F442670

General Info

Members Datasets Scaffolds Average Seq Length
432 291 864 142

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0106170|Ga0495641_0106170_637_1116
Length 159
Sequence VLSPTRPIRGKTAGVLIQGKCHCGNISFSLVWDPDPLEIPARACTCSFCTKHGGVWTSYPAGVLRVAIADAARVSRYAFGTETAEFHVCARCGVVPLVTSRIDDNLYAVVSVNAFEGVDPALLRRVTSNLDGEGKDTRLARRKRNWIARVEFVDGRGAG

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
211 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
212 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
213 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
287 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
288 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
290 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 4.4
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0106170 3300046461 Unclassified 1253
2 SwRhRL3b_contig_419017 2162886006 Unclassified 851
3 JGI24740J21852_10005671 3300001979 Bacteria 5255
4 JGI24739J22299_10000597 3300001989 Bacteria 13005
5 JGI24737J22298_10029261 3300001990 Bacteria 1728
6 JGI25153J46596_10008274 3300003215 Bacteria 4993
7 rootH1_10048821 3300003316 Bacteria 4395
8 Ga0006562J51391_1070621 3300003578 Bacteria 10524
9 Ga0006562J51391_1070622 3300003578 Bacteria 7510
10 Ga0055525_1000082 3300003759 Bacteria 159396
11 Ga0055527_1000179 3300003760 Bacteria 42841
12 Ga0055535_1000405 3300003761 Bacteria 40615
13 Ga0055542_1000431 3300003762 Bacteria 40271
14 Ga0055529_1000428 3300003763 Bacteria 42837
15 Ga0065707_10358043 3300005295 Bacteria 908
16 Ga0070658_11062735 3300005327 Unclassified 704
17 Ga0070683_100102277 3300005329 Bacteria 2699
18 Ga0070683_100457522 3300005329 Bacteria 1218
19 Ga0070690_100048283 3300005330 Bacteria 2710
20 Ga0070690_101295100 3300005330 Bacteria 584
21 Ga0070670_100521232 3300005331 Unclassified 1058
22 Ga0070677_10257150 3300005333 Bacteria 870
23 Ga0068869_100223440 3300005334 Bacteria 1493
24 Ga0068869_100779633 3300005334 Bacteria 820
25 Ga0070666_10003267 3300005335 Bacteria 9844
26 Ga0070666_10021535 3300005335 Bacteria 4179
27 Ga0068868_100055063 3300005338 Bacteria 3137
28 Ga0068868_100328802 3300005338 Bacteria 1304
29 Ga0068868_100539902 3300005338 Bacteria 1026
30 Ga0068868_101179819 3300005338 Bacteria 707
31 Ga0070660_100304010 3300005339 Bacteria 1308
32 Ga0070660_100374102 3300005339 Bacteria 1176
33 Ga0070689_100351039 3300005340 Bacteria 1237
34 Ga0070689_100541819 3300005340 Bacteria 1002
35 Ga0070687_100041467 3300005343 Bacteria 2327
36 Ga0070692_10255510 3300005345 Bacteria 1051
37 Ga0070669_100255383 3300005353 Bacteria 1397
38 Ga0070675_100016707 3300005354 Bacteria 5825
39 Ga0070675_100269175 3300005354 Bacteria 1495
40 Ga0070671_100022423 3300005355 Bacteria 5156
41 Ga0070674_101139077 3300005356 Bacteria 690
42 Ga0070673_100214085 3300005364 Bacteria 1665
43 Ga0070659_100644658 3300005366 Bacteria 913
44 Ga0070667_100000235 3300005367 Bacteria 63272
45 Ga0070667_100043017 3300005367 Bacteria 3790
46 Ga0070667_100157653 3300005367 Bacteria 1997
47 Ga0070667_100647049 3300005367 Bacteria 976
48 Ga0070709_10080646 3300005434 Bacteria 2122
49 Ga0070713_100002285 3300005436 Bacteria 12459
50 Ga0070710_10012175 3300005437 Bacteria 4264
51 Ga0070701_10053332 3300005438 Bacteria 2104
52 Ga0070705_100000798 3300005440 Bacteria 17772
53 Ga0070705_100014059 3300005440 Bacteria 4108
54 Ga0070705_100337496 3300005440 Bacteria 1094
55 Ga0070705_100440637 3300005440 Bacteria 975
56 Ga0070700_100444049 3300005441 Bacteria 985
57 Ga0070694_100024350 3300005444 Bacteria 3907
58 Ga0070694_100024699 3300005444 Bacteria 3880
59 Ga0070708_100190741 3300005445 Bacteria 1917
60 Ga0070663_100000583 3300005455 Bacteria 19478
61 Ga0070663_100144843 3300005455 Bacteria 1817
62 Ga0070678_100010462 3300005456 Bacteria 5671
63 Ga0070662_100035414 3300005457 Bacteria 3525
64 Ga0070662_100311405 3300005457 Unclassified 1282
65 Ga0070662_100405337 3300005457 Bacteria 1126
66 Ga0070681_10000790 3300005458 Bacteria 26387
67 Ga0070681_10866082 3300005458 Bacteria 821
68 Ga0068867_100098725 3300005459 Bacteria 2227
69 Ga0068867_100294809 3300005459 Bacteria 1335
