F442805

General Info

Members Datasets Scaffolds Average Seq Length
433 255 433 165

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10010671|Ga0081538_100106715
Length 155
Sequence VEGSLRTGYLGLGSNVGDREANLRDARAALGRAGIEVLASSSLYETAPQGELLDQPDFLNACLRIRTARELGRRPGGVRHGPRPIDVDLLLLGDLEYSSERLTLPHPEVRSRRFVVEPLLELDPELALPDGTRLADLVEPLREQRVTRIPPSGGF

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 3.7
Rhizosphere 94.69
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000941 3300003373 Bacteria 6273
2 JGI25407J50210_10030414 3300003373 Bacteria 1399
3 Ga0070683_100089868 3300005329 Bacteria 2883
4 Ga0070683_100617376 3300005329 Bacteria 1038
5 Ga0070670_100579536 3300005331 Unclassified 1003
6 Ga0070680_100011130 3300005336 Bacteria 6955
7 Ga0068868_101363106 3300005338 Bacteria 660
8 Ga0070660_100037812 3300005339 Bacteria 3660
9 Ga0070660_100303647 3300005339 Unclassified 1309
10 Ga0070691_10012024 3300005341 Bacteria 3963
11 Ga0070687_100192967 3300005343 Bacteria 1229
12 Ga0070661_100103727 3300005344 Bacteria 2118
13 Ga0070692_10030646 3300005345 Bacteria 2691
14 Ga0070692_10558980 3300005345 Bacteria 751
15 Ga0070668_100060863 3300005347 Bacteria 2925
16 Ga0070668_101172471 3300005347 Bacteria 695
17 Ga0070669_100998900 3300005353 Bacteria 718
18 Ga0070675_101096033 3300005354 Bacteria 732
19 Ga0070709_10087252 3300005434 Bacteria 2050
20 Ga0070714_100121768 3300005435 Bacteria 2321
21 Ga0070713_100152739 3300005436 Bacteria 2055
22 Ga0070710_10022339 3300005437 Bacteria 3307
23 Ga0070711_100005750 3300005439 Bacteria 7439
24 Ga0070711_101150003 3300005439 Bacteria 670
25 Ga0070662_100046496 3300005457 Bacteria 3119
26 Ga0070662_100089294 3300005457 Bacteria 2311
27 Ga0068867_100904102 3300005459 Bacteria 795
28 Ga0070685_10191441 3300005466 Bacteria 1323
29 Ga0070679_100020197 3300005530 Bacteria 6493
30 Ga0070679_100839125 3300005530 Bacteria 862
31 Ga0070684_100001851 3300005535 Bacteria 15491
32 Ga0070672_101105342 3300005543 Unclassified 704
33 Ga0070686_100028722 3300005544 Bacteria 3375
34 Ga0070695_100049565 3300005545 Bacteria 2689
35 Ga0070695_100114483 3300005545 Bacteria 1836
36 Ga0070695_100774353 3300005545 Unclassified 767
37 Ga0070693_100862078 3300005547 Bacteria 676
38 Ga0068855_100384634 3300005563 Bacteria 1540
39 Ga0070664_100114093 3300005564 Unclassified 2360
40 Ga0070664_100136213 3300005564 Bacteria 2159
41 Ga0070664_100580922 3300005564 Bacteria 1038
42 Ga0068857_100093698 3300005577 Bacteria 2689
43 Ga0068854_100408950 3300005578 Bacteria 1124
44 Ga0068854_101062196 3300005578 Bacteria 720
45 Ga0068856_100066185 3300005614 Bacteria 3571
46 Ga0068852_100021413 3300005616 Bacteria 5162
47 Ga0068866_10658481 3300005718 Unclassified 714
48 Ga0068861_100050363 3300005719 Bacteria 3158
49 Ga0081455_10019583 3300005937 Bacteria 6397
50 Ga0081455_10032836 3300005937 Bacteria 4671
51 Ga0081538_10000835 3300005981 Bacteria 33369
52 Ga0081538_10002778 3300005981 Bacteria 16774
53 Ga0081538_10003555 3300005981 Bacteria 14663
54 Ga0081538_10009306 3300005981 Bacteria 8219
55 Ga0081538_10010671 3300005981 Bacteria 7518
56 Ga0081538_10054892 3300005981 Bacteria 2350
57 Ga0081538_10081409 3300005981 Bacteria 1722
58 Ga0081538_10086310 3300005981 Bacteria 1644
59 Ga0081538_10094281 3300005981 Bacteria 1533
60 Ga0070717_10059827 3300006028 Bacteria 3153
61 Ga0070717_10134488 3300006028 Bacteria 2128
62 Ga0070715_10118931 3300006163 Bacteria 1257
63 Ga0070712_100005377 3300006175 Bacteria 7930
64 Ga0097621_100256985 3300006237 Bacteria 1531
65 Ga0075428_100007055 3300006844 Bacteria 12450
66 Ga0075428_100096519 3300006844 Bacteria 3222
67 Ga0075428_100113536 3300006844 Bacteria 2951
68 Ga0075428_100187367 3300006844 Bacteria 2239
69 Ga0075428_100229209 3300006844 Bacteria 2004
70 Ga0075430_100022193 3300006846 Bacteria 5397
71 Ga0075430_100035941 3300006846 Bacteria 4201
72 Ga0075430_100127364 3300006846 Bacteria 2123
73 Ga0075431_100020434 3300006847 Bacteria 6765
74 Ga0075431_100079537 3300006847 Bacteria 3384
75 Ga0075429_100022138 3300006880 Bacteria 5513
76 Ga0075429_100213460 3300006880 Bacteria 1690
77 Ga0075429_100593178 3300006880 Bacteria 971
78 Ga0105240_10034701 3300009093 Bacteria 6504
79 Ga0111539_10061245 3300009094 Bacteria 4459
80 Ga0111539_10082291 3300009094 Bacteria 3786
81 Ga0111539_10143591 3300009094 Bacteria 2794
82 Ga0111539_10531958 3300009094 Bacteria 1369
83 Ga0111539_11305823 3300009094 Bacteria 842
84 Ga0105245_10055301 3300009098 Bacteria 3565
85 Ga0105245_10058045 3300009098 Bacteria 3483
86 Ga0114129_10003533 3300009147 Bacteria 21989
87 Ga0114129_10132488 3300009147 Bacteria 3422
88 Ga0114129_10273189 3300009147 Bacteria 2261
89 Ga0114129_11130495 3300009147 Bacteria 979
90 Ga0114129_11265603 3300009147 Bacteria 916
91 Ga0114129_11291641 3300009147 Bacteria 905
92 Ga0114129_11614484 3300009147 Bacteria 794
93 Ga0105243_10076527 3300009148 Bacteria 2719
94 Ga0105243_10114572 3300009148 Bacteria 2262
95 Ga0105243_10222075 3300009148 Bacteria 1671
96 Ga0105243_10990866 3300009148 Bacteria 842
97 Ga0105242_10427946 3300009176 Bacteria 1242
98 Ga0105242_10678342 3300009176 Bacteria 1005
99 Ga0105248_10310442 3300009177 Bacteria 1776
100 Ga0105237_10077213 3300009545 Bacteria 3321
101 Ga0105237_10644283 3300009545 Bacteria 1066
102 Ga0105238_10043360 3300009551 Bacteria 4552
103 Ga0105249_10004101 3300009553 Bacteria 12579
104 Ga0105239_10290219 3300010375 Bacteria 1842
105 Ga0105246_10224562 3300011119 Bacteria 1474
106 Ga0157371_10115726 3300013102 Bacteria 1904
107 Ga0157371_10469116 3300013102 Bacteria 927
108 Ga0157370_10025457 3300013104 Bacteria 5857
109 Ga0157369_10016156 3300013105 Bacteria 8403
110 Ga0157378_10598228 3300013297 Unclassified 1114
111 Ga0163162_10221681 3300013306 Bacteria 2021
112 Ga0163162_11168770 3300013306 Bacteria 873
113 Ga0157372_10042061 3300013307 Bacteria 5052
114 Ga0157372_10719419 3300013307 Bacteria 1161
115 Ga0157375_10425563 3300013308 Bacteria 1494
116 Ga0157380_10708716 3300014326 Unclassified 1012
117 Ga0157377_10218368 3300014745 Bacteria 1219
118 Ga0157379_10117832 3300014968 Bacteria 2389
119 Ga0206353_11748275 3300020082 Bacteria 3944
120 Ga0213876_10093772 3300021384 Bacteria 1590
