso_pu_bacteria	2721755822	2724106813	80
40	iso_pu_bacteria	2728369352	2730105553	80
41	iso_pu_bacteria	2791355266	2793357932	80
42	iso_pu_bacteria	2818991272	2819242699	80
43	iso_pu_bacteria	2838042994	2838046484	80
44	iso_pu_bacteria	2838068647	2838071670	80
45	iso_pu_bacteria	2838707686	2838711966	80
46	iso_pu_bacteria	2842077413	2842081724	80
47	iso_pu_bacteria	2842237096	2842241378	80
48	iso_pu_bacteria	2842291075	2842295380	80
49	iso_pu_bacteria	2842384541	2842388849	80
50	iso_pu_bacteria	2842422224	2842425303	80
51	iso_pu_bacteria	2911138879	2911143639	80
52	iso_pu_bacteria	2933599457	2933602466	80
53	iso_pu_bacteria	2935894831	2935898401	80
54	iso_pu_bacteria	2936367885	2936370502	80
55	iso_pu_bacteria	2936375103	2936378162	80
56	iso_pu_bacteria	2984555340	2984556920	80
57	iso_pu_bacteria	2989776772	2989778035	80
58	iso_pu_bacteria	2993356040	2993359764	80
59	iso_pu_bacteria	8005246636	8005246723	80
60	iso_pu_bacteria	8005282627	8005287972	80
61	iso_pu_bacteria	8005301065	8005305189	80
62	iso_pu_bacteria	8005376324	8005382172	80
63	iso_pu_bacteria	8005382845	8005388583	80
64	iso_pu_bacteria	8005395548	8005399368	80
65	iso_pu_bacteria	8005460587	8005466621	80
66	iso_pu_bacteria	8005497431	8005503327	80
67	iso_pu_bacteria	8005626139	8005630450	80
68	iso_pu_bacteria	8005668836	8005674845	80
69	iso_pu_bacteria	8005688590	8005689211	80
70	iso_pu_bacteria	8005695170	8005696919	80
71	iso_pu_bacteria	8024479707	8024484018	80
72	3300010375	Ga0105239_11563170	Ga0105239_115631702	82
73	3300005333	Ga0070677_10000237	Ga0070677_100002378	83
74	3300005616	Ga0068852_100596627	Ga0068852_1005966272	83
75	3300009545	Ga0105237_10306767	Ga0105237_103067672	83
76	3300025893	Ga0207682_10001098	Ga0207682_100010988	83
77	3300049823	Ga0501044_0573797	Ga0501044_0573797_79_342	83
78	3300001979	JGI24740J21852_10034538	JGI24740J21852_100345382	84
79	3300003203	JGI25406J46586_10182053	JGI25406J46586_101820532	84
80	3300003320	rootH2_10268919	rootH2_102689193	84
81	3300003322	rootL2_10000246	rootL2_100002464	84
82	3300003322	rootL2_10001723	rootL2_100017234	84
83	3300003322	rootL2_10302176	rootL2_103021762	84
84	3300003323	rootH1_10192654	rootH1_101926542	84
85	3300003771	Ga0055526_1024131	Ga0055526_10241313	84
86	3300003775	Ga0055524_1018388	Ga0055524_10183884	84
87	3300003794	Ga0055531_10010592	Ga0055531_100105924	84
88	3300005290	Ga0065712_10620627	Ga0065712_106206271	84
89	3300005295	Ga0065707_10109305	Ga0065707_101093053	84
90	3300005327	Ga0070658_11209006	Ga0070658_112090062	84
91	3300005327	Ga0070658_11602064	Ga0070658_116020641	84
92	3300005329	Ga0070683_101110445	Ga0070683_1011104451	84
93	3300005331	Ga0070670_100000423	Ga0070670_10000042354	84
94	3300005331	Ga0070670_100040769	Ga0070670_1000407691	84
95	3300005336	Ga0070680_100085727	Ga0070680_1000857273	84
96	3300005339	Ga0070660_100000402	Ga0070660_1000004022	84
97	3300005339	Ga0070660_100727668	Ga0070660_1007276681	84
98	3300005340	Ga0070689_100029405	Ga0070689_1000294054	84
99	3300005344	Ga0070661_101416054	Ga0070661_1014160541	84
100	3300005347	Ga0070668_100046677	Ga0070668_1000466775	84
101	3300005353	Ga0070669_100000076	Ga0070669_10000007658	84
