F442845

General Info

Members Datasets Scaffolds Average Seq Length
433 197 866 307

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10054218|Ga0157380_100542182
Length 328
Sequence MTTSIDEIREDATVADTTAMRLEGIHHVTCITGNAPVNVEFYTGVLGLRLVKKTVNQDDPTVYHLFYADEAGSAGADITFFEYPGARRGRAGAGMVHTVSFRVASEEAIAFWDQRLLAGGAFPQRTQDGRLRFEDPEGLGLELVVSGASDRPLVAAHPEIPAELAIQGFDGVRAFASDAARSRELLEDVLGFRPTGEASWEVRGEKRGGLYAYDAPPASGPGVPGAGTVHHVAWSSTMEDHEAWQRRVAEAGAHATPVIDRFWFRSVYFREPSGVLFELATLGPGFGIDEDPEHLGESLILPPAFEHLRLQVEQVLTPLPDPRAAWRG

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 6
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10054218 3300014326 Bacteria 3181
2 Ga0070683_100025663 3300005329 Bacteria 5295
3 Ga0068869_100060424 3300005334 Bacteria 2778
4 Ga0068868_100026524 3300005338 Bacteria 4417
5 Ga0068868_100030722 3300005338 Bacteria 4120
6 Ga0070692_10002835 3300005345 Bacteria 6849
7 Ga0070669_100209612 3300005353 Bacteria 1537
8 Ga0070675_100253495 3300005354 Bacteria 1541
9 Ga0070671_100103411 3300005355 Bacteria 2390
10 Ga0070688_100103482 3300005365 Bacteria 1881
11 Ga0070659_100025446 3300005366 Bacteria 4546
12 Ga0070659_100076489 3300005366 Bacteria 2669
13 Ga0070659_100334138 3300005366 Bacteria 1269
14 Ga0070709_10142552 3300005434 Bacteria 1648
15 Ga0070709_10201468 3300005434 Bacteria 1410
16 Ga0070711_100000409 3300005439 Bacteria 22269
17 Ga0070705_100034325 3300005440 Bacteria 2835
18 Ga0070700_100034601 3300005441 Bacteria 3053
19 Ga0070700_100092631 3300005441 Bacteria 1975
20 Ga0070678_100028542 3300005456 Bacteria 3808
21 Ga0070681_10046293 3300005458 Bacteria 4349
22 Ga0070681_10075215 3300005458 Bacteria 3337
23 Ga0070707_100340569 3300005468 Bacteria 1457
24 Ga0070679_100117499 3300005530 Bacteria 2644
25 Ga0070684_100022817 3300005535 Bacteria 5225
26 Ga0070684_100032001 3300005535 Bacteria 4480
27 Ga0070684_100074497 3300005535 Bacteria 2992
28 Ga0070697_100422889 3300005536 Bacteria 1158
29 Ga0068853_100519015 3300005539 Bacteria 1126
30 Ga0070665_100001191 3300005548 Bacteria 31756
31 Ga0068854_100042410 3300005578 Bacteria 3221
32 Ga0068856_100036997 3300005614 Bacteria 4787
33 Ga0070702_100250100 3300005615 Bacteria 1201
34 Ga0068864_100256608 3300005618 Bacteria 1625
35 Ga0068861_100049925 3300005719 Bacteria 3170
36 Ga0068870_10056548 3300005840 Bacteria 2095
37 Ga0068860_100448427 3300005843 Bacteria 1283
38 Ga0081455_10008854 3300005937 Bacteria 10412
39 Ga0081455_10009192 3300005937 Bacteria 10184
40 Ga0081455_10015388 3300005937 Bacteria 7436
41 Ga0081455_10040418 3300005937 Bacteria 4112
42 Ga0081538_10000078 3300005981 Bacteria 92826
43 Ga0081538_10001073 3300005981 Bacteria 29053
44 Ga0081538_10001255 3300005981 Bacteria 26461
45 Ga0081538_10003942 3300005981 Bacteria 13841
46 Ga0081538_10005380 3300005981 Bacteria 11508
47 Ga0081538_10008721 3300005981 Bacteria 8561
48 Ga0081538_10019530 3300005981 Bacteria 5030
49 Ga0081538_10022244 3300005981 Bacteria 4598
50 Ga0070717_10003116 3300006028 Bacteria 11832
51 Ga0075365_10097068 3300006038 Bacteria 2014
52 Ga0075365_10183262 3300006038 Bacteria 1464
53 Ga0075364_10133009 3300006051 Bacteria 1670
54 Ga0075432_10006037 3300006058 Bacteria 4122
55 Ga0070716_100145130 3300006173 Bacteria 1519
56 Ga0070712_100291927 3300006175 Bacteria 1317
57 Ga0075428_100003867 3300006844 Bacteria 16450
58 Ga0075433_10047910 3300006852 Bacteria 3717
59 Ga0075434_100001635 3300006871 Bacteria 19072
60 Ga0075429_100036012 3300006880 Bacteria 4304
61 Ga0068865_100036882 3300006881 Bacteria 3299
62 Ga0075435_100001692 3300007076 Bacteria 14333
63 Ga0105240_10140960 3300009093 Bacteria 2882
64 Ga0111539_10004498 3300009094 Bacteria 18226
65 Ga0111539_10008496 3300009094 Bacteria 13051
66 Ga0105245_10007358 3300009098 Bacteria 9640
67 Ga0105245_10021684 3300009098 Bacteria 5639
68 Ga0105245_10021783 3300009098 Bacteria 5625
69 Ga0105247_10017536 3300009101 Bacteria 4294
70 Ga0114129_10024462 3300009147 Bacteria 8557
71 Ga0114129_10033599 3300009147 Bacteria 7248
72 Ga0114129_10079097 3300009147 Bacteria 4572