121 Ga0213875_10011386 3300021388 Bacteria 4424
122 Ga0207656_10337658 3300025321 Bacteria 750
123 Ga0207692_10013632 3300025898 Bacteria 3531
124 Ga0207688_10052275 3300025901 Bacteria 2289
125 Ga0207688_10339710 3300025901 Bacteria 924
126 Ga0207699_10945692 3300025906 Unclassified 636
127 Ga0207705_10654410 3300025909 Bacteria 817
128 Ga0207707_10076266 3300025912 Bacteria 2925
129 Ga0207671_10042415 3300025914 Bacteria 3367
130 Ga0207693_10003642 3300025915 Bacteria 13159
131 Ga0207693_10733454 3300025915 Bacteria 764
132 Ga0207663_10010187 3300025916 Bacteria 4992
133 Ga0207662_10397100 3300025918 Bacteria 934
134 Ga0207657_10027895 3300025919 Bacteria 5162
135 Ga0207657_10175916 3300025919 Bacteria 1732
136 Ga0207649_10138398 3300025920 Bacteria 1662
137 Ga0207652_10058845 3300025921 Bacteria 3311
138 Ga0207652_10487884 3300025921 Bacteria 1110
139 Ga0207652_10601953 3300025921 Bacteria 986
140 Ga0207681_10793822 3300025923 Bacteria 791
141 Ga0207650_11253286 3300025925 Unclassified 631
142 Ga0207687_10100359 3300025927 Bacteria 2129
143 Ga0207687_10502785 3300025927 Bacteria 1012
144 Ga0207700_10053790 3300025928 Bacteria 3018
145 Ga0207664_10003530 3300025929 Bacteria 10444
146 Ga0207664_10170619 3300025929 Bacteria 1862
147 Ga0207690_10038870 3300025932 Bacteria 3100
148 Ga0207706_10088376 3300025933 Bacteria 2724
149 Ga0207706_10241010 3300025933 Bacteria 1581
150 Ga0207686_10345204 3300025934 Bacteria 1119
151 Ga0207686_10624759 3300025934 Bacteria 850
152 Ga0207709_10155682 3300025935 Unclassified 1588
153 Ga0207709_10218303 3300025935 Bacteria 1373
154 Ga0207669_10269450 3300025937 Bacteria 1278
155 Ga0207691_11016232 3300025940 Bacteria 692
156 Ga0207661_10002565 3300025944 Bacteria 12505
157 Ga0207661_10664574 3300025944 Bacteria 958
158 Ga0207679_10079281 3300025945 Bacteria 2504
159 Ga0207712_10818184 3300025961 Bacteria 819
160 Ga0207668_10174164 3300025972 Bacteria 1690
161 Ga0207640_10047464 3300025981 Bacteria 2770
162 Ga0207640_10634040 3300025981 Unclassified 909
163 Ga0207703_10605679 3300026035 Unclassified 1036
164 Ga0207639_10034935 3300026041 Bacteria 3718
165 Ga0207708_10176852 3300026075 Bacteria 1693
166 Ga0207702_10035724 3300026078 Bacteria 4154
167 Ga0207648_10110251 3300026089 Bacteria 2416
168 Ga0207648_10110671 3300026089 Bacteria 2411
169 Ga0207648_10404086 3300026089 Bacteria 1238
170 Ga0207674_10060700 3300026116 Bacteria 3823
171 Ga0207674_10100566 3300026116 Bacteria 2873
172 Ga0207675_100067604 3300026118 Bacteria 3340
173 Ga0207683_10248840 3300026121 Bacteria 1622
174 Ga0207698_10038713 3300026142 Bacteria 3526
175 Ga0207428_10105530 3300027907 Bacteria 2173
176 Ga0265337_1000549 3300028556 Bacteria 19864
177 Ga0265326_10000010 3300028558 Bacteria 184218
178 Ga0265326_10000402 3300028558 Bacteria 17362
179 Ga0265319_1000612 3300028563 Bacteria 23646
180 Ga0265319_1001868 3300028563 Bacteria 11989
181 Ga0265334_10000003 3300028573 Bacteria 244354
182 Ga0265318_10001528 3300028577 Bacteria 13457
183 Ga0265322_10041716 3300028654 Unclassified 1306
184 Ga0265336_10000001 3300028666 Bacteria 916179
185 Ga0265338_10000046 3300028800 Bacteria 223068
186 Ga0265338_10088131 3300028800 Bacteria 2576
187 Ga0265338_10192184 3300028800 Bacteria 1546
188 Ga0265338_10201340 3300028800 Bacteria 1501
189 Ga0265324_10001580 3300029957 Bacteria 12674
190 Ga0265324_10002114 3300029957 Bacteria 10473
191 Ga0265330_10184101 3300031235 Archaea 884
192 Ga0265320_10072959 3300031240 Bacteria 1614
193 Ga0265320_10108123 3300031240 Unclassified 1276
194 Ga0265340_10000005 3300031247 Bacteria 204570
195 Ga0265327_10302359 3300031251 Bacteria 704
196 Ga0265316_10033353 3300031344 Bacteria 4194
197 Ga0307408_100023336 3300031548 Bacteria 4213
198 Ga0307408_100132062 3300031548 Bacteria 1949
199 Ga0307405_10012633 3300031731 Bacteria 4481
200 Ga0307413_10019825 3300031824 Bacteria 3563
201 Ga0307413_10495887 3300031824 Bacteria 979
202 Ga0307410_10001724 3300031852 Bacteria 10098
203 Ga0307410_10059955 3300031852 Bacteria 2599
204 Ga0307410_10153476 3300031852 Bacteria 1717
205 Ga0307410_10983858 3300031852 Bacteria 727
206 Ga0307406_10021241 3300031901 Bacteria 3837
207 Ga0307406_10589489 3300031901 Unclassified 915
208 Ga0307406_11185691 3300031901 Bacteria 662
209 Ga0307407_10000822 3300031903 Bacteria 10300
210 Ga0307407_10186529 3300031903 Bacteria 1379
211 Ga0307407_10605943 3300031903 Bacteria 816
212 Ga0307412_10113042 3300031911 Bacteria 1942
213 Ga0307412_10130777 3300031911 Bacteria 1823
214 Ga0307409_100000585 3300031995 Bacteria 15904
215 Ga0307409_100004644 3300031995 Bacteria 7759
216 Ga0307409_100006209 3300031995 Bacteria 6993
217 Ga0307409_100097747 3300031995 Bacteria 2426
218 Ga0307409_100423893 3300031995 Bacteria 1277
219 Ga0307416_100004948 3300032002 Bacteria 8118
220 Ga0307416_100031416 3300032002 Bacteria 3997
221 Ga0307416_100049386 3300032002 Bacteria 3345
222 Ga0307416_100311006 3300032002 Bacteria 1572
223 Ga0307416_100473006 3300032002 Bacteria 1311
224 Ga0307416_100503829 3300032002 Bacteria 1276
225 Ga0307416_101191478 3300032002 Bacteria 867
226 Ga0307416_101335139 3300032002 Bacteria 823
227 Ga0307414_10840086 3300032004 Bacteria 839
228 Ga0307414_10931254 3300032004 Bacteria 798
229 Ga0307411_10156924 3300032005 Bacteria 1699
230 Ga0307415_100002060 3300032126 Bacteria 9933
231 Ga0307415_100048355 3300032126 Bacteria 2870
232 Ga0307415_100311111 3300032126 Bacteria 1309
233 Ga0307415_100391883 3300032126 Bacteria 1183
234 Ga0307415_101833837 3300032126 Bacteria 587
235 Ga0373941_0152134 3300035115 Unclassified 850
236 Ga0373953_0045066 3300035117 Bacteria 1766
237 Ga0373962_0233692 3300035242 Bacteria 633
238 Ga0373924_0036879 3300035410 Bacteria 1988
239 Ga0373933_0129587 3300035724 Bacteria 1585
240 Ga0373937_1199444 3300036401 Bacteria 707
241 Ga0395898_0085468 3300037466 Bacteria 3041
242 Ga0436364_0375363 3300037853 Bacteria 6426
243 Ga0395901_1184083 3300038443 Bacteria 731
244 Ga0436365_0125666 3300039437 Bacteria 2692
245 Ga0436365_1518618 3300039437 Bacteria 7665
246 Ga0436363_0219803 3300039450 Bacteria 885
247 Ga0439448_0046540 3300042005 Bacteria 1414
248 Ga0439450_123136 3300042008 Bacteria 669
249 Ga0439460_0089675 3300042461 Bacteria 976