102	3300005355	Ga0070671_100000007	Ga0070671_100000007249	84
103	3300005355	Ga0070671_100011365	Ga0070671_1000113653	84
104	3300005365	Ga0070688_100003165	Ga0070688_1000031655	84
105	3300005366	Ga0070659_100031801	Ga0070659_1000318013	84
106	3300005366	Ga0070659_100131749	Ga0070659_1001317494	84
107	3300005366	Ga0070659_100952248	Ga0070659_1009522482	84
108	3300005367	Ga0070667_100000017	Ga0070667_100000017229	84
109	3300005457	Ga0070662_100120213	Ga0070662_1001202131	84
110	3300005466	Ga0070685_10010068	Ga0070685_100100685	84
111	3300005539	Ga0068853_100674042	Ga0068853_1006740421	84
112	3300005546	Ga0070696_100198383	Ga0070696_1001983833	84
113	3300005548	Ga0070665_100000019	Ga0070665_100000019115	84
114	3300005548	Ga0070665_100102734	Ga0070665_1001027344	84
115	3300005563	Ga0068855_101813488	Ga0068855_1018134882	84
116	3300005578	Ga0068854_100593291	Ga0068854_1005932912	84
117	3300005616	Ga0068852_100202156	Ga0068852_1002021563	84
118	3300005617	Ga0068859_100004346	Ga0068859_1000043469	84
119	3300005618	Ga0068864_100001109	Ga0068864_10000110934	84
120	3300005618	Ga0068864_100001179	Ga0068864_1000011797	84
121	3300005618	Ga0068864_100012637	Ga0068864_1000126375	84
122	3300005618	Ga0068864_100545048	Ga0068864_1005450482	84
123	3300005618	Ga0068864_100563001	Ga0068864_1005630012	84
124	3300005719	Ga0068861_100062909	Ga0068861_1000629095	84
125	3300005841	Ga0068863_100000069	Ga0068863_10000006961	84
126	3300005841	Ga0068863_100103612	Ga0068863_1001036125	84
127	3300005841	Ga0068863_100159361	Ga0068863_1001593612	84
128	3300005842	Ga0068858_100000103	Ga0068858_10000010378	84
129	3300005842	Ga0068858_100000964	Ga0068858_10000096428	84
130	3300005842	Ga0068858_100035604	Ga0068858_1000356044	84
131	3300005842	Ga0068858_102254347	Ga0068858_1022543472	84
132	3300005843	Ga0068860_100000056	Ga0068860_10000005615	84
133	3300005843	Ga0068860_100070722	Ga0068860_1000707223	84
134	3300006042	Ga0075368_10012658	Ga0075368_100126583	84
135	3300006051	Ga0075364_10593379	Ga0075364_105933792	84
136	3300006178	Ga0075367_10005638	Ga0075367_100056383	84
137	3300006931	Ga0097620_100004346	Ga0097620_1000043469	84
138	3300006931	Ga0097620_102235304	Ga0097620_1022353042	84
139	3300009011	Ga0105251_10292273	Ga0105251_102922731	84
140	3300009093	Ga0105240_10191082	Ga0105240_101910822	84
141	3300009093	Ga0105240_10233335	Ga0105240_102333354	84
142	3300009101	Ga0105247_10021798	Ga0105247_100217982	84
143	3300009177	Ga0105248_10018782	Ga0105248_100187828	84
144	3300009177	Ga0105248_10433122	Ga0105248_104331222	84
145	3300009551	Ga0105238_10196139	Ga0105238_101961394	84
146	3300009551	Ga0105238_11819758	Ga0105238_118197582	84
147	3300009553	Ga0105249_10834638	Ga0105249_108346383	84
148	3300010375	Ga0105239_10743415	Ga0105239_107434151	84
149	3300012513	Ga0157326_1000035	Ga0157326_10000353	84
150	3300012513	Ga0157326_1055621	Ga0157326_10556212	84
151	3300013100	Ga0157373_10063171	Ga0157373_100631713	84
152	3300013102	Ga0157371_10176400	Ga0157371_101764003	84
153	3300013104	Ga0157370_10101380	Ga0157370_101013803	84
154	3300013104	Ga0157370_10380626	Ga0157370_103806262	84