70 Ga0070685_10779732 3300005466 Unclassified 703
71 Ga0070706_100185461 3300005467 Bacteria 1944
72 Ga0070698_100232641 3300005471 Bacteria 1776
73 Ga0070699_100004429 3300005518 Bacteria 12418
74 Ga0070699_100017291 3300005518 Bacteria 6193
75 Ga0070699_100027592 3300005518 Bacteria 4896
76 Ga0070699_100551439 3300005518 Bacteria 1049
77 Ga0070679_100200759 3300005530 Bacteria 1960
78 Ga0070697_100003801 3300005536 Bacteria 11595
79 Ga0068853_100019259 3300005539 Bacteria 5657
80 Ga0068853_100553884 3300005539 Bacteria 1089
81 Ga0070672_100284204 3300005543 Bacteria 1400
82 Ga0070686_100382495 3300005544 Bacteria 1066
83 Ga0070695_100000996 3300005545 Bacteria 15419
84 Ga0070696_100001647 3300005546 Bacteria 14646
85 Ga0070693_100294903 3300005547 Bacteria 1091
86 Ga0070693_100660569 3300005547 Bacteria 761
87 Ga0070693_101164254 3300005547 Bacteria 591
88 Ga0070704_100043520 3300005549 Bacteria 3113
89 Ga0068855_100006624 3300005563 Bacteria 14070
90 Ga0068855_100321299 3300005563 Bacteria 1711
91 Ga0070664_100176270 3300005564 Unclassified 1898
92 Ga0070664_100311043 3300005564 Bacteria 1425
93 Ga0070664_100795998 3300005564 Bacteria 884
94 Ga0068857_100001024 3300005577 Bacteria 21585
95 Ga0068857_100308976 3300005577 Unclassified 1458
96 Ga0068854_100000287 3300005578 Bacteria 33813
97 Ga0068854_100004984 3300005578 Bacteria 8374
98 Ga0068854_100019471 3300005578 Bacteria 4574
99 Ga0068854_100829509 3300005578 Bacteria 808
100 Ga0068854_101742141 3300005578 Unclassified 570
101 Ga0068856_100000138 3300005614 Bacteria 73748
102 Ga0068856_100044167 3300005614 Bacteria 4384
103 Ga0070702_100401168 3300005615 Unclassified 981
104 Ga0070702_100600561 3300005615 Bacteria 825
105 Ga0068852_100670123 3300005616 Unclassified 1046
106 Ga0068859_100013616 3300005617 Bacteria 8153
107 Ga0068859_100197554 3300005617 Bacteria 2096
108 Ga0068859_101656672 3300005617 Bacteria 706
109 Ga0068864_100265372 3300005618 Bacteria 1598
110 Ga0068861_100078670 3300005719 Bacteria 2576
111 Ga0068861_100105457 3300005719 Unclassified 2251
112 Ga0068851_10055845 3300005834 Bacteria 2012
113 Ga0068870_10070540 3300005840 Bacteria 1904
114 Ga0068863_100052991 3300005841 Bacteria 3844
115 Ga0068858_100016361 3300005842 Bacteria 6966
116 Ga0068858_100068808 3300005842 Bacteria 3281
117 Ga0068858_100138919 3300005842 Bacteria 2281
118 Ga0068858_100385750 3300005842 Bacteria 1345
119 Ga0068858_100714540 3300005842 Bacteria 975
120 Ga0068860_100007576 3300005843 Bacteria 10863
121 Ga0068860_100041141 3300005843 Bacteria 4414
122 Ga0068860_100048100 3300005843 Bacteria 4065
123 Ga0068862_102395839 3300005844 Bacteria 539
124 Ga0070715_10000363 3300006163 Bacteria 11345
125 Ga0070716_100381523 3300006173 Bacteria 1007
126 Ga0070712_100287823 3300006175 Bacteria 1325
127 Ga0097621_100005189 3300006237 Bacteria 9153
128 Ga0097621_100749676 3300006237 Bacteria 902
129 Ga0068871_100055789 3300006358 Bacteria 3208
130 Ga0075428_100006720 3300006844 Bacteria 12796
131 Ga0075430_101051964 3300006846 Unclassified 670
132 Ga0075431_101208796 3300006847 Unclassified 718
133 Ga0075433_10135790 3300006852 Bacteria 2186
134 Ga0075434_100812264 3300006871 Unclassified 951
135 Ga0075429_100186650 3300006880 Bacteria 1817
136 Ga0068865_100084987 3300006881 Bacteria 2282
137 Ga0075436_100214328 3300006914 Bacteria 1365
138 Ga0097620_100013616 3300006931 Bacteria 8153
139 Ga0097620_100197564 3300006931 Bacteria 2096
140 Ga0097620_101656745 3300006931 Bacteria 706
141 Ga0075435_100624168 3300007076 Bacteria 935
142 Ga0075435_101439930 3300007076 Bacteria 604
143 Ga0099794_10122322 3300007265 Bacteria 1310
144 Ga0099794_10184855 3300007265 Bacteria 1064
145 Ga0105240_10003821 3300009093 Bacteria 23283
146 Ga0105240_10009271 3300009093 Bacteria 13959
147 Ga0105240_10019850 3300009093 Bacteria 8977
148 Ga0105240_10139652 3300009093 Bacteria 2898
149 Ga0105240_10515063 3300009093 Bacteria 1328
150 Ga0105240_10628164 3300009093 Bacteria 1180
151 Ga0111539_10001080 3300009094 Bacteria 36018
152 Ga0111539_11001580 3300009094 Bacteria 971
153 Ga0105245_10286176 3300009098 Bacteria 1613