250 Ga0466958_0140718 3300045836 Bacteria 1519
251 Ga0466967_0818547 3300045976 Bacteria 925
252 Ga0495617_117308 3300046452 Bacteria 859
253 Ga0495592_0263568 3300046454 Bacteria 1134
254 Ga0495641_0005510 3300046461 Bacteria 8514
255 Ga0495641_0089012 3300046461 Unclassified 1380
256 Ga0495653_0037415 3300046463 Bacteria 3813
257 Ga0495639_0194537 3300046475 Bacteria 991
258 Ga0495664_0001128 3300046477 Bacteria 13844
259 Ga0495664_0371613 3300046477 Bacteria 860
260 Ga0495584_0186962 3300046491 Bacteria 1052
261 Ga0495584_0225788 3300046491 Unclassified 952
262 Ga0495596_0023885 3300046500 Bacteria 2479
263 Ga0495596_0166711 3300046500 Bacteria 856
264 Ga0495608_0213754 3300046511 Bacteria 1211
265 Ga0495610_0132335 3300046512 Bacteria 1082
266 Ga0495616_0152566 3300046513 Bacteria 1044
267 Ga0495618_0081743 3300046514 Bacteria 2063
268 Ga0495620_0031398 3300046515 Bacteria 2434
269 Ga0495628_0035878 3300046516 Bacteria 3983
270 Ga0495630_0137470 3300046517 Bacteria 1857
271 Ga0495630_0139065 3300046517 Bacteria 1846
272 Ga0495631_0030357 3300046518 Bacteria 2453
273 Ga0495631_0033057 3300046518 Bacteria 2326
274 Ga0495632_0284462 3300046519 Bacteria 736
275 Ga0495637_0049907 3300046520 Bacteria 1756
276 Ga0495643_0346026 3300046522 Bacteria 667
277 Ga0495643_0352357 3300046522 Unclassified 659
278 Ga0495644_0021176 3300046523 Bacteria 2480
279 Ga0495644_0229143 3300046523 Bacteria 719
280 Ga0495642_0033139 3300046528 Bacteria 2076
281 Ga0495652_0023490 3300046529 Bacteria 5466
282 Ga0495665_0062632 3300046531 Bacteria 1964
283 Ga0495640_0019406 3300046533 Bacteria 5018
284 Ga0495640_0281324 3300046533 Unclassified 1036
285 Ga0495586_0322557 3300046535 Unclassified 886
286 Ga0495587_0213844 3300046536 Bacteria 1088
287 Ga0495598_0069847 3300046537 Bacteria 1103
288 Ga0495609_0428928 3300046538 Unclassified 527
289 Ga0495667_0011091 3300046559 Bacteria 6094
290 Ga0495667_0416250 3300046559 Bacteria 846
291 Ga0495656_0017871 3300046615 Bacteria 2713
292 Ga0495634_0010743 3300046642 Bacteria 6698
293 Ga0495611_0108480 3300046648 Bacteria 1291
294 Ga0495635_0148552 3300046663 Bacteria 1595
295 Ga0495635_0268685 3300046663 Bacteria 1147
296 Ga0495657_0006119 3300046675 Bacteria 9430
297 Ga0495657_0023569 3300046675 Bacteria 4396
298 Ga0495623_0090871 3300046679 Bacteria 1874
299 Ga0495646_0008838 3300046680 Bacteria 6397
300 Ga0495658_0077000 3300046683 Unclassified 1950
301 Ga0495669_0178745 3300046684 Bacteria 1011
302 Ga0495649_0534038 3300046694 Bacteria 582
303 Ga0495600_0011715 3300046809 Bacteria 5472
304 Ga0495604_0078802 3300047317 Bacteria 2472
305 Ga0495604_0388751 3300047317 Unclassified 920
306 Ga0495674_0059792 3300047319 Bacteria 3327
307 Ga0495676_0546700 3300047321 Unclassified 757
308 Ga0495680_0026654 3300047322 Bacteria 4760
309 Ga0495683_0100868 3300047323 Bacteria 1388
310 Ga0495677_0112668 3300047445 Bacteria 1035
311 Ga0495679_080974 3300047446 Bacteria 922
312 Ga0495684_0004048 3300047471 Bacteria 11435
313 Ga0495686_0000003 3300047472 Bacteria 899502
314 Ga0495686_0024479 3300047472 Bacteria 3966
315 Ga0495686_0044207 3300047472 Bacteria 2820
316 Ga0495686_0081338 3300047472 Unclassified 1978
317 Ga0495602_0031393 3300048088 Bacteria 5023
318 Ga0495626_0076080 3300048091 Unclassified 1499
319 Ga0496100_0001724 3300048903 Bacteria 10891
320 Ga0496100_0737961 3300048903 Bacteria 770
321 Ga0496101_0023260 3300048904 Bacteria 4279
322 Ga0496102_0710189 3300048905 Bacteria 928
323 Ga0496104_0016349 3300048907 Bacteria 6739
324 Ga0496104_0064902 3300048907 Bacteria 3464
325 Ga0496105_0151149 3300048908 Bacteria 1908
326 Ga0496106_0331410 3300048909 Bacteria 1222
327 Ga0496109_0020981 3300048912 Bacteria 5775
328 Ga0496109_0203195 3300048912 Bacteria 1863
329 Ga0496110_0640850 3300048913 Bacteria 962
330 Ga0496111_0410463 3300048914 Bacteria 1000
331 Ga0496111_0594322 3300048914 Bacteria 810
332 Ga0496113_0205848 3300048916 Bacteria 1565
333 Ga0496113_0414205 3300048916 Unclassified 1082
334 Ga0496114_0152358 3300048917 Bacteria 2006
335 Ga0495682_0220074 3300049460 Bacteria 673
336 Ga0501291_069773 3300049514 Bacteria 679
337 Ga0501031_0094299 3300049568 Unclassified 1953
338 Ga0501031_0155824 3300049568 Unclassified 1493
339 Ga0501031_0453362 3300049568 Bacteria 828
340 Ga0501032_0113780 3300049569 Bacteria 1790
341 Ga0501033_0143655 3300049570 Bacteria 1725
342 Ga0501036_0476468 3300049572 Bacteria 1039
343 Ga0501038_0457870 3300049574 Bacteria 980
344 Ga0501039_0072201 3300049575 Bacteria 2682
345 Ga0501039_0095965 3300049575 Bacteria 2312
346 Ga0501040_0026402 3300049576 Bacteria 3906
347 Ga0501040_0067426 3300049576 Bacteria 2466
348 Ga0501041_0079495 3300049577 Bacteria 2018
349 Ga0501041_0163813 3300049577 Bacteria 1391
350 Ga0501041_0171385 3300049577 Bacteria 1358
351 Ga0501042_0025353 3300049578 Bacteria 4164
352 Ga0501042_0060935 3300049578 Bacteria 2696
353 Ga0501042_0185333 3300049578 Bacteria 1501
354 Ga0501042_0200545 3300049578 Bacteria 1439
355 Ga0501042_0665192 3300049578 Unclassified 757
356 Ga0501043_0314480 3300049579 Unclassified 1195
357 Ga0501043_0930708 3300049579 Bacteria 622
358 Ga0501048_0024884 3300049582 Bacteria 4367
359 Ga0501048_0093709 3300049582 Bacteria 2118
360 Ga0501068_0128815 3300049584 Bacteria 1582
361 Ga0501071_0007074 3300049587 Bacteria 7332
362 Ga0501071_0201263 3300049587 Bacteria 1496
363 Ga0501071_0245190 3300049587 Bacteria 1351
364 Ga0501072_0009138 3300049588 Bacteria 7526
365 Ga0501072_0044201 3300049588 Bacteria 3503
366 Ga0501072_0078276 3300049588 Bacteria 2618
367 Ga0501072_0554509 3300049588 Bacteria 907
368 Ga0501072_0690083 3300049588 Bacteria 803
369 Ga0501074_0102814 3300049590 Bacteria 2045
370 Ga0501075_0005035 3300049591 Bacteria 9023
371 Ga0501075_0049814 3300049591 Bacteria 3148
372 Ga0501075_0087016 3300049591 Bacteria 2368
373 Ga0501075_0473582 3300049591 Bacteria 955
374 Ga0501076_0027348 3300049592 Bacteria 4423
375 Ga0501076_0048327 3300049592 Bacteria 3363
376 Ga0501076_0194718 3300049592 Bacteria 1654
377 Ga0501076_0323936 3300049592 Bacteria 1264
378 Ga0501077_0038531 3300049593 Bacteria 3044
379 Ga0501077_0075926 3300049593 Bacteria 2128
380 Ga0501223_072473 3300049663 Bacteria 682