155	3300013104	Ga0157370_11141364	Ga0157370_111413642	84
156	3300013105	Ga0157369_10374136	Ga0157369_103741362	84
157	3300013105	Ga0157369_12613143	Ga0157369_126131432	84
158	3300013105	Ga0157369_12633462	Ga0157369_126334621	84
159	3300013296	Ga0157374_10177608	Ga0157374_101776084	84
160	3300013306	Ga0163162_10011507	Ga0163162_100115077	84
161	3300014325	Ga0163163_10534628	Ga0163163_105346283	84
162	3300014325	Ga0163163_10663226	Ga0163163_106632262	84
163	3300014325	Ga0163163_10795650	Ga0163163_107956502	84
164	3300014968	Ga0157379_10055350	Ga0157379_100553505	84
165	3300017792	Ga0163161_10313973	Ga0163161_103139731	84
166	3300017792	Ga0163161_10770442	Ga0163161_107704422	84
167	3300020081	Ga0206354_10147980	Ga0206354_101479802	84
168	3300020082	Ga0206353_11734250	Ga0206353_117342501	84
169	3300021388	Ga0213875_10000275	Ga0213875_1000027531	84
170	3300025735	Ga0207713_1015837	Ga0207713_10158374	84
171	3300025735	Ga0207713_1224433	Ga0207713_12244332	84
172	3300025900	Ga0207710_10074802	Ga0207710_100748022	84
173	3300025909	Ga0207705_11082420	Ga0207705_110824202	84
174	3300025913	Ga0207695_10066263	Ga0207695_100662634	84
175	3300025919	Ga0207657_10340928	Ga0207657_103409282	84
176	3300025921	Ga0207652_10703398	Ga0207652_107033983	84
177	3300025923	Ga0207681_10000088	Ga0207681_1000008856	84
178	3300025924	Ga0207694_10221332	Ga0207694_102213324	84
179	3300025925	Ga0207650_10000235	Ga0207650_1000023584	84
180	3300025925	Ga0207650_10028937	Ga0207650_100289372	84
181	3300025927	Ga0207687_10060824	Ga0207687_100608244	84
182	3300025929	Ga0207664_10409485	Ga0207664_104094852	84
183	3300025931	Ga0207644_10000002	Ga0207644_10000002924	84
184	3300025932	Ga0207690_10019450	Ga0207690_100194505	84
185	3300025932	Ga0207690_10835724	Ga0207690_108357242	84
186	3300025933	Ga0207706_11486005	Ga0207706_114860051	84
187	3300025936	Ga0207670_10002319	Ga0207670_1000231910	84
188	3300025941	Ga0207711_10038433	Ga0207711_100384336	84
189	3300025949	Ga0207667_10273473	Ga0207667_102734733	84
190	3300025961	Ga0207712_12077894	Ga0207712_120778942	84
191	3300025972	Ga0207668_10027115	Ga0207668_100271154	84
192	3300025981	Ga0207640_10856925	Ga0207640_108569251	84
193	3300025986	Ga0207658_10000011	Ga0207658_1000001115	84
194	3300026035	Ga0207703_10000691	Ga0207703_1000069126	84
195	3300026035	Ga0207703_10012001	Ga0207703_1001200110	84
196	3300026035	Ga0207703_10016505	Ga0207703_100165056	84
197	3300026041	Ga0207639_10610498	Ga0207639_106104982	84
198	3300026088	Ga0207641_10000112	Ga0207641_1000011277	84
199	3300026088	Ga0207641_10012777	Ga0207641_100127776	84
200	3300026088	Ga0207641_10249793	Ga0207641_102497932	84
201	3300026088	Ga0207641_10264667	Ga0207641_102646674	84
202	3300026095	Ga0207676_10000945	Ga0207676_1000094513	84
203	3300026095	Ga0207676_10011373	Ga0207676_100113733	84
204	3300026095	Ga0207676_10013472	Ga0207676_100134727	84
205	3300026095	Ga0207676_11215220	Ga0207676_112152202	84
206	3300026118	Ga0207675_100003316	Ga0207675_10000331619	84
207	3300027866	Ga0209813_10000087	Ga0209813_1000008725	84
208	3300028379	Ga0268266_10000025	Ga0268266_10000025375	84