154 Ga0105245_11459392 3300009098 Bacteria 735
155 Ga0105247_10030152 3300009101 Bacteria 3288
156 Ga0114129_10169477 3300009147 Bacteria 2977
157 Ga0105243_10059127 3300009148 Bacteria 3058
158 Ga0105243_11241356 3300009148 Unclassified 760
159 Ga0105241_10004061 3300009174 Bacteria 10829
160 Ga0105242_10105300 3300009176 Bacteria 2396
161 Ga0105248_10000167 3300009177 Bacteria 76591
162 Ga0105248_10372328 3300009177 Bacteria 1608
163 Ga0105248_11352055 3300009177 Bacteria 806
164 Ga0105237_10000095 3300009545 Bacteria 121776
165 Ga0105237_10002091 3300009545 Bacteria 25231
166 Ga0105237_10017179 3300009545 Bacteria 7505
167 Ga0105237_11065513 3300009545 Unclassified 815
168 Ga0105238_10245616 3300009551 Bacteria 1768
169 Ga0105249_10000271 3300009553 Bacteria 54577
170 Ga0105249_10228087 3300009553 Bacteria 1836
171 Ga0105239_10052491 3300010375 Bacteria 4471
172 Ga0105239_10324924 3300010375 Bacteria 1735
173 Ga0105239_10634656 3300010375 Unclassified 1219
174 Ga0105239_10656922 3300010375 Bacteria 1198
175 Ga0105239_11502729 3300010375 Bacteria 778
176 Ga0157314_1000065 3300012500 Bacteria 11331
177 Ga0157373_10299527 3300013100 Unclassified 1141
178 Ga0157369_10250374 3300013105 Bacteria 1849
179 Ga0157369_10443156 3300013105 Bacteria 1345
180 Ga0157374_10040089 3300013296 Bacteria 4312
181 Ga0157378_10005124 3300013297 Bacteria 11505
182 Ga0157378_10097505 3300013297 Bacteria 2680
183 Ga0157378_12074984 3300013297 Unclassified 619
184 Ga0163162_10013023 3300013306 Bacteria 8118
185 Ga0163162_12966540 3300013306 Bacteria 545
186 Ga0157375_10194576 3300013308 Bacteria 2183
187 Ga0157375_10502638 3300013308 Bacteria 1376
188 Ga0163163_10658952 3300014325 Bacteria 1110
189 Ga0157380_10121583 3300014326 Bacteria 2212
190 Ga0157380_11902594 3300014326 Unclassified 655
191 Ga0157377_11244914 3300014745 Unclassified 579
192 Ga0157377_11719531 3300014745 Unclassified 507
193 Ga0157379_10068194 3300014968 Bacteria 3180
194 Ga0157376_10032855 3300014969 Bacteria 4171
195 Ga0157376_10297039 3300014969 Bacteria 1527
196 Ga0157376_11925619 3300014969 Unclassified 628
197 Ga0213874_10006886 3300021377 Bacteria 2708
198 Ga0209672_100826 3300025228 Bacteria 14489
199 Ga0209563_100097 3300025230 Bacteria 159453
200 Ga0209129_1002332 3300025258 Bacteria 9398
201 Ga0209758_1000417 3300025297 Bacteria 72277
202 Ga0207656_10002105 3300025321 Bacteria 6652
203 Ga0207653_10429876 3300025885 Unclassified 518
204 Ga0207682_10127338 3300025893 Bacteria 1134
205 Ga0207692_10009583 3300025898 Bacteria 4052
206 Ga0207642_10121873 3300025899 Bacteria 1347
207 Ga0207688_10133315 3300025901 Bacteria 1457
208 Ga0207680_10013389 3300025903 Bacteria 4212
209 Ga0207680_10344261 3300025903 Bacteria 1046
210 Ga0207680_10913425 3300025903 Bacteria 629
211 Ga0207647_10016127 3300025904 Bacteria 5105
212 Ga0207685_10159855 3300025905 Bacteria 1028
213 Ga0207643_10044964 3300025908 Bacteria 2493
214 Ga0207707_10024269 3300025912 Bacteria 5306
215 Ga0207707_10085348 3300025912 Bacteria 2758
216 Ga0207695_10001371 3300025913 Bacteria 41340
217 Ga0207695_10010635 3300025913 Bacteria 11243
218 Ga0207695_10170504 3300025913 Bacteria 2102
219 Ga0207695_10344067 3300025913 Bacteria 1379
220 Ga0207695_10448458 3300025913 Bacteria 1173
221 Ga0207695_10520430 3300025913 Bacteria 1071
222 Ga0207671_10000026 3300025914 Bacteria 268845
223 Ga0207671_10008618 3300025914 Bacteria 8617
224 Ga0207671_10271692 3300025914 Bacteria 1336
225 Ga0207693_10002400 3300025915 Bacteria 16262
226 Ga0207693_10010091 3300025915 Bacteria 7671
227 Ga0207663_10336188 3300025916 Bacteria 1139
228 Ga0207660_10303650 3300025917 Unclassified 1271
229 Ga0207662_10100923 3300025918 Bacteria 1788
230 Ga0207657_10027904 3300025919 Bacteria 5161
231 Ga0207657_10210929 3300025919 Bacteria 1559
232 Ga0207649_10558642 3300025920 Bacteria 876
233 Ga0207694_10114976 3300025924 Bacteria 2143
234 Ga0207659_10196396 3300025926 Bacteria 1608
235 Ga0207687_10174074 3300025927 Bacteria 1662
236 Ga0207700_10437240 3300025928 Unclassified 1151
237 Ga0207664_10361608 3300025929 Bacteria 1286
238 Ga0207644_10095321 3300025931 Bacteria 2225