381 Ga0501079_0027281 3300049741 Bacteria 4378
382 Ga0501080_0453034 3300049742 Bacteria 1150
383 Ga0501081_0009154 3300049743 Bacteria 6446
384 Ga0501081_0021513 3300049743 Bacteria 4306
385 Ga0501081_0059003 3300049743 Bacteria 2656
386 Ga0501081_0078034 3300049743 Bacteria 2315
387 Ga0501081_0272192 3300049743 Bacteria 1239
388 Ga0501083_0541509 3300049744 Bacteria 758
389 Ga0501045_0049317 3300049824 Bacteria 3070
390 Ga0501045_0055422 3300049824 Bacteria 2899
391 Ga0501045_0123207 3300049824 Bacteria 1925
392 Ga0501045_0539664 3300049824 Bacteria 865
393 nmdc:mga0yw44_1081141_c1 3300050492 Bacteria 542
394 nmdc:mga05p37_2070_c1 3300050507 Bacteria 23400
395 nmdc:mga05p37_324769_c1 3300050507 Bacteria 1820
396 nmdc:mga05p37_333919_c1 3300050507 Bacteria 1789
397 nmdc:mga05p37_595867_c1 3300050507 Bacteria 1248
398 nmdc:mga09592_211207_c1 3300050508 Bacteria 1681
399 nmdc:mga09592_30790_c1 3300050508 Bacteria 4467
400 nmdc:mga09592_40339_c1 3300050508 Bacteria 3921
401 nmdc:mga09592_714606_c1 3300050508 Bacteria 852
402 nmdc:mga0qj67_1240450_c1 3300050509 Bacteria 579
403 nmdc:mga0qj67_59266_c1 3300050509 Bacteria 3036
404 nmdc:mga0qj67_74727_c1 3300050509 Bacteria 2708
405 nmdc:mga06r32_16129_c1 3300050510 Bacteria 6803
406 nmdc:mga06r32_248188_c1 3300050510 Bacteria 1767
407 nmdc:mga06r32_95356_c1 3300050510 Bacteria 2912
408 nmdc:mga08y16_235814_c1 3300050511 Bacteria 1892
409 nmdc:mga08y16_287028_c1 3300050511 Bacteria 1697
410 nmdc:mga08y16_723599_c1 3300050511 Bacteria 993
411 nmdc:mga0n895_1563362_c1 3300050512 Bacteria 625
412 nmdc:mga0a205_69181_c1 3300050515 Bacteria 3409
413 nmdc:mga0a205_777730_c1 3300050515 Bacteria 805
414 Ga0495601_0107147 3300053077 Bacteria 1808
415 Ga0495655_0013210 3300053083 Bacteria 1703
416 Ga0495655_0038506 3300053083 Unclassified 1207
417 Ga0495595_0068029 3300053084 Bacteria 1679
418 Ga0495619_0097105 3300053085 Bacteria 2001
419 Ga0495619_0989921 3300053085 Bacteria 563
420 Ga0501084_0008442 3300054114 Bacteria 8514
421 Ga0501084_0048343 3300054114 Bacteria 3561
422 Ga0501084_0053562 3300054114 Bacteria 3375
423 Ga0501084_0236975 3300054114 Bacteria 1540
424 Ga0501084_0352183 3300054114 Bacteria 1244
425 Ga0501084_0683625 3300054114 Bacteria 866
426 Ga0590075_068512 3300059424 Bacteria 916
427 Ga0501082_0058058 3300060353 Bacteria 3334
428 Ga0501082_0102730 3300060353 Bacteria 2473
429 Ga0501082_0199377 3300060353 Bacteria 1741
430 Ga0501082_0236532 3300060353 Bacteria 1590
431 Ga0501082_0330273 3300060353 Bacteria 1329
432 Ga0530510_0004046 3300061734 Bacteria 10124
433 Ga0530510_0005933 3300061734 Bacteria 8470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10345204 Ga0207686_103452042 147
2 3300046491 Ga0495584_0186962 Ga0495584_0186962_377_826 147
3 3300046522 Ga0495643_0352357 Ga0495643_0352357_163_612 147
4 3300046528 Ga0495642_0033139 Ga0495642_0033139_112_561 147
5 3300047323 Ga0495683_0100868 Ga0495683_0100868_138_587 147
6 3300047446 Ga0495679_080974 Ga0495679_080974_29_478 147
7 3300048091 Ga0495626_0076080 Ga0495626_0076080_581_1030 147
8 3300005457 Ga0070662_100089294 Ga0070662_1000892942 151
9 3300005459 Ga0068867_100904102 Ga0068867_1009041022 151
10 3300005543 Ga0070672_101105342 Ga0070672_1011053421 151
11 3300005544 Ga0070686_100028722 Ga0070686_1000287223 151
12 3300005545 Ga0070695_100049565 Ga0070695_1000495652 151
13 3300005564 Ga0070664_100114093 Ga0070664_1001140932 151
14 3300005577 Ga0068857_100093698 Ga0068857_1000936982 151
15 3300005718 Ga0068866_10658481 Ga0068866_106584812 151
16 3300006237 Ga0097621_100256985 Ga0097621_1002569853 151
17 3300006844 Ga0075428_100229209 Ga0075428_1002292092 151
18 3300009094 Ga0111539_10531958 Ga0111539_105319581 151
19 3300009098 Ga0105245_10055301 Ga0105245_100553014 151
20 3300009148 Ga0105243_10114572 Ga0105243_101145723 151
21 3300009176 Ga0105242_10427946 Ga0105242_104279462 151
22 3300011119 Ga0105246_10224562 Ga0105246_102245622 151
23 3300025901 Ga0207688_10052275 Ga0207688_100522753 151
24 3300025918 Ga0207662_10397100 Ga0207662_103971002 151
25 3300025925 Ga0207650_11253286 Ga0207650_112532861 151
26 3300025935 Ga0207709_10155682 Ga0207709_101556822 151
27 3300025940 Ga0207691_11016232 Ga0207691_110162322 151
28 3300025981 Ga0207640_10634040 Ga0207640_106340402 151
29 3300026035 Ga0207703_10605679 Ga0207703_106056792 151
30 3300026089 Ga0207648_10110671 Ga0207648_101106712 151
31 3300026116 Ga0207674_10100566 Ga0207674_101005662 151
32 3300026121 Ga0207683_10248840 Ga0207683_102488402 151
33 3300031824 Ga0307413_10495887 Ga0307413_104958871 151
34 3300031852 Ga0307410_10001724 Ga0307410_100017246 151
35 3300031901 Ga0307406_10589489 Ga0307406_105894891 151
36 3300031901 Ga0307406_11185691 Ga0307406_111856911 151
37 3300031903 Ga0307407_10000822 Ga0307407_100008225 151
38 3300031911 Ga0307412_10113042 Ga0307412_101130423 151
39 3300031995 Ga0307409_100423893 Ga0307409_1004238932 151
40 3300032002 Ga0307416_100473006 Ga0307416_1004730062 151
41 3300032126 Ga0307415_101833837 Ga0307415_1018338371 151
42 3300042005 Ga0439448_0046540 Ga0439448_0046540_156_617 151
43 3300046452 Ga0495617_117308 Ga0495617_117308_48_509 151
44 3300046500 Ga0495596_0166711 Ga0495596_0166711_310_771 151
45 3300046512 Ga0495610_0132335 Ga0495610_0132335_410_871 151
46 3300046518 Ga0495631_0033057 Ga0495631_0033057_1529_1990 151
47 3300046520 Ga0495637_0049907 Ga0495637_0049907_882_1343 151
48 3300046537 Ga0495598_0069847 Ga0495598_0069847_124_585 151
49 3300046538 Ga0495609_0428928 Ga0495609_0428928_52_513 151
50 3300046648 Ga0495611_0108480 Ga0495611_0108480_539_1000 151
51 3300046684 Ga0495669_0178745 Ga0495669_0178745_61_522 151
52 3300046694 Ga0495649_0534038 Ga0495649_0534038_70_531 151
53 3300049460 Ga0495682_0220074 Ga0495682_0220074_112_573 151
54 3300049663 Ga0501223_072473 Ga0501223_072473_137_598 151
55 3300053083 Ga0495655_0013210 Ga0495655_0013210_586_1047 151
56 3300005331 Ga0070670_100579536 Ga0070670_1005795362 154
57 3300005338 Ga0068868_101363106 Ga0068868_1013631061 154
58 3300005343 Ga0070687_100192967 Ga0070687_1001929672 154
59 3300005466 Ga0070685_10191441 Ga0070685_101914412 154
60 3300009177 Ga0105248_10310442 Ga0105248_103104422 154