209	3300028379	Ga0268266_10110212	Ga0268266_101102124	84
210	3300028380	Ga0268265_10062194	Ga0268265_100621943	84
211	3300028381	Ga0268264_10000089	Ga0268264_10000089235	84
212	3300028381	Ga0268264_10000288	Ga0268264_100002885	84
213	3300028800	Ga0265338_10026310	Ga0265338_100263104	84
214	3300031239	Ga0265328_10028076	Ga0265328_100280762	84
215	3300031548	Ga0307408_101945556	Ga0307408_1019455562	84
216	3300031852	Ga0307410_11543897	Ga0307410_115438972	84
217	3300031901	Ga0307406_10101724	Ga0307406_101017242	84
218	3300031901	Ga0307406_10119498	Ga0307406_101194982	84
219	3300031911	Ga0307412_10082839	Ga0307412_100828393	84
220	3300031911	Ga0307412_11158423	Ga0307412_111584232	84
221	3300032005	Ga0307411_12254245	Ga0307411_122542452	84
222	3300035172	Ga0373955_0051311	Ga0373955_0051311_1688_1954	84
223	3300035695	Ga0373927_0065817	Ga0373927_0065817_916_1182	84
224	3300037418	Ga0395900_0530344	Ga0395900_0530344_332_598	84
225	3300037471	Ga0395905_0000314	Ga0395905_0000314_31807_32079	84
226	3300037853	Ga0436364_0011659	Ga0436364_0011659_56309_56575	84
227	3300038443	Ga0395901_1092288	Ga0395901_1092288_82_348	84
228	3300039437	Ga0436365_0870050	Ga0436365_0870050_464_730	84
229	3300039450	Ga0436363_0647589	Ga0436363_0647589_382_648	84
230	3300041404	Ga0439436_0037530	Ga0439436_0037530_749_1015	84
231	3300041410	Ga0439461_0004669	Ga0439461_0004669_268_534	84
232	3300041411	Ga0439466_0058573	Ga0439466_0058573_255_521	84
233	3300041413	Ga0439465_0005170	Ga0439465_0005170_1776_2042	84
234	3300041452	Ga0451793_1823492	Ga0451793_1823492_355_621	84
235	3300041462	Ga0451806_498320	Ga0451806_498320_312_584	84
236	3300041498	Ga0451841_0644503	Ga0451841_0644503_314_583	84
237	3300041997	Ga0439431_0000114	Ga0439431_0000114_11758_12024	84
238	3300041999	Ga0439433_0052815	Ga0439433_0052815_440_706	84
239	3300042002	Ga0439442_010357	Ga0439442_010357_923_1189	84
240	3300042004	Ga0439445_0001641	Ga0439445_0001641_1979_2245	84
241	3300042006	Ga0439432_000864	Ga0439432_000864_1770_2036	84
242	3300042010	Ga0439452_020856	Ga0439452_020856_171_437	84
243	3300042014	Ga0439457_039798	Ga0439457_039798_137_403	84
244	3300042015	Ga0439462_0000602	Ga0439462_0000602_1670_1936	84
245	3300042435	Ga0439434_0000382	Ga0439434_0000382_1582_1848	84
246	3300046460	Ga0495638_0059382	Ga0495638_0059382_1567_1833	84
247	3300046492	Ga0495585_0112787	Ga0495585_0112787_797_1063	84
248	3300046492	Ga0495585_0509526	Ga0495585_0509526_56_328	84
249	3300046501	Ga0495607_0009554	Ga0495607_0009554_4453_4722	84
250	3300046507	Ga0495606_0059545	Ga0495606_0059545_1882_2151	84
251	3300046519	Ga0495632_0144316	Ga0495632_0144316_798_1064	84
252	3300046522	Ga0495643_0014096	Ga0495643_0014096_3994_4263	84
253	3300046522	Ga0495643_0078087	Ga0495643_0078087_282_548	84
254	3300046524	Ga0495648_0062951	Ga0495648_0062951_188_454	84
255	3300046558	Ga0495633_0012226	Ga0495633_0012226_2055_2327	84
256	3300046616	Ga0495668_0024908	Ga0495668_0024908_2328_2594	84
257	3300046665	Ga0495661_0344803	Ga0495661_0344803_152_421	84
258	3300046691	Ga0495670_0125072	Ga0495670_0125072_57_329	84
259	3300046810	Ga0495660_0292895	Ga0495660_0292895_215_481	84