239 Ga0207706_10047063 3300025933 Unclassified 3817
240 Ga0207706_10466849 3300025933 Bacteria 1091
241 Ga0207686_11513425 3300025934 Unclassified 553
242 Ga0207704_10083840 3300025938 Bacteria 2069
243 Ga0207665_10003249 3300025939 Bacteria 10881
244 Ga0207665_10017232 3300025939 Bacteria 4745
245 Ga0207691_10245936 3300025940 Bacteria 1545
246 Ga0207711_10000538 3300025941 Bacteria 38775
247 Ga0207711_10059125 3300025941 Bacteria 3300
248 Ga0207689_10024726 3300025942 Bacteria 5035
249 Ga0207661_10100378 3300025944 Bacteria 2429
250 Ga0207661_10978816 3300025944 Bacteria 779
251 Ga0207679_10227376 3300025945 Unclassified 1573
252 Ga0207667_10000432 3300025949 Bacteria 56395
253 Ga0207667_10001233 3300025949 Bacteria 32072
254 Ga0207651_10476832 3300025960 Bacteria 1075
255 Ga0207712_10000301 3300025961 Bacteria 46175
256 Ga0207640_10000025 3300025981 Bacteria 143903
257 Ga0207640_10000208 3300025981 Bacteria 41443
258 Ga0207658_10000056 3300025986 Bacteria 124846
259 Ga0207658_10368431 3300025986 Bacteria 1255
260 Ga0207658_11394288 3300025986 Bacteria 641
261 Ga0207677_10170041 3300026023 Bacteria 1703
262 Ga0207677_10194345 3300026023 Bacteria 1607
263 Ga0207677_10646811 3300026023 Bacteria 933
264 Ga0207703_10029736 3300026035 Bacteria 4312
265 Ga0207703_10036054 3300026035 Bacteria 3934
266 Ga0207703_10255741 3300026035 Bacteria 1581
267 Ga0207703_10308858 3300026035 Bacteria 1445
268 Ga0207703_10683879 3300026035 Bacteria 975
269 Ga0207639_10016763 3300026041 Bacteria 5189
270 Ga0207678_10000389 3300026067 Bacteria 39987
271 Ga0207678_10073514 3300026067 Bacteria 2930
272 Ga0207678_10149186 3300026067 Bacteria 1996
273 Ga0207678_11165814 3300026067 Bacteria 682
274 Ga0207708_10373727 3300026075 Bacteria 1174
275 Ga0207702_10000740 3300026078 Bacteria 34919
276 Ga0207702_10049557 3300026078 Bacteria 3544
277 Ga0207702_10841088 3300026078 Unclassified 908
278 Ga0207641_10426240 3300026088 Bacteria 1278
279 Ga0207641_10674314 3300026088 Bacteria 1017
280 Ga0207648_10034730 3300026089 Unclassified 4444
281 Ga0207648_10149622 3300026089 Bacteria 2060
282 Ga0207648_10397061 3300026089 Bacteria 1249
283 Ga0207676_10829741 3300026095 Bacteria 903
284 Ga0207674_10000695 3300026116 Bacteria 43737
285 Ga0207675_100196546 3300026118 Bacteria 1936
286 Ga0207675_100228782 3300026118 Bacteria 1793
287 Ga0207683_10001886 3300026121 Bacteria 18558
288 Ga0207683_10512951 3300026121 Bacteria 1108
289 Ga0207698_11464147 3300026142 Bacteria 698
290 Ga0209981_1078091 3300027378 Unclassified 515
291 Ga0209999_1067243 3300027543 Unclassified 685
292 Ga0209971_1026597 3300027682 Bacteria 1383
293 Ga0207428_10008673 3300027907 Bacteria 9181
294 Ga0268266_10493291 3300028379 Bacteria 1169
295 Ga0268264_10013866 3300028381 Bacteria 6627
296 Ga0268264_10036317 3300028381 Bacteria 4059
297 Ga0268264_10163347 3300028381 Bacteria 2008
298 Ga0268264_10752494 3300028381 Bacteria 971
299 Ga0265332_10026980 3300031238 Bacteria 2517
300 Ga0307516_10000067 3300031730 Bacteria 111575
301 Ga0307416_101473391 3300032002 Unclassified 786
302 Ga0307416_102110455 3300032002 Bacteria 665
303 Ga0307507_10283216 3300033179 Unclassified 1034
304 Ga0373929_0112956 3300035085 Bacteria 696
305 Ga0373952_0039646 3300035092 Bacteria 1083
306 Ga0373936_0013565 3300035113 Bacteria 3110
307 Ga0373939_0044601 3300035114 Bacteria 1350
308 Ga0373945_0134708 3300035116 Bacteria 992
309 Ga0373953_0101771 3300035117 Bacteria 1209
310 Ga0373954_0124317 3300035118 Bacteria 1253
311 Ga0373954_0129632 3300035118 Bacteria 1227
312 Ga0373957_0061179 3300035120 Bacteria 1458
313 Ga0373957_0415640 3300035120 Unclassified 580
314 Ga0373960_0039238 3300035121 Bacteria 1361
315 Ga0373943_0022072 3300035170 Bacteria 2945
316 Ga0373955_0020045 3300035172 Bacteria 3354
317 Ga0373955_0050039 3300035172 Bacteria 2271
318 Ga0373942_0009125 3300035207 Bacteria 2317
319 Ga0373961_0011535 3300035241 Bacteria 2195
320 Ga0373924_0007500 3300035410 Bacteria 3940
321 Ga0373931_0088881 3300035691 Bacteria 1718
322 Ga0373935_0070722 3300035692 Bacteria 2250
323 Ga0373935_1196413 3300035692 Unclassified 566