73 Ga0105243_10004978 3300009148 Bacteria 10414
74 Ga0105243_10073267 3300009148 Bacteria 2775
75 Ga0105243_10080612 3300009148 Bacteria 2655
76 Ga0105243_10098129 3300009148 Bacteria 2426
77 Ga0105241_10065813 3300009174 Bacteria 2801
78 Ga0105242_10215309 3300009176 Bacteria 1714
79 Ga0105242_10432890 3300009176 Bacteria 1236
80 Ga0105248_10102075 3300009177 Bacteria 3233
81 Ga0105238_10119516 3300009551 Bacteria 2615
82 Ga0105249_10075774 3300009553 Bacteria 3116
83 Ga0105249_10236212 3300009553 Bacteria 1805
84 Ga0105239_10028276 3300010375 Bacteria 6168
85 Ga0105239_10073733 3300010375 Bacteria 3752
86 Ga0157370_10052268 3300013104 Bacteria 3901
87 Ga0157369_10001705 3300013105 Bacteria 26767
88 Ga0157369_10008801 3300013105 Bacteria 11568
89 Ga0157374_10017917 3300013296 Bacteria 6242
90 Ga0157372_10053921 3300013307 Bacteria 4483
91 Ga0157372_10113840 3300013307 Bacteria 3101
92 Ga0157372_10575290 3300013307 Bacteria 1313
93 Ga0163163_10056637 3300014325 Bacteria 3874
94 Ga0157377_10027104 3300014745 Bacteria 3073
95 Ga0157377_10087507 3300014745 Bacteria 1833
96 Ga0157379_10051208 3300014968 Bacteria 3688
97 Ga0213876_10042997 3300021384 Bacteria 2388
98 Ga0213875_10100145 3300021388 Bacteria 1352
99 Ga0213871_10012370 3300021441 Bacteria 1981
100 Ga0207710_10050817 3300025900 Bacteria 1861
101 Ga0207688_10020674 3300025901 Bacteria 3594
102 Ga0207699_10346374 3300025906 Bacteria 1048
103 Ga0207695_10118758 3300025913 Bacteria 2615
104 Ga0207693_10053640 3300025915 Bacteria 3163
105 Ga0207693_10075679 3300025915 Bacteria 2636
106 Ga0207693_10183213 3300025915 Bacteria 1648
107 Ga0207693_10207816 3300025915 Bacteria 1539
108 Ga0207693_10312747 3300025915 Bacteria 1230
109 Ga0207663_10315299 3300025916 Bacteria 1173
110 Ga0207663_10482841 3300025916 Bacteria 960
111 Ga0207657_10022597 3300025919 Bacteria 5880
112 Ga0207657_10043977 3300025919 Bacteria 3930
113 Ga0207652_10149818 3300025921 Bacteria 2088
114 Ga0207694_10032892 3300025924 Bacteria 3972
115 Ga0207687_10002364 3300025927 Bacteria 12821
116 Ga0207687_10008197 3300025927 Bacteria 6836
117 Ga0207687_10057249 3300025927 Bacteria 2738
118 Ga0207700_10201377 3300025928 Bacteria 1678
119 Ga0207664_10164099 3300025929 Bacteria 1897
120 Ga0207664_10346144 3300025929 Bacteria 1315
121 Ga0207644_10101651 3300025931 Bacteria 2161
122 Ga0207644_10112142 3300025931 Bacteria 2064
123 Ga0207690_10003774 3300025932 Bacteria 8970
124 Ga0207690_10284990 3300025932 Bacteria 1288
125 Ga0207690_10335981 3300025932 Bacteria 1191
126 Ga0207706_10021000 3300025933 Bacteria 5865
127 Ga0207686_10080411 3300025934 Bacteria 2125
128 Ga0207704_10015786 3300025938 Bacteria 3860
129 Ga0207665_10159407 3300025939 Bacteria 1622
130 Ga0207711_10061920 3300025941 Bacteria 3227
131 Ga0207689_10075094 3300025942 Bacteria 2778
132 Ga0207689_10235292 3300025942 Bacteria 1514
133 Ga0207667_10016092 3300025949 Bacteria 8466
134 Ga0207677_10145733 3300026023 Bacteria 1819
135 Ga0207702_10003948 3300026078 Bacteria 13325
136 Ga0207648_10146923 3300026089 Bacteria 2080
137 Ga0207675_100115407 3300026118 Bacteria 2537
138 Ga0207683_10047491 3300026121 Bacteria 3760
139 Ga0207428_10000104 3300027907 Bacteria 116036
140 Ga0268266_10063286 3300028379 Bacteria 3193
141 Ga0268266_10405346 3300028379 Bacteria 1290
142 Ga0268265_10306250 3300028380 Bacteria 1433
143 Ga0265319_1000813 3300028563 Bacteria 19941
144 Ga0265318_10001748 3300028577 Bacteria 12396
145 Ga0265322_10002810 3300028654 Bacteria 5319
146 Ga0265338_10001704 3300028800 Bacteria 34899
147 Ga0265338_10002825 3300028800 Bacteria 25357
148 Ga0265338_10005197 3300028800 Bacteria 17092
149 Ga0265338_10012308 3300028800 Bacteria 9764
150 Ga0265329_10060036 3300031242 Bacteria 1204
151 Ga0265340_10028402 3300031247 Bacteria 2814
152 Ga0265331_10034416 3300031250 Bacteria 2499
153 Ga0265327_10016154 3300031251 Bacteria 4765
154 Ga0265316_10014252 3300031344 Bacteria 7010
155 Ga0265313_10037308 3300031595 Unclassified 2432
156 Ga0265314_10003426 3300031711 Bacteria 15331