260	3300047469	Ga0495673_0000053	Ga0495673_0000053_193201_193467	84
261	3300047472	Ga0495686_0027104	Ga0495686_0027104_713_979	84
262	3300048903	Ga0496100_0460913	Ga0496100_0460913_142_396	84
263	3300048913	Ga0496110_0996272	Ga0496110_0996272_14_268	84
264	3300048919	Ga0496116_0164697	Ga0496116_0164697_724_990	84
265	3300048919	Ga0496116_0438924	Ga0496116_0438924_240_494	84
266	3300048920	Ga0496117_0299751	Ga0496117_0299751_428_682	84
267	3300048921	Ga0496118_0230121	Ga0496118_0230121_647_901	84
268	3300048925	Ga0496122_0535660	Ga0496122_0535660_201_467	84
269	3300048926	Ga0496123_0276051	Ga0496123_0276051_180_446	84
270	3300048927	Ga0496124_0001448	Ga0496124_0001448_22652_22906	84
271	3300048927	Ga0496124_0270732	Ga0496124_0270732_167_433	84
272	3300048929	Ga0496126_0573471	Ga0496126_0573471_361_627	84
273	3300049570	Ga0501033_0000038	Ga0501033_0000038_80263_80535	84
274	3300049571	Ga0501034_0301160	Ga0501034_0301160_1047_1319	84
275	3300049571	Ga0501034_1423062	Ga0501034_1423062_125_391	84
276	3300049581	Ga0501047_0184535	Ga0501047_0184535_759_1025	84
277	3300049585	Ga0501069_0020997	Ga0501069_0020997_226_492	84
278	3300049586	Ga0501070_0080166	Ga0501070_0080166_2110_2376	84
279	3300049591	Ga0501075_0837624	Ga0501075_0837624_366_632	84
280	3300049766	Ga0501269_032001	Ga0501269_032001_348_614	84
281	3300049822	Ga0501035_0000367	Ga0501035_0000367_46879_47151	84
282	3300049823	Ga0501044_1336112	Ga0501044_1336112_223_489	84
283	3300050494	nmdc:mga06z11_1001_c1	nmdc:mga06z11_1001_c1_7734_8000	84
284	3300050495	nmdc:mga04h51_839_c1	nmdc:mga04h51_839_c1_1575_1841	84
285	3300050496	nmdc:mga07m45_626911_c1	nmdc:mga07m45_626911_c1_41_307	84
286	3300053087	Ga0500643_000314	Ga0500643_000314_35864_36130	84
287	3300053087	Ga0500643_001512	Ga0500643_001512_904_1170	84
288	3300053087	Ga0500643_007506	Ga0500643_007506_3195_3449	84
289	3300053087	Ga0500643_016184	Ga0500643_016184_105_371	84
290	3300053087	Ga0500643_026054	Ga0500643_026054_539_805	84
291	3300053087	Ga0500643_064748	Ga0500643_064748_757_1011	84
292	3300053090	Ga0500646_0080801	Ga0500646_0080801_124_390	84
293	3300053091	Ga0500647_0279958	Ga0500647_0279958_366_632	84
294	3300053094	Ga0500566_0000008	Ga0500566_0000008_59837_60103	84
295	3300053095	Ga0500640_005167	Ga0500640_005167_1095_1361	84
296	3300053096	Ga0500641_0001456	Ga0500641_0001456_6537_6803	84
297	3300053104	Ga0500556_0010197	Ga0500556_0010197_1010_1276	84
298	3300053105	Ga0500557_048942	Ga0500557_048942_925_1191	84
299	3300053108	Ga0500562_034700	Ga0500562_034700_488_754	84
300	3300053108	Ga0500562_115700	Ga0500562_115700_164_430	84
301	3300053111	Ga0500572_019578	Ga0500572_019578_538_804	84
302	3300053115	Ga0500591_113988	Ga0500591_113988_458_724	84
303	3300053122	Ga0500608_021366	Ga0500608_021366_1487_1753	84
304	3300053123	Ga0500614_001835	Ga0500614_001835_2923_3189	84
305	3300053125	Ga0500618_000007	Ga0500618_000007_82380_82652	84
306	3300053133	Ga0500655_000172	Ga0500655_000172_12694_12960	84
307	3300053134	Ga0500658_0427065	Ga0500658_0427065_308_574	84
308	3300053136	Ga0500559_0002991	Ga0500559_0002991_7196_7462	84
309	3300053139	Ga0500568_0280719	Ga0500568_0280719_229_495	84