324 Ga0373927_0016136 3300035695 Bacteria 4928
325 Ga0373933_0016236 3300035724 Bacteria 4160
326 Ga0373933_0140040 3300035724 Bacteria 1527
327 Ga0373933_0608754 3300035724 Unclassified 717
328 Ga0373947_0015434 3300035725 Bacteria 4385
329 Ga0373937_0072137 3300036401 Bacteria 3184
330 Ga0373937_0229951 3300036401 Bacteria 1746
331 Ga0373925_0026048 3300037068 Bacteria 4276
332 Ga0373925_0990476 3300037068 Unclassified 692
333 Ga0395905_0001200 3300037471 Bacteria 32396
334 Ga0436360_0217279 3300039438 Bacteria 2534
335 Ga0436363_0215343 3300039450 Bacteria 1736
336 Ga0436363_0475575 3300039450 Bacteria 6155
337 Ga0439453_0066318 3300041408 Unclassified 756
338 Ga0439461_0146470 3300041410 Unclassified 607
339 Ga0451800_0579666 3300041459 Bacteria 1091
340 Ga0439441_028661 3300042001 Bacteria 1068
341 Ga0439443_024284 3300042003 Unclassified 971
342 Ga0439456_031087 3300042013 Bacteria 1143
343 Ga0439446_0086701 3300042156 Bacteria 976
344 Ga0439435_0001421 3300042436 Bacteria 4415
345 Ga0439460_0120596 3300042461 Bacteria 857
346 Ga0466969_0030676 3300044656 Bacteria 2739
347 Ga0466969_0154688 3300044656 Bacteria 1055
348 Ga0466972_0010969 3300044658 Bacteria 4548
349 Ga0466982_0000015 3300044672 Bacteria 131281
350 Ga0466964_0002674 3300044706 Bacteria 6382
351 Ga0466971_0006084 3300044719 Bacteria 5250
352 Ga0466968_0003252 3300044735 Bacteria 5985
353 Ga0466970_0172606 3300044765 Bacteria 1198
354 Ga0466970_0942895 3300044765 Bacteria 508
355 Ga0466957_0056144 3300044842 Bacteria 2407
356 Ga0466957_0221365 3300044842 Bacteria 1250
357 Ga0466957_0265978 3300044842 Bacteria 1144
358 Ga0466960_0048892 3300044901 Bacteria 2033
359 Ga0466959_0468038 3300045049 Bacteria 854
360 Ga0451576_0347992 3300045051 Bacteria 1552
361 Ga0466958_0093619 3300045836 Bacteria 1861
362 Ga0495592_0532414 3300046454 Bacteria 725
363 Ga0495629_0284455 3300046459 Bacteria 1134
364 Ga0495580_0019324 3300046472 Bacteria 5062
365 Ga0495580_0019513 3300046472 Bacteria 5037
366 Ga0495580_0074360 3300046472 Bacteria 2371
367 Ga0495582_0274301 3300046473 Bacteria 968
368 Ga0495594_0009332 3300046499 Bacteria 5068
369 Ga0495608_0187105 3300046511 Bacteria 1308
370 Ga0495618_0624424 3300046514 Unclassified 639
371 Ga0495630_0624608 3300046517 Unclassified 825
372 Ga0495665_0177658 3300046531 Bacteria 1107
373 Ga0495586_0701257 3300046535 Unclassified 584
374 Ga0495587_0461325 3300046536 Unclassified 703
375 Ga0495621_0072254 3300046539 Bacteria 1273
376 Ga0495622_0082711 3300046557 Bacteria 1477
377 Ga0495667_0108506 3300046559 Bacteria 1793
378 Ga0495646_0477619 3300046680 Bacteria 642
379 Ga0495647_0303285 3300046681 Bacteria 720
380 Ga0495624_0126061 3300046690 Bacteria 1571
381 Ga0495671_0226406 3300046692 Bacteria 905
382 Ga0495581_0569196 3300047315 Bacteria 657
383 Ga0495604_0125088 3300047317 Bacteria 1855
384 Ga0495674_0446016 3300047319 Bacteria 1040
385 Ga0495680_0019856 3300047322 Bacteria 5664
386 Ga0495686_0004347 3300047472 Bacteria 11705
387 Ga0495593_0205694 3300047673 Bacteria 989
388 Ga0496100_0135429 3300048903 Bacteria 1739
389 Ga0496101_0120702 3300048904 Bacteria 1981
390 Ga0496102_0056347 3300048905 Bacteria 3585
391 Ga0496102_0119776 3300048905 Bacteria 2458
392 Ga0496104_0371098 3300048907 Bacteria 1343
393 Ga0496105_0187844 3300048908 Bacteria 1690
394 Ga0496106_0068273 3300048909 Bacteria 2711
395 Ga0496107_0253845 3300048910 Bacteria 1308
396 Ga0496108_0004541 3300048911 Bacteria 11179
397 Ga0496108_1090921 3300048911 Bacteria 679
398 Ga0496109_0036912 3300048912 Bacteria 4413
399 Ga0496110_0013721 3300048913 Bacteria 6712
400 Ga0496111_0039621 3300048914 Bacteria 3379
401 Ga0496112_0119271 3300048915 Bacteria 2608
402 Ga0496112_0157878 3300048915 Bacteria 2235
403 Ga0496113_0412607 3300048916 Bacteria 1084
404 Ga0496114_0074064 3300048917 Bacteria 2866
405 Ga0496115_0097813 3300048918 Bacteria 2403
406 Ga0496118_0235633 3300048921 Bacteria 1052
407 Ga0496121_0029393 3300048924 Bacteria 5082
408 Ga0496121_0055497 3300048924 Bacteria 3300
409 Ga0496122_0005693 3300048925 Bacteria 14708
410 Ga0496123_0004026 3300048926 Bacteria 15858
411 Ga0496125_0000643 3300048928 Bacteria 58244