157 Ga0307405_10178264 3300031731 Bacteria 1523
158 Ga0307412_10045532 3300031911 Bacteria 2869
159 Ga0307416_100217387 3300032002 Bacteria 1829
160 Ga0307414_10029067 3300032004 Bacteria 3594
161 Ga0307411_10165236 3300032005 Bacteria 1663
162 Ga0373951_0024612 3300035091 Bacteria 1395
163 Ga0373960_0081377 3300035121 Bacteria 1020
164 Ga0373933_0096864 3300035724 Bacteria 1827
165 Ga0373947_0046344 3300035725 Bacteria 2603
166 Ga0395899_0013856 3300037312 Bacteria 6159
167 Ga0395900_0030685 3300037418 Bacteria 5520
168 Ga0395900_0034605 3300037418 Bacteria 5203
169 Ga0395900_0067660 3300037418 Bacteria 3670
170 Ga0395898_0046235 3300037466 Bacteria 4275
171 Ga0395898_0327189 3300037466 Bacteria 1462
172 Ga0395905_0017747 3300037471 Bacteria 6757
173 Ga0395905_0051099 3300037471 Bacteria 3871
174 Ga0436364_0189902 3300037853 Bacteria 7212
175 Ga0395901_0007019 3300038443 Bacteria 11385
176 Ga0395901_0019092 3300038443 Bacteria 7010
177 Ga0436365_0112446 3300039437 Bacteria 4371
178 Ga0436360_0439670 3300039438 Bacteria 8566
179 Ga0436363_0451320 3300039450 Bacteria 2813
180 Ga0466969_0010572 3300044656 Bacteria 4891
181 Ga0466969_0042632 3300044656 Bacteria 2264
182 Ga0466966_0144390 3300044684 Bacteria 1453
183 Ga0466961_0016024 3300044693 Bacteria 4812
184 Ga0466961_0114560 3300044693 Bacteria 1694
185 Ga0466963_0006842 3300044694 Bacteria 6785
186 Ga0466971_0019003 3300044719 Bacteria 3049
187 Ga0466971_0145000 3300044719 Bacteria 1107
188 Ga0466968_0009404 3300044735 Bacteria 3758
189 Ga0466968_0089852 3300044735 Bacteria 1359
190 Ga0466959_0019809 3300045049 Bacteria 4950
191 Ga0466959_0165079 3300045049 Unclassified 1555
192 Ga0466958_0002220 3300045836 Bacteria 9673
193 Ga0466967_0005848 3300045976 Bacteria 8606
194 Ga0466967_0084912 3300045976 Bacteria 2865
195 Ga0466967_0511649 3300045976 Bacteria 1179
196 Ga0495584_0043853 3300046491 Bacteria 2258
197 Ga0495667_0126917 3300046559 Bacteria 1646
198 Ga0495684_0103829 3300047471 Bacteria 2148
199 Ga0495593_0128753 3300047673 Bacteria 1286
200 Ga0495602_0294741 3300048088 Bacteria 1189
201 Ga0496100_0009016 3300048903 Bacteria 5587
202 Ga0496101_0016788 3300048904 Bacteria 4955
203 Ga0496101_0027430 3300048904 Bacteria 3968
204 Ga0496102_0012956 3300048905 Bacteria 7220
205 Ga0496102_0022769 3300048905 Bacteria 5553
206 Ga0496102_0280474 3300048905 Bacteria 1571
207 Ga0496103_0050930 3300048906 Bacteria 2562
208 Ga0496104_0248961 3300048907 Bacteria 1690
209 Ga0496105_0050552 3300048908 Bacteria 3433
210 Ga0496106_0009750 3300048909 Bacteria 7092
211 Ga0496107_0111976 3300048910 Bacteria 2006
212 Ga0496108_0085300 3300048911 Bacteria 2680
213 Ga0496108_0121054 3300048911 Bacteria 2245
214 Ga0496108_0140383 3300048911 Bacteria 2081
215 Ga0496109_0014256 3300048912 Bacteria 6916
216 Ga0496109_0035130 3300048912 Bacteria 4519
217 Ga0496109_0059552 3300048912 Bacteria 3489
218 Ga0496110_0001058 3300048913 Bacteria 19428
219 Ga0496110_0245376 3300048913 Bacteria 1630
220 Ga0496110_0372260 3300048913 Bacteria 1302
221 Ga0496111_0093231 3300048914 Bacteria 2207
222 Ga0496111_0162568 3300048914 Bacteria 1658
223 Ga0496111_0169299 3300048914 Bacteria 1623
224 Ga0496112_0136015 3300048915 Bacteria 2428
225 Ga0496113_0005217 3300048916 Bacteria 8084
226 Ga0496113_0162188 3300048916 Bacteria 1768
227 Ga0501309_006822 3300049129 Bacteria 1401
228 Ga0501321_003248 3300049537 Bacteria 1474
229 Ga0501031_0000242 3300049568 Bacteria 30996
230 Ga0501031_0020548 3300049568 Bacteria 4305
231 Ga0501031_0020832 3300049568 Bacteria 4274
232 Ga0501031_0063613 3300049568 Bacteria 2403
233 Ga0501031_0063661 3300049568 Bacteria 2402
234 Ga0501031_0172417 3300049568 Bacteria 1413
235 Ga0501032_0010084 3300049569 Bacteria 6819
236 Ga0501032_0034161 3300049569 Bacteria 3482
237 Ga0501032_0061729 3300049569 Bacteria 2512
238 Ga0501032_0079475 3300049569 Bacteria 2184
239 Ga0501033_0000237 3300049570 Bacteria 53135
240 Ga0501033_0008656 3300049570 Bacteria 7876
241 Ga0501033_0013009 3300049570 Bacteria 6346