61 3300009545 Ga0105237_10644283 Ga0105237_106442832 154
62 3300013306 Ga0163162_11168770 Ga0163162_111687702 154
63 3300013308 Ga0157375_10425563 Ga0157375_104255632 154
64 3300014326 Ga0157380_10708716 Ga0157380_107087162 154
65 3300014968 Ga0157379_10117832 Ga0157379_101178324 154
66 3300048909 Ga0496106_0331410 Ga0496106_0331410_724_1194 154
67 3300048912 Ga0496109_0020981 Ga0496109_0020981_2346_2816 154
68 3300048914 Ga0496111_0594322 Ga0496111_0594322_80_550 154
69 3300048916 Ga0496113_0414205 Ga0496113_0414205_119_589 154
70 3300049514 Ga0501291_069773 Ga0501291_069773_131_601 154
71 3300005981 Ga0081538_10010671 Ga0081538_100106715 155
72 3300047445 Ga0495677_0112668 Ga0495677_0112668_131_607 156
73 3300005545 Ga0070695_100774353 Ga0070695_1007743532 158
74 3300047472 Ga0495686_0044207 Ga0495686_0044207_1822_2298 158
75 3300054114 Ga0501084_0683625 Ga0501084_0683625_343_825 159
76 3300031548 Ga0307408_100023336 Ga0307408_1000233364 160
77 3300031731 Ga0307405_10012633 Ga0307405_100126335 160
78 3300031995 Ga0307409_100000585 Ga0307409_10000058512 160
79 3300032002 Ga0307416_100031416 Ga0307416_1000314164 160
80 3300046461 Ga0495641_0005510 Ga0495641_0005510_1422_1904 160
81 3300046475 Ga0495639_0194537 Ga0495639_0194537_20_502 160
82 3300046523 Ga0495644_0229143 Ga0495644_0229143_161_643 160
83 3300046683 Ga0495658_0077000 Ga0495658_0077000_174_656 160
84 3300047321 Ga0495676_0546700 Ga0495676_0546700_253_735 160
85 3300047472 Ga0495686_0000003 Ga0495686_0000003_126422_126904 160
86 3300049569 Ga0501032_0113780 Ga0501032_0113780_453_941 160
87 3300049575 Ga0501039_0072201 Ga0501039_0072201_902_1390 160
88 3300049576 Ga0501040_0067426 Ga0501040_0067426_1254_1742 160
89 3300049577 Ga0501041_0079495 Ga0501041_0079495_756_1244 160
90 3300049578 Ga0501042_0185333 Ga0501042_0185333_600_1088 160
91 3300049579 Ga0501043_0930708 Ga0501043_0930708_17_505 160
92 3300049582 Ga0501048_0093709 Ga0501048_0093709_698_1186 160
93 3300049587 Ga0501071_0245190 Ga0501071_0245190_821_1309 160
94 3300049588 Ga0501072_0554509 Ga0501072_0554509_57_545 160
95 3300049591 Ga0501075_0049814 Ga0501075_0049814_388_876 160
96 3300049592 Ga0501076_0194718 Ga0501076_0194718_747_1235 160
97 3300049593 Ga0501077_0038531 Ga0501077_0038531_194_682 160
98 3300049743 Ga0501081_0059003 Ga0501081_0059003_907_1395 160
99 3300054114 Ga0501084_0048343 Ga0501084_0048343_2029_2517 160
100 3300054114 Ga0501084_0352183 Ga0501084_0352183_557_1045 160
101 3300060353 Ga0501082_0236532 Ga0501082_0236532_498_986 160
102 3300005329 Ga0070683_100089868 Ga0070683_1000898684 161
103 3300005336 Ga0070680_100011130 Ga0070680_1000111302 161
104 3300005339 Ga0070660_100037812 Ga0070660_1000378122 161
105 3300005344 Ga0070661_100103727 Ga0070661_1001037273 161
106 3300005345 Ga0070692_10030646 Ga0070692_100306463 161
107 3300005347 Ga0070668_101172471 Ga0070668_1011724712 161
108 3300005354 Ga0070675_101096033 Ga0070675_1010960331 161
109 3300005530 Ga0070679_100020197 Ga0070679_1000201975 161
110 3300005535 Ga0070684_100001851 Ga0070684_1000018519 161
111 3300005563 Ga0068855_100384634 Ga0068855_1003846342 161
112 3300005564 Ga0070664_100580922 Ga0070664_1005809222 161
113 3300005578 Ga0068854_100408950 Ga0068854_1004089502 161
114 3300005614 Ga0068856_100066185 Ga0068856_1000661852 161
115 3300005616 Ga0068852_100021413 Ga0068852_1000214134 161
116 3300006847 Ga0075431_100020434 Ga0075431_1000204347 161
117 3300006880 Ga0075429_100022138 Ga0075429_1000221387 161
118 3300009093 Ga0105240_10034701 Ga0105240_100347014 161
119 3300009147 Ga0114129_10273189 Ga0114129_102731893 161
120 3300009545 Ga0105237_10077213 Ga0105237_100772132 161
121 3300009551 Ga0105238_10043360 Ga0105238_100433602 161
122 3300013102 Ga0157371_10115726 Ga0157371_101157263 161
123 3300013104 Ga0157370_10025457 Ga0157370_100254575 161
124 3300013105 Ga0157369_10016156 Ga0157369_100161564 161
125 3300013307 Ga0157372_10042061 Ga0157372_100420615 161
126 3300020082 Ga0206353_11748275 Ga0206353_117482755 161
127 3300025909 Ga0207705_10654410 Ga0207705_106544101 161
128 3300025912 Ga0207707_10076266 Ga0207707_100762662 161
129 3300025914 Ga0207671_10042415 Ga0207671_100424153 161
130 3300025919 Ga0207657_10027895 Ga0207657_100278955 161
131 3300025920 Ga0207649_10138398 Ga0207649_101383982 161
132 3300025921 Ga0207652_10058845 Ga0207652_100588455 161
133 3300025932 Ga0207690_10038870 Ga0207690_100388704 161
134 3300025944 Ga0207661_10002565 Ga0207661_100025659 161
135 3300025961 Ga0207712_10818184 Ga0207712_108181842 161
136 3300025981 Ga0207640_10047464 Ga0207640_100474642 161
137 3300026041 Ga0207639_10034935 Ga0207639_100349355 161
138 3300026078 Ga0207702_10035724 Ga0207702_100357244 161
139 3300026116 Ga0207674_10060700 Ga0207674_100607005 161
140 3300026142 Ga0207698_10038713 Ga0207698_100387135 161
141 3300032002 Ga0307416_100503829 Ga0307416_1005038293 161
142 3300046461 Ga0495641_0089012 Ga0495641_0089012_648_1133 161
143 3300046533 Ga0495640_0281324 Ga0495640_0281324_436_921 161
144 3300047472 Ga0495686_0024479 Ga0495686_0024479_844_1329 161
145 3300047472 Ga0495686_0081338 Ga0495686_0081338_1003_1488 161
146 3300049568 Ga0501031_0094299 Ga0501031_0094299_816_1307 161
147 3300049575 Ga0501039_0095965 Ga0501039_0095965_1311_1802 161
148 3300049576 Ga0501040_0026402 Ga0501040_0026402_1741_2232 161
149 3300049578 Ga0501042_0665192 Ga0501042_0665192_184_675 161
150 3300049579 Ga0501043_0314480 Ga0501043_0314480_104_595 161
151 3300049582 Ga0501048_0024884 Ga0501048_0024884_2336_2827 161
152 3300049584 Ga0501068_0128815 Ga0501068_0128815_948_1439 161
153 3300049588 Ga0501072_0044201 Ga0501072_0044201_753_1244 161
154 3300049592 Ga0501076_0027348 Ga0501076_0027348_2585_3076 161
155 3300049743 Ga0501081_0021513 Ga0501081_0021513_908_1399 161
156 3300049824 Ga0501045_0539664 Ga0501045_0539664_230_715 161
157 3300050492 nmdc:mga0yw44_1081141_c1 nmdc:mga0yw44_1081141_c1_26_511 161
158 3300050507 nmdc:mga05p37_324769_c1 nmdc:mga05p37_324769_c1_919_1404 161
159 3300050508 nmdc:mga09592_40339_c1 nmdc:mga09592_40339_c1_2382_2867 161
160 3300050509 nmdc:mga0qj67_59266_c1 nmdc:mga0qj67_59266_c1_169_654 161
161 3300050510 nmdc:mga06r32_95356_c1 nmdc:mga06r32_95356_c1_1922_2407 161