412 Ga0496126_0313393 3300048929 Unclassified 1291
413 Ga0501040_0670707 3300049576 Bacteria 749
414 nmdc:mga07m45_119095_c1 3300050496 Bacteria 1524
415 nmdc:mga09592_177764_c1 3300050508 Bacteria 1841
416 nmdc:mga0qj67_319637_c1 3300050509 Bacteria 1257
417 nmdc:mga0qj67_375891_c1 3300050509 Unclassified 1148
418 nmdc:mga08y16_7124_c1 3300050511 Bacteria 11735
419 nmdc:mga0n895_798372_c1 3300050512 Unclassified 934
420 nmdc:mga0rr50_464368_c1 3300050513 Bacteria 1074
421 nmdc:mga08x19_219982_c2 3300050514 Unclassified 797
422 Ga0495601_0342936 3300053077 Bacteria 972
423 Ga0500635_0111634 3300053080 Unclassified 1016
424 Ga0495595_0175930 3300053084 Bacteria 1060
425 Ga0500566_0223875 3300053094 Unclassified 933
426 Ga0500597_000432 3300053120 Bacteria 8806
427 Ga0500597_158327 3300053120 Bacteria 969
428 Ga0500614_085401 3300053123 Unclassified 889
429 Ga0500658_0429254 3300053134 Bacteria 603
430 Ga0500636_0229528 3300053177 Bacteria 961
431 Ga0500637_0294121 3300053178 Unclassified 888
432 Ga0466962_0005764 3300061719 Bacteria 5950
433 Ga0495641_0106170
434 SwRhRL3b_contig_419017
435 JGI24740J21852_10005671
436 JGI24739J22299_10000597
437 JGI24737J22298_10029261
438 JGI25153J46596_10008274
439 rootH1_10048821
440 Ga0006562J51391_1070621
441 Ga0006562J51391_1070622
442 Ga0055525_1000082
443 Ga0055527_1000179
444 Ga0055535_1000405
445 Ga0055542_1000431
446 Ga0055529_1000428
447 Ga0065707_10358043
448 Ga0070658_11062735
449 Ga0070683_100102277
450 Ga0070683_100457522
451 Ga0070690_100048283
452 Ga0070690_101295100
453 Ga0070670_100521232
454 Ga0070677_10257150
455 Ga0068869_100223440
456 Ga0068869_100779633
457 Ga0070666_10003267
458 Ga0070666_10021535
459 Ga0068868_100055063
460 Ga0068868_100328802
461 Ga0068868_100539902
462 Ga0068868_101179819
463 Ga0070660_100304010
464 Ga0070660_100374102
465 Ga0070689_100351039
466 Ga0070689_100541819
467 Ga0070687_100041467
468 Ga0070692_10255510
469 Ga0070669_100255383
470 Ga0070675_100016707
471 Ga0070675_100269175
472 Ga0070671_100022423
473 Ga0070674_101139077
474 Ga0070673_100214085
475 Ga0070659_100644658
476 Ga0070667_100000235
477 Ga0070667_100043017
478 Ga0070667_100157653
479 Ga0070667_100647049
480 Ga0070709_10080646
481 Ga0070713_100002285
482 Ga0070710_10012175
483 Ga0070701_10053332
484 Ga0070705_100000798
485 Ga0070705_100014059
486 Ga0070705_100337496
487 Ga0070705_100440637
488 Ga0070700_100444049
489 Ga0070694_100024350
490 Ga0070694_100024699
491 Ga0070708_100190741
492 Ga0070663_100000583
493 Ga0070663_100144843
494 Ga0070678_100010462
495 Ga0070662_100035414
496 Ga0070662_100311405
497 Ga0070662_100405337
498 Ga0070681_10000790
499 Ga0070681_10866082
500 Ga0068867_100098725
501 Ga0068867_100294809
502 Ga0070685_10779732
503 Ga0070706_100185461
504 Ga0070698_100232641
505 Ga0070699_100004429
506 Ga0070699_100017291
507 Ga0070699_100027592
508 Ga0070699_100551439
509 Ga0070679_100200759
510 Ga0070697_100003801
511 Ga0068853_100019259
512 Ga0068853_100553884
513 Ga0070672_100284204
514 Ga0070686_100382495
515 Ga0070695_100000996
516 Ga0070696_100001647
517 Ga0070693_100294903
518 Ga0070693_100660569
519 Ga0070693_101164254
520 Ga0070704_100043520
521 Ga0068855_100006624
522 Ga0068855_100321299
523 Ga0070664_100176270
524 Ga0070664_100311043
525 Ga0070664_100795998
526 Ga0068857_100001024
527 Ga0068857_100308976
528 Ga0068854_100000287
529 Ga0068854_100004984
530 Ga0068854_100019471
531 Ga0068854_100829509
532 Ga0068854_101742141
533 Ga0068856_100000138
534 Ga0068856_100044167
535 Ga0070702_100401168
536 Ga0070702_100600561
537 Ga0068852_100670123
538 Ga0068859_100013616
539 Ga0068859_100197554
540 Ga0068859_101656672
541 Ga0068864_100265372
542 Ga0068861_100078670
543 Ga0068861_100105457
544 Ga0068851_10055845
545 Ga0068870_10070540
546 Ga0068863_100052991
547 Ga0068858_100016361
548 Ga0068858_100068808
549 Ga0068858_100138919
550 Ga0068858_100385750
551 Ga0068858_100714540
552 Ga0068860_100007576
553 Ga0068860_100041141
554 Ga0068860_100048100
555 Ga0068862_102395839
556 Ga0070715_10000363
557 Ga0070716_100381523
558 Ga0070712_100287823
559 Ga0097621_100005189