242 Ga0501033_0146814 3300049570 Bacteria 1703
243 Ga0501033_0395640 3300049570 Bacteria 964
244 Ga0501036_0000224 3300049572 Bacteria 37944
245 Ga0501036_0005035 3300049572 Bacteria 10694
246 Ga0501036_0014340 3300049572 Bacteria 6597
247 Ga0501036_0057916 3300049572 Bacteria 3282
248 Ga0501036_0147404 3300049572 Bacteria 1985
249 Ga0501036_0444320 3300049572 Bacteria 1080
250 Ga0501037_0000351 3300049573 Bacteria 38838
251 Ga0501037_0081957 3300049573 Bacteria 2338
252 Ga0501038_0000592 3300049574 Bacteria 32132
253 Ga0501038_0004290 3300049574 Bacteria 13258
254 Ga0501038_0015535 3300049574 Bacteria 6920
255 Ga0501038_0378989 3300049574 Bacteria 1097
256 Ga0501039_0000483 3300049575 Bacteria 28824
257 Ga0501039_0002847 3300049575 Bacteria 12930
258 Ga0501039_0005720 3300049575 Bacteria 9420
259 Ga0501039_0010905 3300049575 Bacteria 6926
260 Ga0501039_0203351 3300049575 Bacteria 1557
261 Ga0501039_0480211 3300049575 Bacteria 976
262 Ga0501040_0001103 3300049576 Bacteria 17097
263 Ga0501040_0005138 3300049576 Bacteria 8464
264 Ga0501040_0048650 3300049576 Bacteria 2897
265 Ga0501040_0082551 3300049576 Bacteria 2228
266 Ga0501040_0132901 3300049576 Bacteria 1750
267 Ga0501040_0172318 3300049576 Bacteria 1532
268 Ga0501041_0000070 3300049577 Bacteria 38960
269 Ga0501041_0001320 3300049577 Bacteria 13654
270 Ga0501041_0002070 3300049577 Bacteria 11288
271 Ga0501041_0007365 3300049577 Bacteria 6460
272 Ga0501041_0023936 3300049577 Bacteria 3663
273 Ga0501041_0027535 3300049577 Bacteria 3425
274 Ga0501041_0028567 3300049577 Bacteria 3364
275 Ga0501041_0127524 3300049577 Bacteria 1584
276 Ga0501042_0000294 3300049578 Bacteria 24709
277 Ga0501042_0003701 3300049578 Bacteria 9660
278 Ga0501042_0004428 3300049578 Bacteria 8959
279 Ga0501042_0017552 3300049578 Bacteria 4937
280 Ga0501042_0039484 3300049578 Bacteria 3354
281 Ga0501042_0045401 3300049578 Bacteria 3131
282 Ga0501043_0000329 3300049579 Bacteria 42843
283 Ga0501043_0004696 3300049579 Bacteria 11075
284 Ga0501043_0054159 3300049579 Bacteria 3150
285 Ga0501043_0162592 3300049579 Bacteria 1744
286 Ga0501043_0243180 3300049579 Bacteria 1388
287 Ga0501046_0001690 3300049580 Bacteria 21099
288 Ga0501046_0006202 3300049580 Bacteria 10614
289 Ga0501046_0016127 3300049580 Bacteria 6266
290 Ga0501046_0145219 3300049580 Bacteria 1792
291 Ga0501047_0000451 3300049581 Bacteria 45403
292 Ga0501047_0016601 3300049581 Bacteria 7028
293 Ga0501048_0000243 3300049582 Bacteria 36346
294 Ga0501048_0002615 3300049582 Bacteria 13781
295 Ga0501048_0008142 3300049582 Bacteria 7931
296 Ga0501048_0055383 3300049582 Bacteria 2815
297 Ga0501048_0065065 3300049582 Bacteria 2578
298 Ga0501048_0065513 3300049582 Bacteria 2569
299 Ga0501067_0255870 3300049583 Bacteria 975
300 Ga0501068_0006574 3300049584 Bacteria 6413
301 Ga0501068_0011786 3300049584 Bacteria 4942
302 Ga0501068_0028932 3300049584 Bacteria 3280
303 Ga0501069_0000401 3300049585 Bacteria 19582
304 Ga0501069_0010577 3300049585 Bacteria 4888
305 Ga0501069_0021000 3300049585 Bacteria 3541
306 Ga0501069_0029491 3300049585 Bacteria 3010
307 Ga0501070_0000237 3300049586 Bacteria 51856
308 Ga0501070_0026562 3300049586 Bacteria 4857
309 Ga0501070_0093796 3300049586 Bacteria 2483
310 Ga0501070_0278591 3300049586 Bacteria 1365
311 Ga0501071_0000176 3300049587 Bacteria 28221
312 Ga0501071_0011648 3300049587 Bacteria 5935
313 Ga0501071_0015734 3300049587 Bacteria 5195
314 Ga0501071_0018707 3300049587 Bacteria 4802
315 Ga0501071_0054184 3300049587 Bacteria 2894
316 Ga0501071_0068301 3300049587 Bacteria 2586
317 Ga0501071_0115160 3300049587 Bacteria 1989
318 Ga0501072_0000631 3300049588 Bacteria 25231
319 Ga0501072_0001283 3300049588 Bacteria 18788
320 Ga0501072_0003095 3300049588 Bacteria 12541
321 Ga0501072_0016497 3300049588 Bacteria 5674
322 Ga0501072_0030053 3300049588 Bacteria 4247
323 Ga0501072_0034861 3300049588 Bacteria 3943
324 Ga0501072_0043554 3300049588 Bacteria 3527
325 Ga0501072_0134724 3300049588 Bacteria 1969
326 Ga0501073_0003510 3300049589 Bacteria 11776