162 3300054114 Ga0501084_0053562 Ga0501084_0053562_2747_3238 161
163 3300060353 Ga0501082_0199377 Ga0501082_0199377_910_1401 161
164 3300005981 Ga0081538_10054892 Ga0081538_100548922 162
165 3300009148 Ga0105243_10222075 Ga0105243_102220752 162
166 3300025321 Ga0207656_10337658 Ga0207656_103376582 162
167 3300046675 Ga0495657_0023569 Ga0495657_0023569_2802_3290 162
168 3300046513 Ga0495616_0152566 Ga0495616_0152566_203_694 163
169 3300046515 Ga0495620_0031398 Ga0495620_0031398_247_738 163
170 3300046523 Ga0495644_0021176 Ga0495644_0021176_1699_2190 163
171 3300046615 Ga0495656_0017871 Ga0495656_0017871_1382_1873 163
172 3300049743 Ga0501081_0272192 Ga0501081_0272192_214_708 163
173 3300050509 nmdc:mga0qj67_1240450_c1 nmdc:mga0qj67_1240450_c1_65_556 163
174 3300005439 Ga0070711_101150003 Ga0070711_1011500031 164
175 3300005937 Ga0081455_10019583 Ga0081455_100195834 164
176 3300009147 Ga0114129_11265603 Ga0114129_112656032 164
177 3300021384 Ga0213876_10093772 Ga0213876_100937722 164
178 3300021388 Ga0213875_10011386 Ga0213875_100113863 164
179 3300025915 Ga0207693_10733454 Ga0207693_107334541 164
180 3300032004 Ga0307414_10931254 Ga0307414_109312541 164
181 3300037853 Ga0436364_0375363 Ga0436364_0375363_5677_6174 164
182 3300039437 Ga0436365_1518618 Ga0436365_1518618_2092_2589 164
183 3300039450 Ga0436363_0219803 Ga0436363_0219803_29_523 164
184 3300005329 Ga0070683_100617376 Ga0070683_1006173762 165
185 3300005937 Ga0081455_10032836 Ga0081455_100328363 165
186 3300006844 Ga0075428_100007055 Ga0075428_1000070556 165
187 3300006846 Ga0075430_100022193 Ga0075430_1000221933 165
188 3300006846 Ga0075430_100035941 Ga0075430_1000359412 165
189 3300009147 Ga0114129_10003533 Ga0114129_1000353318 165
190 3300025944 Ga0207661_10664574 Ga0207661_106645742 165
191 3300031852 Ga0307410_10153476 Ga0307410_101534763 165
192 3300032002 Ga0307416_101191478 Ga0307416_1011914782 165
193 3300042008 Ga0439450_123136 Ga0439450_123136_132_629 165
194 3300042461 Ga0439460_0089675 Ga0439460_0089675_102_599 165
195 3300045976 Ga0466967_0818547 Ga0466967_0818547_86_586 165
196 3300046500 Ga0495596_0023885 Ga0495596_0023885_811_1314 165
197 3300046517 Ga0495630_0137470 Ga0495630_0137470_191_706 165
198 3300046518 Ga0495631_0030357 Ga0495631_0030357_378_881 165
199 3300046519 Ga0495632_0284462 Ga0495632_0284462_184_681 165
200 3300046663 Ga0495635_0268685 Ga0495635_0268685_193_708 165
201 3300050507 nmdc:mga05p37_2070_c1 nmdc:mga05p37_2070_c1_18798_19295 165
202 3300050508 nmdc:mga09592_30790_c1 nmdc:mga09592_30790_c1_1928_2425 165
203 3300050509 nmdc:mga0qj67_74727_c1 nmdc:mga0qj67_74727_c1_1191_1688 165
204 3300053077 Ga0495601_0107147 Ga0495601_0107147_949_1464 165
205 3300053083 Ga0495655_0038506 Ga0495655_0038506_394_891 165
206 3300059424 Ga0590075_068512 Ga0590075_068512_372_869 165
207 3300005981 Ga0081538_10002778 Ga0081538_1000277816 166
208 3300005981 Ga0081538_10003555 Ga0081538_100035558 166
209 3300005981 Ga0081538_10081409 Ga0081538_100814092 166
210 3300005981 Ga0081538_10086310 Ga0081538_100863102 166
211 3300005981 Ga0081538_10094281 Ga0081538_100942812 166
212 3300009147 Ga0114129_11130495 Ga0114129_111304952 166
213 3300031911 Ga0307412_10130777 Ga0307412_101307772 166
214 3300031995 Ga0307409_100004644 Ga0307409_1000046446 166
215 3300032126 Ga0307415_100311111 Ga0307415_1003111112 166
216 3300035115 Ga0373941_0152134 Ga0373941_0152134_112_612 166
217 3300036401 Ga0373937_1199444 Ga0373937_1199444_170_670 166
218 3300037466 Ga0395898_0085468 Ga0395898_0085468_1385_1885 166
219 3300039437 Ga0436365_0125666 Ga0436365_0125666_2018_2524 166
220 3300045836 Ga0466958_0140718 Ga0466958_0140718_21_524 166
221 3300046522 Ga0495643_0346026 Ga0495643_0346026_139_642 166
222 3300049568 Ga0501031_0155824 Ga0501031_0155824_371_871 166
223 3300049570 Ga0501033_0143655 Ga0501033_0143655_214_714 166
224 3300049574 Ga0501038_0457870 Ga0501038_0457870_458_958 166
225 3300049577 Ga0501041_0163813 Ga0501041_0163813_169_669 166
226 3300049591 Ga0501075_0473582 Ga0501075_0473582_193_693 166
227 3300049592 Ga0501076_0323936 Ga0501076_0323936_133_633 166
228 3300049824 Ga0501045_0123207 Ga0501045_0123207_1174_1674 166
229 3300053085 Ga0495619_0989921 Ga0495619_0989921_29_529 166
230 3300060353 Ga0501082_0330273 Ga0501082_0330273_745_1245 166
231 3300005341 Ga0070691_10012024 Ga0070691_100120243 167
232 3300005345 Ga0070692_10558980 Ga0070692_105589802 167
233 3300005347 Ga0070668_100060863 Ga0070668_1000608633 167
234 3300005353 Ga0070669_100998900 Ga0070669_1009989001 167
235 3300005457 Ga0070662_100046496 Ga0070662_1000464964 167
236 3300005545 Ga0070695_100114483 Ga0070695_1001144833 167
237 3300005719 Ga0068861_100050363 Ga0068861_1000503635 167
238 3300006844 Ga0075428_100187367 Ga0075428_1001873673 167
239 3300006846 Ga0075430_100127364 Ga0075430_1001273641 167
240 3300009094 Ga0111539_10082291 Ga0111539_100822912 167
241 3300009094 Ga0111539_11305823 Ga0111539_113058232 167
242 3300009098 Ga0105245_10058045 Ga0105245_100580456 167
243 3300009553 Ga0105249_10004101 Ga0105249_1000410110 167
244 3300010375 Ga0105239_10290219 Ga0105239_102902192 167
245 3300013102 Ga0157371_10469116 Ga0157371_104691162 167
246 3300013306 Ga0163162_10221681 Ga0163162_102216812 167
247 3300013307 Ga0157372_10719419 Ga0157372_107194193 167
248 3300025901 Ga0207688_10339710 Ga0207688_103397102 167
249 3300025923 Ga0207681_10793822 Ga0207681_107938221 167
250 3300025927 Ga0207687_10100359 Ga0207687_101003591 167
251 3300025933 Ga0207706_10088376 Ga0207706_100883763 167
252 3300025972 Ga0207668_10174164 Ga0207668_101741642 167
253 3300026089 Ga0207648_10110251 Ga0207648_101102512 167
254 3300026118 Ga0207675_100067604 Ga0207675_1000676044 167
255 3300031852 Ga0307410_10983858 Ga0307410_109838582 167
256 3300031903 Ga0307407_10186529 Ga0307407_101865292 167
257 3300031995 Ga0307409_100097747 Ga0307409_1000977473 167
258 3300032002 Ga0307416_100311006 Ga0307416_1003110063 167
259 3300032126 Ga0307415_100002060 Ga0307415_1000020607 167
260 3300032126 Ga0307415_100391883 Ga0307415_1003918833 167
261 3300046477 Ga0495664_0001128 Ga0495664_0001128_7689_8195 167
262 3300046491 Ga0495584_0225788 Ga0495584_0225788_381_884 167