310	3300053139	Ga0500568_0304324	Ga0500568_0304324_186_473	84
311	3300053140	Ga0500573_0068360	Ga0500573_0068360_624_890	84
312	3300053144	Ga0500585_182276	Ga0500585_182276_372_638	84
313	3300053148	Ga0500590_000500	Ga0500590_000500_1255_1521	84
314	3300053150	Ga0500603_000805	Ga0500603_000805_5692_5958	84
315	3300053153	Ga0500616_0050690	Ga0500616_0050690_562_828	84
316	3300053153	Ga0500616_0062785	Ga0500616_0062785_395_661	84
317	3300053156	Ga0500622_0018265	Ga0500622_0018265_1375_1641	84
318	3300053159	Ga0500630_000498	Ga0500630_000498_14666_14932	84
319	3300053162	Ga0500638_043729	Ga0500638_043729_1431_1697	84
320	3300053163	Ga0500639_000010	Ga0500639_000010_86549_86815	84
321	3300053163	Ga0500639_344143	Ga0500639_344143_175_441	84
322	3300053177	Ga0500636_0339541	Ga0500636_0339541_223_489	84
323	3300053178	Ga0500637_0044960	Ga0500637_0044960_1283_1549	84
324	3300053730	Ga0500645_000262	Ga0500645_000262_24956_25222	84
325	3300053730	Ga0500645_000404	Ga0500645_000404_13424_13690	84
326	3300053735	Ga0500596_000632	Ga0500596_000632_702_968	84
327	3300053737	Ga0500601_001667	Ga0500601_001667_1047_1313	84
328	3300060353	Ga0501082_0683869	Ga0501082_0683869_272_538	84
329	3300013102	Ga0157371_10017590	Ga0157371_100175902	87
330	3300013105	Ga0157369_10002832	Ga0157369_100028327	87
331	3300020077	Ga0206351_10943377	Ga0206351_109433771	87
332	3300038443	Ga0395901_0000017	Ga0395901_0000017_113610_113873	87
333	3300038443	Ga0395901_0311362	Ga0395901_0311362_135_398	87
334	3300042005	Ga0439448_0052168	Ga0439448_0052168_848_1150	87
335	3300044658	Ga0466972_0012483	Ga0466972_0012483_3842_4105	87
336	3300003792	Ga0055540_1010979	Ga0055540_10109793	91
337	3300025303	Ga0209051_1004696	Ga0209051_10046968	91
338	iso_pu_bacteria	2857547612	2857548614	94
339	iso_pu_bacteria	2791355137	2792838796	96
340	iso_pu_bacteria	2928157003	2928163711	96
341	3300014497	Ga0182008_10005830	Ga0182008_100058304	98
342	3300015261	Ga0182006_1000007	Ga0182006_1000007390	98
343	3300015262	Ga0182007_10000022	Ga0182007_10000022136	98
344	3300015265	Ga0182005_1000010	Ga0182005_1000010367	98
345	3300041512	Ga0451853_1737656	Ga0451853_1737656_10_306	98
346	3300048914	Ga0496111_0254715	Ga0496111_0254715_127_432	98
347	3300048924	Ga0496121_0006942	Ga0496121_0006942_5651_5956	98
348	3300048925	Ga0496122_0002165	Ga0496122_0002165_4322_4627	98
349	3300048926	Ga0496123_0001145	Ga0496123_0001145_18003_18308	98
350	3300048927	Ga0496124_0067801	Ga0496124_0067801_2104_2409	98
351	3300048928	Ga0496125_0243004	Ga0496125_0243004_620_925	98
352	3300001904	JGI24736J21556_1029935	JGI24736J21556_10299352	100
353	3300001989	JGI24739J22299_10012983	JGI24739J22299_100129834	100
354	3300001989	JGI24739J22299_10020791	JGI24739J22299_100207913	100
355	3300001990	JGI24737J22298_10103560	JGI24737J22298_101035602	100
356	3300002067	JGI24735J21928_10000847	JGI24735J21928_100008472	100
357	3300003187	JGI25151J46595_10007626	JGI25151J46595_100076267	100
358	3300003781	Ga0055536_1000169	Ga0055536_100016959	100
359	3300005327	Ga0070658_10004537	Ga0070658_1000453711	100
360	3300005327	Ga0070658_10016474	Ga0070658_100164741	100