327 Ga0501073_0086884 3300049589 Bacteria 2175
328 Ga0501073_0252264 3300049589 Bacteria 1218
329 Ga0501074_0007530 3300049590 Bacteria 7876
330 Ga0501074_0009702 3300049590 Bacteria 6992
331 Ga0501074_0090224 3300049590 Bacteria 2195
332 Ga0501074_0122061 3300049590 Bacteria 1863
333 Ga0501074_0230377 3300049590 Bacteria 1319
334 Ga0501074_0258442 3300049590 Bacteria 1238
335 Ga0501075_0000033 3300049591 Bacteria 55705
336 Ga0501075_0000999 3300049591 Bacteria 18056
337 Ga0501075_0001564 3300049591 Bacteria 14940
338 Ga0501075_0002477 3300049591 Bacteria 12313
339 Ga0501075_0121659 3300049591 Bacteria 1986
340 Ga0501076_0000081 3300049592 Bacteria 49598
341 Ga0501076_0001603 3300049592 Bacteria 15225
342 Ga0501076_0004976 3300049592 Bacteria 9516
343 Ga0501076_0017449 3300049592 Bacteria 5456
344 Ga0501076_0098789 3300049592 Bacteria 2352
345 Ga0501076_0105888 3300049592 Bacteria 2270
346 Ga0501076_0158433 3300049592 Bacteria 1843
347 Ga0501076_0182436 3300049592 Bacteria 1711
348 Ga0501077_0002654 3300049593 Bacteria 10722
349 Ga0501077_0009350 3300049593 Bacteria 6087
350 Ga0501077_0032536 3300049593 Bacteria 3320
351 Ga0501077_0037690 3300049593 Bacteria 3078
352 Ga0501077_0046863 3300049593 Bacteria 2746
353 Ga0501077_0074467 3300049593 Bacteria 2150
354 Ga0501079_0000024 3300049741 Bacteria 62474
355 Ga0501079_0000463 3300049741 Bacteria 26686
356 Ga0501079_0001801 3300049741 Bacteria 15312
357 Ga0501079_0013543 3300049741 Bacteria 6221
358 Ga0501079_0014736 3300049741 Bacteria 5958
359 Ga0501079_0018191 3300049741 Bacteria 5368
360 Ga0501079_0020759 3300049741 Bacteria 5023
361 Ga0501079_0026562 3300049741 Bacteria 4438
362 Ga0501079_0029391 3300049741 Bacteria 4219
363 Ga0501080_0017510 3300049742 Bacteria 6626
364 Ga0501080_0030403 3300049742 Bacteria 5032
365 Ga0501080_0041911 3300049742 Bacteria 4264
366 Ga0501080_0070091 3300049742 Bacteria 3260
367 Ga0501080_0274481 3300049742 Bacteria 1534
368 Ga0501081_0003073 3300049743 Bacteria 10595
369 Ga0501081_0015731 3300049743 Bacteria 4993
370 Ga0501081_0027306 3300049743 Bacteria 3850
371 Ga0501081_0030967 3300049743 Bacteria 3625
372 Ga0501081_0041880 3300049743 Bacteria 3137
373 Ga0501081_0101095 3300049743 Bacteria 2038
374 Ga0501083_0015851 3300049744 Bacteria 5275
375 Ga0501083_0026945 3300049744 Bacteria 3969
376 Ga0501083_0093412 3300049744 Bacteria 1986
377 Ga0501035_0000389 3300049822 Bacteria 50594
378 Ga0501035_0028008 3300049822 Bacteria 5146
379 Ga0501035_0057372 3300049822 Bacteria 3472
380 Ga0501035_0234941 3300049822 Bacteria 1561
381 Ga0501035_0370131 3300049822 Bacteria 1196
382 Ga0501044_0001428 3300049823 Bacteria 28051
383 Ga0501044_0021867 3300049823 Bacteria 6819
384 Ga0501044_0113319 3300049823 Bacteria 2719
385 Ga0501045_0000102 3300049824 Bacteria 42092
386 Ga0501045_0005382 3300049824 Bacteria 8871
387 Ga0501045_0007856 3300049824 Bacteria 7424
388 Ga0501045_0009248 3300049824 Bacteria 6892
389 Ga0501045_0011895 3300049824 Bacteria 6116
390 Ga0501045_0022820 3300049824 Bacteria 4483
391 Ga0501045_0027555 3300049824 Bacteria 4095
392 Ga0501045_0249508 3300049824 Bacteria 1321
393 nmdc:mga00v17_98322_c1 3300050491 Bacteria 1845
394 nmdc:mga0yw44_223763_c1 3300050492 Bacteria 1248
395 nmdc:mga0yw44_37341_c1 3300050492 Bacteria 2868
396 nmdc:mga05p37_175470_c1 3300050507 Bacteria 2611
397 nmdc:mga05p37_215118_c1 3300050507 Bacteria 2321
398 nmdc:mga05p37_53486_c1 3300050507 Bacteria 4965
399 nmdc:mga09592_58112_c1 3300050508 Bacteria 3271
400 nmdc:mga08y16_18092_c1 3300050511 Bacteria 7423
401 nmdc:mga08y16_84847_c1 3300050511 Bacteria 3301
402 nmdc:mga0n895_20729_c1 3300050512 Bacteria 6136
403 nmdc:mga0rr50_32182_c1 3300050513 Bacteria 3734
404 Ga0501084_0000210 3300054114 Bacteria 45327
405 Ga0501084_0001180 3300054114 Bacteria 20409
406 Ga0501084_0002565 3300054114 Bacteria 14640
407 Ga0501084_0005484 3300054114 Bacteria 10410
408 Ga0501084_0014979 3300054114 Bacteria 6429
409 Ga0501084_0152072 3300054114 Bacteria 1951
410 Ga0501084_0183101 3300054114 Bacteria 1768