560 Ga0097621_100749676
561 Ga0068871_100055789
562 Ga0075428_100006720
563 Ga0075430_101051964
564 Ga0075431_101208796
565 Ga0075433_10135790
566 Ga0075434_100812264
567 Ga0075429_100186650
568 Ga0068865_100084987
569 Ga0075436_100214328
570 Ga0097620_100013616
571 Ga0097620_100197564
572 Ga0097620_101656745
573 Ga0075435_100624168
574 Ga0075435_101439930
575 Ga0099794_10122322
576 Ga0099794_10184855
577 Ga0105240_10003821
578 Ga0105240_10009271
579 Ga0105240_10019850
580 Ga0105240_10139652
581 Ga0105240_10515063
582 Ga0105240_10628164
583 Ga0111539_10001080
584 Ga0111539_11001580
585 Ga0105245_10286176
586 Ga0105245_11459392
587 Ga0105247_10030152
588 Ga0114129_10169477
589 Ga0105243_10059127
590 Ga0105243_11241356
591 Ga0105241_10004061
592 Ga0105242_10105300
593 Ga0105248_10000167
594 Ga0105248_10372328
595 Ga0105248_11352055
596 Ga0105237_10000095
597 Ga0105237_10002091
598 Ga0105237_10017179
599 Ga0105237_11065513
600 Ga0105238_10245616
601 Ga0105249_10000271
602 Ga0105249_10228087
603 Ga0105239_10052491
604 Ga0105239_10324924
605 Ga0105239_10634656
606 Ga0105239_10656922
607 Ga0105239_11502729
608 Ga0157314_1000065
609 Ga0157373_10299527
610 Ga0157369_10250374
611 Ga0157369_10443156
612 Ga0157374_10040089
613 Ga0157378_10005124
614 Ga0157378_10097505
615 Ga0157378_12074984
616 Ga0163162_10013023
617 Ga0163162_12966540
618 Ga0157375_10194576
619 Ga0157375_10502638
620 Ga0163163_10658952
621 Ga0157380_10121583
622 Ga0157380_11902594
623 Ga0157377_11244914
624 Ga0157377_11719531
625 Ga0157379_10068194
626 Ga0157376_10032855
627 Ga0157376_10297039
628 Ga0157376_11925619
629 Ga0213874_10006886
630 Ga0209672_100826
631 Ga0209563_100097
632 Ga0209129_1002332
633 Ga0209758_1000417
634 Ga0207656_10002105
635 Ga0207653_10429876
636 Ga0207682_10127338
637 Ga0207692_10009583
638 Ga0207642_10121873
639 Ga0207688_10133315
640 Ga0207680_10013389
641 Ga0207680_10344261
642 Ga0207680_10913425
643 Ga0207647_10016127
644 Ga0207685_10159855
645 Ga0207643_10044964
646 Ga0207707_10024269
647 Ga0207707_10085348
648 Ga0207695_10001371
649 Ga0207695_10010635
650 Ga0207695_10170504
651 Ga0207695_10344067
652 Ga0207695_10448458
653 Ga0207695_10520430
654 Ga0207671_10000026
655 Ga0207671_10008618
656 Ga0207671_10271692
657 Ga0207693_10002400
658 Ga0207693_10010091
659 Ga0207663_10336188
660 Ga0207660_10303650
661 Ga0207662_10100923
662 Ga0207657_10027904
663 Ga0207657_10210929
664 Ga0207649_10558642
665 Ga0207694_10114976
666 Ga0207659_10196396
667 Ga0207687_10174074
668 Ga0207700_10437240
669 Ga0207664_10361608
670 Ga0207644_10095321
671 Ga0207706_10047063
672 Ga0207706_10466849
673 Ga0207686_11513425
674 Ga0207704_10083840
675 Ga0207665_10003249
676 Ga0207665_10017232
677 Ga0207691_10245936
678 Ga0207711_10000538
679 Ga0207711_10059125
680 Ga0207689_10024726
681 Ga0207661_10100378
682 Ga0207661_10978816
683 Ga0207679_10227376
684 Ga0207667_10000432
685 Ga0207667_10001233
686 Ga0207651_10476832
687 Ga0207712_10000301
688 Ga0207640_10000025
689 Ga0207640_10000208
690 Ga0207658_10000056
691 Ga0207658_10368431
692 Ga0207658_11394288
693 Ga0207677_10170041
694 Ga0207677_10194345
695 Ga0207677_10646811
696 Ga0207703_10029736
697 Ga0207703_10036054
698 Ga0207703_10255741
699 Ga0207703_10308858
700 Ga0207703_10683879
701 Ga0207639_10016763
702 Ga0207678_10000389
703 Ga0207678_10073514
704 Ga0207678_10149186
705 Ga0207678_11165814
706 Ga0207708_10373727
707 Ga0207702_10000740
708 Ga0207702_10049557
709 Ga0207702_10841088
710 Ga0207641_10426240
711 Ga0207641_10674314
712 Ga0207648_10034730
713 Ga0207648_10149622
714 Ga0207648_10397061
715 Ga0207676_10829741
716 Ga0207674_10000695
717 Ga0207675_100196546
718 Ga0207675_100228782
719 Ga0207683_10001886
720 Ga0207683_10512951
721 Ga0207698_11464147
722 Ga0209981_1078091
723 Ga0209999_1067243
724 Ga0209971_1026597
725 Ga0207428_10008673
726 Ga0268266_10493291
727 Ga0268264_10013866
728 Ga0268264_10036317
729 Ga0268264_10163347
730 Ga0268264_10752494
731 Ga0265332_10026980
732 Ga0307516_10000067
733 Ga0307416_101473391
734 Ga0307416_102110455
735 Ga0307507_10283216
736 Ga0373929_0112956
737 Ga0373952_0039646
738 Ga0373936_0013565