361	3300005339	Ga0070660_100003391	Ga0070660_10000339112	100
362	3300005539	Ga0068853_101467001	Ga0068853_1014670011	100
363	3300005563	Ga0068855_100007988	Ga0068855_10000798811	100
364	3300005614	Ga0068856_100158345	Ga0068856_1001583454	100
365	3300005616	Ga0068852_100307502	Ga0068852_1003075022	100
366	3300005616	Ga0068852_100340232	Ga0068852_1003402321	100
367	3300006237	Ga0097621_101519015	Ga0097621_1015190152	100
368	3300009093	Ga0105240_10002204	Ga0105240_1000220418	100
369	3300009098	Ga0105245_11704654	Ga0105245_117046542	100
370	3300009174	Ga0105241_10043979	Ga0105241_100439794	100
371	3300009545	Ga0105237_10003832	Ga0105237_1000383217	100
372	3300009545	Ga0105237_11087409	Ga0105237_110874092	100
373	3300009551	Ga0105238_10119625	Ga0105238_101196254	100
374	3300010375	Ga0105239_11015468	Ga0105239_110154682	100
375	3300013100	Ga0157373_10002990	Ga0157373_100029905	100
376	3300013104	Ga0157370_10005400	Ga0157370_100054002	100
377	3300013105	Ga0157369_10018420	Ga0157369_100184204	100
378	3300013105	Ga0157369_10421971	Ga0157369_104219712	100
379	3300013296	Ga0157374_10000049	Ga0157374_1000004975	100
380	3300013306	Ga0163162_10558427	Ga0163162_105584273	100
381	3300013306	Ga0163162_12660261	Ga0163162_126602611	100
382	3300013307	Ga0157372_10001561	Ga0157372_1000156112	100
383	3300014497	Ga0182008_10102315	Ga0182008_101023152	100
384	3300015261	Ga0182006_1093937	Ga0182006_10939373	100
385	3300015261	Ga0182006_1165311	Ga0182006_11653112	100
386	3300020069	Ga0197907_11494566	Ga0197907_114945662	100
387	3300020075	Ga0206349_1485105	Ga0206349_14851052	100
388	3300020076	Ga0206355_1153817	Ga0206355_11538172	100
389	3300020078	Ga0206352_11157109	Ga0206352_111571092	100
390	3300020080	Ga0206350_10253049	Ga0206350_102530492	100
391	3300020081	Ga0206354_10439898	Ga0206354_104398983	100
392	3300020082	Ga0206353_10691668	Ga0206353_106916682	100
393	3300022467	Ga0224712_10056085	Ga0224712_100560851	100
394	3300022467	Ga0224712_10260566	Ga0224712_102605662	100
395	3300025292	Ga0209676_1000462	Ga0209676_100046273	100
396	3300025294	Ga0209025_1011831	Ga0209025_10118318	100
397	3300025294	Ga0209025_1027753	Ga0209025_10277533	100
398	3300025904	Ga0207647_10000461	Ga0207647_1000046123	100
399	3300025909	Ga0207705_10068895	Ga0207705_100688952	100
400	3300025909	Ga0207705_10094075	Ga0207705_100940752	100
401	3300025911	Ga0207654_10075682	Ga0207654_100756823	100
402	3300025913	Ga0207695_10011287	Ga0207695_100112874	100
403	3300025914	Ga0207671_10540864	Ga0207671_105408642	100
404	3300025914	Ga0207671_10727787	Ga0207671_107277871	100
405	3300025919	Ga0207657_10004791	Ga0207657_100047917	100
406	3300025924	Ga0207694_10563935	Ga0207694_105639351	100
407	3300025927	Ga0207687_10623869	Ga0207687_106238692	100
408	3300025949	Ga0207667_10024538	Ga0207667_100245384	100
409	3300026041	Ga0207639_11336650	Ga0207639_113366502	100
410	3300026078	Ga0207702_10142339	Ga0207702_101423394	100
411	3300026116	Ga0207674_10703388	Ga0207674_107033882	100
412	3300026142	Ga0207698_10947947	Ga0207698_109479472	100
413	3300026142	Ga0207698_11059265	Ga0207698_110592652	100