411 Ga0501084_0199268 3300054114 Bacteria 1689
412 Ga0501084_0405245 3300054114 Bacteria 1152
413 Ga0501084_0446529 3300054114 Bacteria 1093
414 Ga0590075_005679 3300059424 Bacteria 2952
415 Ga0501082_0000122 3300060353 Bacteria 62357
416 Ga0501082_0000139 3300060353 Bacteria 59897
417 Ga0501082_0010500 3300060353 Bacteria 7967
418 Ga0501082_0025570 3300060353 Bacteria 5088
419 Ga0501082_0052622 3300060353 Bacteria 3509
420 Ga0501082_0063013 3300060353 Bacteria 3192
421 Ga0501082_0134625 3300060353 Bacteria 2144
422 Ga0501082_0208641 3300060353 Bacteria 1700
423 Ga0466962_0009777 3300061719 Bacteria 4602
424 Ga0466962_0124234 3300061719 Bacteria 1246
425 Ga0530510_0000137 3300061734 Bacteria 42732
426 Ga0530510_0000807 3300061734 Bacteria 20405
427 Ga0530510_0001194 3300061734 Bacteria 17283
428 Ga0530510_0004432 3300061734 Bacteria 9722
429 Ga0530510_0018962 3300061734 Bacteria 4879
430 Ga0530510_0026990 3300061734 Bacteria 4113
431 Ga0530510_0029424 3300061734 Bacteria 3942
432 Ga0530510_0035254 3300061734 Bacteria 3605
433 Ga0530510_0140070 3300061734 Bacteria 1782
434 Ga0157380_10054218
435 Ga0070683_100025663
436 Ga0068869_100060424
437 Ga0068868_100026524
438 Ga0068868_100030722
439 Ga0070692_10002835
440 Ga0070669_100209612
441 Ga0070675_100253495
442 Ga0070671_100103411
443 Ga0070688_100103482
444 Ga0070659_100025446
445 Ga0070659_100076489
446 Ga0070659_100334138
447 Ga0070709_10142552
448 Ga0070709_10201468
449 Ga0070711_100000409
450 Ga0070705_100034325
451 Ga0070700_100034601
452 Ga0070700_100092631
453 Ga0070678_100028542
454 Ga0070681_10046293
455 Ga0070681_10075215
456 Ga0070707_100340569
457 Ga0070679_100117499
458 Ga0070684_100022817
459 Ga0070684_100032001
460 Ga0070684_100074497
461 Ga0070697_100422889
462 Ga0068853_100519015
463 Ga0070665_100001191
464 Ga0068854_100042410
465 Ga0068856_100036997
466 Ga0070702_100250100
467 Ga0068864_100256608
468 Ga0068861_100049925
469 Ga0068870_10056548
470 Ga0068860_100448427
471 Ga0081455_10008854
472 Ga0081455_10009192
473 Ga0081455_10015388
474 Ga0081455_10040418
475 Ga0081538_10000078
476 Ga0081538_10001073
477 Ga0081538_10001255
478 Ga0081538_10003942
479 Ga0081538_10005380
480 Ga0081538_10008721
481 Ga0081538_10019530
482 Ga0081538_10022244
483 Ga0070717_10003116
484 Ga0075365_10097068
485 Ga0075365_10183262
486 Ga0075364_10133009
487 Ga0075432_10006037
488 Ga0070716_100145130
489 Ga0070712_100291927
490 Ga0075428_100003867
491 Ga0075433_10047910
492 Ga0075434_100001635
493 Ga0075429_100036012
494 Ga0068865_100036882
495 Ga0075435_100001692
496 Ga0105240_10140960
497 Ga0111539_10004498
498 Ga0111539_10008496
499 Ga0105245_10007358
500 Ga0105245_10021684
501 Ga0105245_10021783
502 Ga0105247_10017536
503 Ga0114129_10024462
504 Ga0114129_10033599
505 Ga0114129_10079097
506 Ga0105243_10004978
507 Ga0105243_10073267
508 Ga0105243_10080612
509 Ga0105243_10098129
510 Ga0105241_10065813
511 Ga0105242_10215309
512 Ga0105242_10432890
513 Ga0105248_10102075
514 Ga0105238_10119516
515 Ga0105249_10075774
516 Ga0105249_10236212
517 Ga0105239_10028276
518 Ga0105239_10073733
519 Ga0157370_10052268
520 Ga0157369_10001705
521 Ga0157369_10008801
522 Ga0157374_10017917
523 Ga0157372_10053921
524 Ga0157372_10113840
525 Ga0157372_10575290
526 Ga0163163_10056637
527 Ga0157377_10027104
528 Ga0157377_10087507
529 Ga0157379_10051208
530 Ga0213876_10042997
531 Ga0213875_10100145
532 Ga0213871_10012370
533 Ga0207710_10050817
534 Ga0207688_10020674
535 Ga0207699_10346374
536 Ga0207695_10118758
537 Ga0207693_10053640
538 Ga0207693_10075679
539 Ga0207693_10183213
540 Ga0207693_10207816
541 Ga0207693_10312747
542 Ga0207663_10315299
543 Ga0207663_10482841
544 Ga0207657_10022597
545 Ga0207657_10043977
546 Ga0207652_10149818
547 Ga0207694_10032892
548 Ga0207687_10002364
549 Ga0207687_10008197
550 Ga0207687_10057249
551 Ga0207700_10201377
552 Ga0207664_10164099
553 Ga0207664_10346144
554 Ga0207644_10101651
555 Ga0207644_10112142
556 Ga0207690_10003774
557 Ga0207690_10284990
558 Ga0207690_10335981
559 Ga0207706_10021000
560 Ga0207686_10080411