739 Ga0373939_0044601
740 Ga0373945_0134708
741 Ga0373953_0101771
742 Ga0373954_0124317
743 Ga0373954_0129632
744 Ga0373957_0061179
745 Ga0373957_0415640
746 Ga0373960_0039238
747 Ga0373943_0022072
748 Ga0373955_0020045
749 Ga0373955_0050039
750 Ga0373942_0009125
751 Ga0373961_0011535
752 Ga0373924_0007500
753 Ga0373931_0088881
754 Ga0373935_0070722
755 Ga0373935_1196413
756 Ga0373927_0016136
757 Ga0373933_0016236
758 Ga0373933_0140040
759 Ga0373933_0608754
760 Ga0373947_0015434
761 Ga0373937_0072137
762 Ga0373937_0229951
763 Ga0373925_0026048
764 Ga0373925_0990476
765 Ga0395905_0001200
766 Ga0436360_0217279
767 Ga0436363_0215343
768 Ga0436363_0475575
769 Ga0439453_0066318
770 Ga0439461_0146470
771 Ga0451800_0579666
772 Ga0439441_028661
773 Ga0439443_024284
774 Ga0439456_031087
775 Ga0439446_0086701
776 Ga0439435_0001421
777 Ga0439460_0120596
778 Ga0466969_0030676
779 Ga0466969_0154688
780 Ga0466972_0010969
781 Ga0466982_0000015
782 Ga0466964_0002674
783 Ga0466971_0006084
784 Ga0466968_0003252
785 Ga0466970_0172606
786 Ga0466970_0942895
787 Ga0466957_0056144
788 Ga0466957_0221365
789 Ga0466957_0265978
790 Ga0466960_0048892
791 Ga0466959_0468038
792 Ga0451576_0347992
793 Ga0466958_0093619
794 Ga0495592_0532414
795 Ga0495629_0284455
796 Ga0495580_0019324
797 Ga0495580_0019513
798 Ga0495580_0074360
799 Ga0495582_0274301
800 Ga0495594_0009332
801 Ga0495608_0187105
802 Ga0495618_0624424
803 Ga0495630_0624608
804 Ga0495665_0177658
805 Ga0495586_0701257
806 Ga0495587_0461325
807 Ga0495621_0072254
808 Ga0495622_0082711
809 Ga0495667_0108506
810 Ga0495646_0477619
811 Ga0495647_0303285
812 Ga0495624_0126061
813 Ga0495671_0226406
814 Ga0495581_0569196
815 Ga0495604_0125088
816 Ga0495674_0446016
817 Ga0495680_0019856
818 Ga0495686_0004347
819 Ga0495593_0205694
820 Ga0496100_0135429
821 Ga0496101_0120702
822 Ga0496102_0056347
823 Ga0496102_0119776
824 Ga0496104_0371098
825 Ga0496105_0187844
826 Ga0496106_0068273
827 Ga0496107_0253845
828 Ga0496108_0004541
829 Ga0496108_1090921
830 Ga0496109_0036912
831 Ga0496110_0013721
832 Ga0496111_0039621
833 Ga0496112_0119271
834 Ga0496112_0157878
835 Ga0496113_0412607
836 Ga0496114_0074064
837 Ga0496115_0097813
838 Ga0496118_0235633
839 Ga0496121_0029393
840 Ga0496121_0055497
841 Ga0496122_0005693
842 Ga0496123_0004026
843 Ga0496125_0000643
844 Ga0496126_0313393
845 Ga0501040_0670707
846 nmdc:mga07m45_119095_c1
847 nmdc:mga09592_177764_c1
848 nmdc:mga0qj67_319637_c1
849 nmdc:mga0qj67_375891_c1
850 nmdc:mga08y16_7124_c1
851 nmdc:mga0n895_798372_c1
852 nmdc:mga0rr50_464368_c1
853 nmdc:mga08x19_219982_c2
854 Ga0495601_0342936
855 Ga0500635_0111634
856 Ga0495595_0175930
857 Ga0500566_0223875
858 Ga0500597_000432
859 Ga0500597_158327
860 Ga0500614_085401
861 Ga0500658_0429254
862 Ga0500636_0229528
863 Ga0500637_0294121
864 Ga0466962_0005764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7703 4 114
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.7683 58 99
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7581 4 114
7qnt-assembly1.cif.gz_AAA tarm(se) native 0.7124 60 103
5jcf-assembly2.cif.gz_B crystal structure of chicken mda5 with 5'p 10-mer dsrna and adp-mg2+ at 2.6 a resolution (orthorhombic form). 0.552 59 107
ID Description Score Start End Superfamily
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8122 4 105 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7891 5 119 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.784 4 105 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7635 4 116 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7517 4 116 2.170.150.70
ID Description Score Start End GO Terms
AF-F8C8H7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9917 1 140 GO:0016846
GO:0046872
AF-A0A329VZ18-F1-model_v4 CENP-V/GFA domain-containing protein 0.9898 16 139 GO:0016846
GO:0046872
AF-A0A534AD10-F1-model_v4 CENP-V/GFA domain-containing protein 0.9866 1 111 GO:0016846
GO:0046872
AF-A0A522JPP6-F1-model_v4 CENP-V/GFA domain-containing protein 0.9855 1 142 GO:0016846
GO:0046872
AF-A0A2E5PMV7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9846 1 133 GO:0016846
GO:0046872

Map