414	3300037312	Ga0395899_0301581	Ga0395899_0301581_144_446	100
415	3300037418	Ga0395900_0385344	Ga0395900_0385344_779_1081	100
416	3300037418	Ga0395900_0766988	Ga0395900_0766988_142_444	100
417	3300037466	Ga0395898_0003342	Ga0395898_0003342_13265_13567	100
418	3300037466	Ga0395898_1614538	Ga0395898_1614538_208_510	100
419	3300038443	Ga0395901_0207710	Ga0395901_0207710_1231_1533	100
420	3300038443	Ga0395901_0475094	Ga0395901_0475094_902_1204	100
421	3300038443	Ga0395901_0716618	Ga0395901_0716618_226_528	100
422	3300044656	Ga0466969_0036396	Ga0466969_0036396_1759_2073	100
423	3300044684	Ga0466966_0170548	Ga0466966_0170548_816_1130	100
424	3300044693	Ga0466961_0137680	Ga0466961_0137680_1041_1355	100
425	3300045049	Ga0466959_0018737	Ga0466959_0018737_1000_1314	100
426	3300045836	Ga0466958_0181032	Ga0466958_0181032_900_1214	100
427	3300047472	Ga0495686_0000359	Ga0495686_0000359_48698_49000	100
428	3300048915	Ga0496112_0653311	Ga0496112_0653311_458_763	100
429	3300048919	Ga0496116_0166259	Ga0496116_0166259_207_512	100
430	3300048922	Ga0496119_0042052	Ga0496119_0042052_1523_1831	100
431	3300048924	Ga0496121_0904615	Ga0496121_0904615_171_476	100
432	3300048925	Ga0496122_0258057	Ga0496122_0258057_228_533	100
433	3300048928	Ga0496125_0233016	Ga0496125_0233016_577_885	100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

22

101

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6n90-assembly1.cif.gz_A	yoeb/pare toxin from agrobacterium tumefaciens	0.9646	18	100
6n90-assembly1.cif.gz_B	yoeb/pare toxin from agrobacterium tumefaciens	0.9558	18	100
4v8x-assembly2.cif.gz_CY	structure of thermus thermophilus ribosome	0.9519	18	100
7cua-assembly1.cif.gz_B	the structure of yoeb dimer from staphylococcus aureus	0.9513	17	100
3oei-assembly4.cif.gz_O	crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358-relbe3)	0.9466	18	100

ID	Description	Score	Start	End	Superfamily
4bydY00	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.9519	18	100	3.30.2310.20
af_P9WF09_1_85_3.30.2310.20	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.9374	16	100	3.30.2310.20
4bydY00	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.9304	18	100	3.30.2310.20
af_P9WF09_1_85_3.30.2310.20	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.9268	16	100	3.30.2310.20
af_Q2FVF8_1_87_3.30.2310.20	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.8706	17	100	3.30.2310.20

ID	Description	Score	Start	End	GO Terms
AF-A0A480A579-F1-model_v4	Putative mRNA interferase YoeB	0.9974	26	84	GO:0004519 GO:0006401
AF-A0A1J5BFE1-F1-model_v4	Putative mRNA interferase YoeB	0.9942	18	97	GO:0004519 GO:0006401
AF-A0A7V4YZ20-F1-model_v4	Putative mRNA interferase YoeB	0.9926	18	100	GO:0004519 GO:0006401 GO:0045892
AF-A0A840UNX6-F1-model_v4	Putative mRNA interferase YoeB	0.9916	22	87	GO:0004519 GO:0006401 GO:0045892
AF-A0A7V8FSH7-F1-model_v4	Putative mRNA interferase YoeB	0.9901	18	97	GO:0004519 GO:0006401 GO:0098795

Feature Viewer

pLDDT	pTM	Quality
94.89	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442905

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

22

101

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map