561 Ga0207704_10015786
562 Ga0207665_10159407
563 Ga0207711_10061920
564 Ga0207689_10075094
565 Ga0207689_10235292
566 Ga0207667_10016092
567 Ga0207677_10145733
568 Ga0207702_10003948
569 Ga0207648_10146923
570 Ga0207675_100115407
571 Ga0207683_10047491
572 Ga0207428_10000104
573 Ga0268266_10063286
574 Ga0268266_10405346
575 Ga0268265_10306250
576 Ga0265319_1000813
577 Ga0265318_10001748
578 Ga0265322_10002810
579 Ga0265338_10001704
580 Ga0265338_10002825
581 Ga0265338_10005197
582 Ga0265338_10012308
583 Ga0265329_10060036
584 Ga0265340_10028402
585 Ga0265331_10034416
586 Ga0265327_10016154
587 Ga0265316_10014252
588 Ga0265313_10037308
589 Ga0265314_10003426
590 Ga0307405_10178264
591 Ga0307412_10045532
592 Ga0307416_100217387
593 Ga0307414_10029067
594 Ga0307411_10165236
595 Ga0373951_0024612
596 Ga0373960_0081377
597 Ga0373933_0096864
598 Ga0373947_0046344
599 Ga0395899_0013856
600 Ga0395900_0030685
601 Ga0395900_0034605
602 Ga0395900_0067660
603 Ga0395898_0046235
604 Ga0395898_0327189
605 Ga0395905_0017747
606 Ga0395905_0051099
607 Ga0436364_0189902
608 Ga0395901_0007019
609 Ga0395901_0019092
610 Ga0436365_0112446
611 Ga0436360_0439670
612 Ga0436363_0451320
613 Ga0466969_0010572
614 Ga0466969_0042632
615 Ga0466966_0144390
616 Ga0466961_0016024
617 Ga0466961_0114560
618 Ga0466963_0006842
619 Ga0466971_0019003
620 Ga0466971_0145000
621 Ga0466968_0009404
622 Ga0466968_0089852
623 Ga0466959_0019809
624 Ga0466959_0165079
625 Ga0466958_0002220
626 Ga0466967_0005848
627 Ga0466967_0084912
628 Ga0466967_0511649
629 Ga0495584_0043853
630 Ga0495667_0126917
631 Ga0495684_0103829
632 Ga0495593_0128753
633 Ga0495602_0294741
634 Ga0496100_0009016
635 Ga0496101_0016788
636 Ga0496101_0027430
637 Ga0496102_0012956
638 Ga0496102_0022769
639 Ga0496102_0280474
640 Ga0496103_0050930
641 Ga0496104_0248961
642 Ga0496105_0050552
643 Ga0496106_0009750
644 Ga0496107_0111976
645 Ga0496108_0085300
646 Ga0496108_0121054
647 Ga0496108_0140383
648 Ga0496109_0014256
649 Ga0496109_0035130
650 Ga0496109_0059552
651 Ga0496110_0001058
652 Ga0496110_0245376
653 Ga0496110_0372260
654 Ga0496111_0093231
655 Ga0496111_0162568
656 Ga0496111_0169299
657 Ga0496112_0136015
658 Ga0496113_0005217
659 Ga0496113_0162188
660 Ga0501309_006822
661 Ga0501321_003248
662 Ga0501031_0000242
663 Ga0501031_0020548
664 Ga0501031_0020832
665 Ga0501031_0063613
666 Ga0501031_0063661
667 Ga0501031_0172417
668 Ga0501032_0010084
669 Ga0501032_0034161
670 Ga0501032_0061729
671 Ga0501032_0079475
672 Ga0501033_0000237
673 Ga0501033_0008656
674 Ga0501033_0013009
675 Ga0501033_0146814
676 Ga0501033_0395640
677 Ga0501036_0000224
678 Ga0501036_0005035
679 Ga0501036_0014340
680 Ga0501036_0057916
681 Ga0501036_0147404
682 Ga0501036_0444320
683 Ga0501037_0000351
684 Ga0501037_0081957
685 Ga0501038_0000592
686 Ga0501038_0004290
687 Ga0501038_0015535
688 Ga0501038_0378989
689 Ga0501039_0000483
690 Ga0501039_0002847
691 Ga0501039_0005720
692 Ga0501039_0010905
693 Ga0501039_0203351
694 Ga0501039_0480211
695 Ga0501040_0001103
696 Ga0501040_0005138
697 Ga0501040_0048650
698 Ga0501040_0082551
699 Ga0501040_0132901
700 Ga0501040_0172318
701 Ga0501041_0000070
702 Ga0501041_0001320
703 Ga0501041_0002070
704 Ga0501041_0007365
705 Ga0501041_0023936
706 Ga0501041_0027535
707 Ga0501041_0028567
708 Ga0501041_0127524
709 Ga0501042_0000294
710 Ga0501042_0003701
711 Ga0501042_0004428
712 Ga0501042_0017552
713 Ga0501042_0039484
714 Ga0501042_0045401
715 Ga0501043_0000329
716 Ga0501043_0004696
717 Ga0501043_0054159
718 Ga0501043_0162592
719 Ga0501043_0243180
720 Ga0501046_0001690
721 Ga0501046_0006202
722 Ga0501046_0016127
723 Ga0501046_0145219
724 Ga0501047_0000451
725 Ga0501047_0016601
726 Ga0501048_0000243
727 Ga0501048_0002615
728 Ga0501048_0008142
729 Ga0501048_0055383
730 Ga0501048_0065065
731 Ga0501048_0065513
732 Ga0501067_0255870
733 Ga0501068_0006574
734 Ga0501068_0011786
735 Ga0501068_0028932
736 Ga0501069_0000401
737 Ga0501069_0010577
738 Ga0501069_0021000
739 Ga0501069_0029491
740 Ga0501070_0000237
741 Ga0501070_0026562
742 Ga0501070_0093796