263 3300049588 Ga0501072_0690083 Ga0501072_0690083_232_735 167
264 3300050510 nmdc:mga06r32_248188_c1 nmdc:mga06r32_248188_c1_761_1264 167
265 3300005339 Ga0070660_100303647 Ga0070660_1003036472 168
266 3300005530 Ga0070679_100839125 Ga0070679_1008391251 168
267 3300005547 Ga0070693_100862078 Ga0070693_1008620781 168
268 3300005564 Ga0070664_100136213 Ga0070664_1001362132 168
269 3300005578 Ga0068854_101062196 Ga0068854_1010621961 168
270 3300006880 Ga0075429_100593178 Ga0075429_1005931782 168
271 3300009094 Ga0111539_10061245 Ga0111539_100612453 168
272 3300009147 Ga0114129_11291641 Ga0114129_112916412 168
273 3300009147 Ga0114129_11614484 Ga0114129_116144841 168
274 3300009148 Ga0105243_10076527 Ga0105243_100765272 168
275 3300013297 Ga0157378_10598228 Ga0157378_105982281 168
276 3300014745 Ga0157377_10218368 Ga0157377_102183682 168
277 3300025919 Ga0207657_10175916 Ga0207657_101759163 168
278 3300025921 Ga0207652_10487884 Ga0207652_104878843 168
279 3300025921 Ga0207652_10601953 Ga0207652_106019532 168
280 3300025927 Ga0207687_10502785 Ga0207687_105027852 168
281 3300025933 Ga0207706_10241010 Ga0207706_102410102 168
282 3300025935 Ga0207709_10218303 Ga0207709_102183032 168
283 3300025937 Ga0207669_10269450 Ga0207669_102694502 168
284 3300025945 Ga0207679_10079281 Ga0207679_100792812 168
285 3300026075 Ga0207708_10176852 Ga0207708_101768522 168
286 3300027907 Ga0207428_10105530 Ga0207428_101055303 168
287 3300032002 Ga0307416_100049386 Ga0307416_1000493864 168
288 3300032002 Ga0307416_101335139 Ga0307416_1013351392 168
289 3300035242 Ga0373962_0233692 Ga0373962_0233692_93_602 168
290 3300048903 Ga0496100_0001724 Ga0496100_0001724_7064_7573 168
291 3300048904 Ga0496101_0023260 Ga0496101_0023260_2792_3301 168
292 3300048913 Ga0496110_0640850 Ga0496110_0640850_293_802 168
293 3300048914 Ga0496111_0410463 Ga0496111_0410463_98_607 168
294 3300049578 Ga0501042_0060935 Ga0501042_0060935_1549_2064 168
295 3300049587 Ga0501071_0007074 Ga0501071_0007074_5190_5705 168
296 3300049588 Ga0501072_0009138 Ga0501072_0009138_4885_5400 168
297 3300049590 Ga0501074_0102814 Ga0501074_0102814_1376_1891 168
298 3300049591 Ga0501075_0005035 Ga0501075_0005035_1898_2413 168
299 3300049592 Ga0501076_0048327 Ga0501076_0048327_975_1490 168
300 3300049593 Ga0501077_0075926 Ga0501077_0075926_321_836 168
301 3300049741 Ga0501079_0027281 Ga0501079_0027281_3510_4025 168
302 3300049742 Ga0501080_0453034 Ga0501080_0453034_72_587 168
303 3300049743 Ga0501081_0009154 Ga0501081_0009154_3561_4076 168
304 3300049824 Ga0501045_0055422 Ga0501045_0055422_1320_1835 168
305 3300050507 nmdc:mga05p37_333919_c1 nmdc:mga05p37_333919_c1_1256_1765 168
306 3300050507 nmdc:mga05p37_595867_c1 nmdc:mga05p37_595867_c1_226_735 168
307 3300050511 nmdc:mga08y16_287028_c1 nmdc:mga08y16_287028_c1_1151_1660 168
308 3300050511 nmdc:mga08y16_723599_c1 nmdc:mga08y16_723599_c1_268_774 168
309 3300050512 nmdc:mga0n895_1563362_c1 nmdc:mga0n895_1563362_c1_79_588 168
310 3300050515 nmdc:mga0a205_69181_c1 nmdc:mga0a205_69181_c1_764_1273 168
311 3300054114 Ga0501084_0008442 Ga0501084_0008442_2467_2982 168
312 3300060353 Ga0501082_0058058 Ga0501082_0058058_972_1487 168
313 3300061734 Ga0530510_0004046 Ga0530510_0004046_6298_6813 168
314 3300003373 JGI25407J50210_10030414 JGI25407J50210_100304142 169
315 3300005981 Ga0081538_10009306 Ga0081538_100093065 169
316 3300006163 Ga0070715_10118931 Ga0070715_101189311 169
317 3300006844 Ga0075428_100096519 Ga0075428_1000965193 169
318 3300009094 Ga0111539_10143591 Ga0111539_101435912 169
319 3300048903 Ga0496100_0737961 Ga0496100_0737961_90_608 169
320 3300049568 Ga0501031_0453362 Ga0501031_0453362_205_714 169
321 3300049572 Ga0501036_0476468 Ga0501036_0476468_180_689 169
322 3300049577 Ga0501041_0171385 Ga0501041_0171385_243_752 169
323 3300049578 Ga0501042_0025353 Ga0501042_0025353_3554_4063 169
324 3300049587 Ga0501071_0201263 Ga0501071_0201263_724_1233 169
325 3300049588 Ga0501072_0078276 Ga0501072_0078276_1027_1536 169
326 3300049591 Ga0501075_0087016 Ga0501075_0087016_366_875 169
327 3300049743 Ga0501081_0078034 Ga0501081_0078034_1612_2121 169
328 3300050508 nmdc:mga09592_714606_c1 nmdc:mga09592_714606_c1_34_546 169
329 3300050511 nmdc:mga08y16_235814_c1 nmdc:mga08y16_235814_c1_1173_1685 169
330 3300050515 nmdc:mga0a205_777730_c1 nmdc:mga0a205_777730_c1_59_571 169
331 3300054114 Ga0501084_0236975 Ga0501084_0236975_580_1089 169
332 3300060353 Ga0501082_0102730 Ga0501082_0102730_1822_2331 169
333 3300061734 Ga0530510_0005933 Ga0530510_0005933_7696_8205 169
334 3300005434 Ga0070709_10087252 Ga0070709_100872524 170
335 3300005435 Ga0070714_100121768 Ga0070714_1001217683 170
336 3300005436 Ga0070713_100152739 Ga0070713_1001527393 170
337 3300005437 Ga0070710_10022339 Ga0070710_100223392 170
338 3300005439 Ga0070711_100005750 Ga0070711_1000057505 170
339 3300006028 Ga0070717_10059827 Ga0070717_100598272 170
340 3300006028 Ga0070717_10134488 Ga0070717_101344883 170
341 3300006175 Ga0070712_100005377 Ga0070712_1000053776 170
342 3300025898 Ga0207692_10013632 Ga0207692_100136325 170
343 3300025906 Ga0207699_10945692 Ga0207699_109456921 170
344 3300025915 Ga0207693_10003642 Ga0207693_100036428 170
345 3300025916 Ga0207663_10010187 Ga0207663_100101873 170
346 3300025928 Ga0207700_10053790 Ga0207700_100537902 170
347 3300025929 Ga0207664_10170619 Ga0207664_101706192 170
348 3300026089 Ga0207648_10404086 Ga0207648_104040862 170
349 3300028800 Ga0265338_10201340 Ga0265338_102013402 170
350 3300035117 Ga0373953_0045066 Ga0373953_0045066_717_1232 170
351 3300035410 Ga0373924_0036879 Ga0373924_0036879_575_1090 170
352 3300035724 Ga0373933_0129587 Ga0373933_0129587_1020_1535 170
353 3300038443 Ga0395901_1184083 Ga0395901_1184083_130_642 170
354 3300046454 Ga0495592_0263568 Ga0495592_0263568_97_612 170
355 3300046463 Ga0495653_0037415 Ga0495653_0037415_1953_2468 170
356 3300046477 Ga0495664_0371613 Ga0495664_0371613_330_845 170
357 3300046511 Ga0495608_0213754 Ga0495608_0213754_107_622 170
358 3300046514 Ga0495618_0081743 Ga0495618_0081743_393_908 170
359 3300046516 Ga0495628_0035878 Ga0495628_0035878_759_1274 170
360 3300046517 Ga0495630_0139065 Ga0495630_0139065_973_1488 170
361 3300046529 Ga0495652_0023490 Ga0495652_0023490_660_1175 170