743 Ga0501070_0278591
744 Ga0501071_0000176
745 Ga0501071_0011648
746 Ga0501071_0015734
747 Ga0501071_0018707
748 Ga0501071_0054184
749 Ga0501071_0068301
750 Ga0501071_0115160
751 Ga0501072_0000631
752 Ga0501072_0001283
753 Ga0501072_0003095
754 Ga0501072_0016497
755 Ga0501072_0030053
756 Ga0501072_0034861
757 Ga0501072_0043554
758 Ga0501072_0134724
759 Ga0501073_0003510
760 Ga0501073_0086884
761 Ga0501073_0252264
762 Ga0501074_0007530
763 Ga0501074_0009702
764 Ga0501074_0090224
765 Ga0501074_0122061
766 Ga0501074_0230377
767 Ga0501074_0258442
768 Ga0501075_0000033
769 Ga0501075_0000999
770 Ga0501075_0001564
771 Ga0501075_0002477
772 Ga0501075_0121659
773 Ga0501076_0000081
774 Ga0501076_0001603
775 Ga0501076_0004976
776 Ga0501076_0017449
777 Ga0501076_0098789
778 Ga0501076_0105888
779 Ga0501076_0158433
780 Ga0501076_0182436
781 Ga0501077_0002654
782 Ga0501077_0009350
783 Ga0501077_0032536
784 Ga0501077_0037690
785 Ga0501077_0046863
786 Ga0501077_0074467
787 Ga0501079_0000024
788 Ga0501079_0000463
789 Ga0501079_0001801
790 Ga0501079_0013543
791 Ga0501079_0014736
792 Ga0501079_0018191
793 Ga0501079_0020759
794 Ga0501079_0026562
795 Ga0501079_0029391
796 Ga0501080_0017510
797 Ga0501080_0030403
798 Ga0501080_0041911
799 Ga0501080_0070091
800 Ga0501080_0274481
801 Ga0501081_0003073
802 Ga0501081_0015731
803 Ga0501081_0027306
804 Ga0501081_0030967
805 Ga0501081_0041880
806 Ga0501081_0101095
807 Ga0501083_0015851
808 Ga0501083_0026945
809 Ga0501083_0093412
810 Ga0501035_0000389
811 Ga0501035_0028008
812 Ga0501035_0057372
813 Ga0501035_0234941
814 Ga0501035_0370131
815 Ga0501044_0001428
816 Ga0501044_0021867
817 Ga0501044_0113319
818 Ga0501045_0000102
819 Ga0501045_0005382
820 Ga0501045_0007856
821 Ga0501045_0009248
822 Ga0501045_0011895
823 Ga0501045_0022820
824 Ga0501045_0027555
825 Ga0501045_0249508
826 nmdc:mga00v17_98322_c1
827 nmdc:mga0yw44_223763_c1
828 nmdc:mga0yw44_37341_c1
829 nmdc:mga05p37_175470_c1
830 nmdc:mga05p37_215118_c1
831 nmdc:mga05p37_53486_c1
832 nmdc:mga09592_58112_c1
833 nmdc:mga08y16_18092_c1
834 nmdc:mga08y16_84847_c1
835 nmdc:mga0n895_20729_c1
836 nmdc:mga0rr50_32182_c1
837 Ga0501084_0000210
838 Ga0501084_0001180
839 Ga0501084_0002565
840 Ga0501084_0005484
841 Ga0501084_0014979
842 Ga0501084_0152072
843 Ga0501084_0183101
844 Ga0501084_0199268
845 Ga0501084_0405245
846 Ga0501084_0446529
847 Ga0590075_005679
848 Ga0501082_0000122
849 Ga0501082_0000139
850 Ga0501082_0010500
851 Ga0501082_0025570
852 Ga0501082_0052622
853 Ga0501082_0063013
854 Ga0501082_0134625
855 Ga0501082_0208641
856 Ga0466962_0009777
857 Ga0466962_0124234
858 Ga0530510_0000137
859 Ga0530510_0000807
860 Ga0530510_0001194
861 Ga0530510_0004432
862 Ga0530510_0018962
863 Ga0530510_0026990
864 Ga0530510_0029424
865 Ga0530510_0035254
866 Ga0530510_0140070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

168

279

0.88

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

143

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.9297 2 300
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.9089 1 301
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.8979 2 300
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.8837 1 301
4huz-assembly1.cif.gz_A-2 2,6-dichloro-p-hydroquinone 1,2-dioxygenase 0.8465 2 294
ID Description Score Start End Superfamily
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9549 1 300 3.10.180.10
1zswA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9295 1 301 3.10.180.10
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9214 1 300 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9166 30 298 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.882 30 298 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A5C9AWT2-F1-model_v4 deleted 0.9952 1 66
AF-A0A536JGZ0-F1-model_v4 Ring-cleaving dioxygenase 0.9932 2 257 GO:0051213
AF-M0GJD4-F1-model_v4 Dioxygenase 0.9931 5 64 GO:0051213
AF-A0A7W0KDW4-F1-model_v4 VOC family protein 0.9925 1 65
AF-A0A535DKE5-F1-model_v4 Ring-cleaving dioxygenase 0.992 1 185 GO:0051213

Map