362 3300046531 Ga0495665_0062632 Ga0495665_0062632_389_904 170
363 3300046533 Ga0495640_0019406 Ga0495640_0019406_2710_3225 170
364 3300046535 Ga0495586_0322557 Ga0495586_0322557_126_641 170
365 3300046536 Ga0495587_0213844 Ga0495587_0213844_192_707 170
366 3300046559 Ga0495667_0011091 Ga0495667_0011091_2100_2615 170
367 3300046559 Ga0495667_0416250 Ga0495667_0416250_71_586 170
368 3300046642 Ga0495634_0010743 Ga0495634_0010743_1665_2180 170
369 3300046663 Ga0495635_0148552 Ga0495635_0148552_839_1354 170
370 3300046675 Ga0495657_0006119 Ga0495657_0006119_1945_2460 170
371 3300046679 Ga0495623_0090871 Ga0495623_0090871_1345_1860 170
372 3300046680 Ga0495646_0008838 Ga0495646_0008838_2620_3135 170
373 3300046809 Ga0495600_0011715 Ga0495600_0011715_1651_2166 170
374 3300047317 Ga0495604_0078802 Ga0495604_0078802_38_553 170
375 3300047317 Ga0495604_0388751 Ga0495604_0388751_260_775 170
376 3300047319 Ga0495674_0059792 Ga0495674_0059792_1019_1534 170
377 3300047322 Ga0495680_0026654 Ga0495680_0026654_3029_3544 170
378 3300047471 Ga0495684_0004048 Ga0495684_0004048_9263_9778 170
379 3300048088 Ga0495602_0031393 Ga0495602_0031393_2105_2620 170
380 3300048907 Ga0496104_0016349 Ga0496104_0016349_4995_5510 170
381 3300048907 Ga0496104_0064902 Ga0496104_0064902_1655_2170 170
382 3300048908 Ga0496105_0151149 Ga0496105_0151149_226_741 170
383 3300048912 Ga0496109_0203195 Ga0496109_0203195_1293_1808 170
384 3300048916 Ga0496113_0205848 Ga0496113_0205848_608_1123 170
385 3300048917 Ga0496114_0152358 Ga0496114_0152358_201_716 170
386 3300053084 Ga0495595_0068029 Ga0495595_0068029_575_1090 170
387 3300053085 Ga0495619_0097105 Ga0495619_0097105_975_1490 170
388 3300009148 Ga0105243_10990866 Ga0105243_109908662 171
389 3300028556 Ga0265337_1000549 Ga0265337_100054915 171
390 3300028558 Ga0265326_10000402 Ga0265326_1000040212 171
391 3300028563 Ga0265319_1000612 Ga0265319_100061220 171
392 3300028577 Ga0265318_10001528 Ga0265318_1000152811 171
393 3300028654 Ga0265322_10041716 Ga0265322_100417163 171
394 3300028666 Ga0265336_10000001 Ga0265336_10000001121 171
395 3300028800 Ga0265338_10000046 Ga0265338_1000004610 171
396 3300029957 Ga0265324_10002114 Ga0265324_100021149 171
397 3300031235 Ga0265330_10184101 Ga0265330_101841012 171
398 3300031240 Ga0265320_10108123 Ga0265320_101081232 171
399 3300031247 Ga0265340_10000005 Ga0265340_10000005121 171
400 3300031344 Ga0265316_10033353 Ga0265316_100333535 171
401 3300049578 Ga0501042_0200545 Ga0501042_0200545_213_731 171
402 3300049744 Ga0501083_0541509 Ga0501083_0541509_56_574 171
403 3300049824 Ga0501045_0049317 Ga0501045_0049317_2072_2590 171
404 3300006847 Ga0075431_100079537 Ga0075431_1000795375 172
405 3300006880 Ga0075429_100213460 Ga0075429_1002134603 172
406 3300009147 Ga0114129_10132488 Ga0114129_101324883 172
407 3300028558 Ga0265326_10000010 Ga0265326_1000001083 172
408 3300028563 Ga0265319_1001868 Ga0265319_10018684 172
409 3300028573 Ga0265334_10000003 Ga0265334_10000003131 172
410 3300028800 Ga0265338_10088131 Ga0265338_100881312 172
411 3300028800 Ga0265338_10192184 Ga0265338_101921842 172
412 3300029957 Ga0265324_10001580 Ga0265324_100015807 172
413 3300031240 Ga0265320_10072959 Ga0265320_100729592 172
414 3300031251 Ga0265327_10302359 Ga0265327_103023592 172
415 3300031548 Ga0307408_100132062 Ga0307408_1001320623 172
416 3300031824 Ga0307413_10019825 Ga0307413_100198253 172
417 3300031852 Ga0307410_10059955 Ga0307410_100599553 172
418 3300031901 Ga0307406_10021241 Ga0307406_100212414 172
419 3300031903 Ga0307407_10605943 Ga0307407_106059432 172
420 3300031995 Ga0307409_100006209 Ga0307409_1000062099 172
421 3300032002 Ga0307416_100004948 Ga0307416_1000049485 172
422 3300032004 Ga0307414_10840086 Ga0307414_108400862 172
423 3300032005 Ga0307411_10156924 Ga0307411_101569243 172
424 3300032126 Ga0307415_100048355 Ga0307415_1000483554 172
425 3300050508 nmdc:mga09592_211207_c1 nmdc:mga09592_211207_c1_212_730 172
426 3300050510 nmdc:mga06r32_16129_c1 nmdc:mga06r32_16129_c1_5951_6469 172
427 3300025929 Ga0207664_10003530 Ga0207664_100035309 173
428 3300009176 Ga0105242_10678342 Ga0105242_106783421 174
429 3300025934 Ga0207686_10624759 Ga0207686_106247592 174
430 3300048905 Ga0496102_0710189 Ga0496102_0710189_56_589 174
431 3300006844 Ga0075428_100113536 Ga0075428_1001135362 177
432 3300003373 JGI25407J50210_10000941 JGI25407J50210_100009414 194
433 3300005981 Ga0081538_10000835 Ga0081538_100008357 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

9

124

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cg8-assembly1.cif.gz_B-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9559 18 167
2cg8-assembly1.cif.gz_D-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9533 18 167
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9417 18 167
2cg8-assembly1.cif.gz_A-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9411 18 167
4m5j-assembly1.cif.gz_A the identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase 0.938 19 176
ID Description Score Start End Superfamily
af_Q7X7X0_67_217_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9739 19 149 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.959 19 164 3.30.70.560
2cg8A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9456 20 164 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9321 19 182 3.30.70.560
3mcoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.925 19 176 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A7W0APL9-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9948 20 132 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A838PK28-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9873 20 176 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A538E9P4-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9832 20 176 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A7S0QXH3-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9811 18 149 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A7W0APL9-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9775 20 132 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Feature Viewer

pLDDT pTM Quality
84.43 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map