F442669

General Info

Members Datasets Scaffolds Average Seq Length
432 218 408 593

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000019|Ga0495638_0000019_368163_370121
Length 652
Sequence MIAHPTVTTTLKELLMRTFRAAALGLLAAAVLSACVPPAAQRPSDHAPAAQHAADLLRQGQFDQAAQAYLTLAEQTSSGSDHYRLLAAEAYRQEGTLDRTAPVLAQIRRDRLVPADRVHYDLLQAELALQHHDVARALALTTQANLQVPPELAARLLELRARAMAGSNDYWGAARTRVQLDETLSGADRAQNRKQVIELLSKLGADPLKQRAMAMQPGDRMLPWINEALTQLGVAVARPQPSLGQPVGTEVAGPNANVREGYKVPQRIALLLPLSGPLASAGSSVREGFYAAYADAARNNAPRPDVRSYDTGNTPAQTVKAYQQAVSDGAQLVVGPLTRDDVAAVFAQGQLPVPVLALNHPDGQSLPPAGASEFGLLPETEGALAADHMYEGGLHRAYVLASSEDYAQRAASAFKAEFAAKGGTLVSSGAIDPATVNYAAAIRGLGASTYIDSSASTDPSASAPDAGIFISMRPQQARLLMPQLRLARLDLPVFATSHIYGGLDDAAADRDLDGVQFSDAPWLFDAQPGLPNHADITALLPAARGTSARLFAFGMDAWNLVPYLDWLHAHPGSYLPGASGQLTADQFGRVRRVLVWAKFQDGLAHPISGSLQLDDVPAQAPPDDGALSPAPASTITPPAAPLPAAASSIHGG

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2739367700 Dyella sp. YR388 Isolate Unclassified
12 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
13 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
16 2884411467 Dyella sp. AD56 Isolate Rhizosphere
17 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
18 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
19 2919085039 Luteibacter sp. 1214 Isolate Unclassified
20 2919404418 Luteibacter sp. 3190 Isolate Unclassified
21 2928963466 Dyella japonica 1073 Isolate Unclassified
22 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
23 2941471342 Luteibacter sp. 621 Isolate Unclassified
24 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
25 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
32 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
37 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
86 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
139 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 0.93
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.6
Nodule 0
Rhizoplane 2.08
Rhizosphere 59.95
Stem 0
Stem Tuber 0
Unclassified 17.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002449 3300001904 Bacteria 3281
2 JGI24740J21852_10000678 3300001979 Bacteria 14765
3 JGI24739J22299_10000934 3300001989 Bacteria 10874
4 JGI24739J22299_10011145 3300001989 Bacteria 3322
5 JGI24735J21928_10003840 3300002067 Bacteria 5086
6 JGI24735J21928_10014448 3300002067 Bacteria 2472
7 JGI25162J39368_1000355 3300002737 Bacteria 39213
8 JGI25162J39368_1000758 3300002737 Bacteria 21886
9 JGI25162J39368_1002161 3300002737 Bacteria 8194
10 JGI25157J39369_1000133 3300002741 Bacteria 62143
11 JGI25157J39369_1000213 3300002741 Bacteria 48048
12 JGI25157J39369_1000314 3300002741 Bacteria 34899
13 JGI25157J39369_1001344 3300002741 Bacteria 9709
14 JGI25163J39215_1000277 3300002771 Bacteria 18053
15 JGI25164J39214_1000075 3300002772 Bacteria 97713
16 JGI25164J39214_1000135 3300002772 Bacteria 71187
17 JGI25164J39214_1000459 3300002772 Bacteria 20918
18 JGI25164J39214_1001744 3300002772 Bacteria 4316
19 JGI25165J46597_1000057 3300003214 Bacteria 217135
20 JGI25165J46597_1000178 3300003214 Bacteria 97713
21 JGI25165J46597_1000757 3300003214 Bacteria 24811
22 rootH1_10037425 3300003316 Bacteria 4621
23 rootH2_10051054 3300003320 Bacteria 3223
24 Ga0006562J51391_1000801 3300003578 Bacteria 4140
25 Ga0006562J51391_1000804 3300003578 Bacteria 4860
26 Ga0006562J51391_1037726 3300003578 Bacteria 3290
27 Ga0006562J51391_1037727 3300003578 Bacteria 3232
28 Ga0055538_1000579 3300003751 Bacteria 12346
29 Ga0055539_1001268 3300003752 Bacteria 5019
30 Ga0055525_1000184 3300003759 Bacteria 77971
31 Ga0055527_1000094 3300003760 Bacteria 68614
32 Ga0055527_1000180 3300003760 Bacteria 42287
33 Ga0055535_1000144 3300003761 Bacteria 75043
34 Ga0055535_1000350 3300003761 Bacteria 45642
35 Ga0055535_1000421 3300003761 Bacteria 39851
36 Ga0055535_1000691 3300003761 Bacteria 25992
37 Ga0055535_1000807 3300003761 Bacteria 22701
38 Ga0055535_1001281 3300003761 Bacteria 13664
39 Ga0055542_1000312 3300003762 Bacteria 52869
40 Ga0055542_1000326 3300003762 Bacteria 50636
41 Ga0055542_1000448 3300003762 Bacteria 39213
42 Ga0055542_1000700 3300003762 Bacteria 26473
43 Ga0055542_1001094 3300003762 Bacteria 16454
44 Ga0055542_1001569 3300003762 Bacteria 10679
45 Ga0055529_1000137 3300003763 Bacteria 103695
46 Ga0055529_1000153 3300003763 Bacteria 97713
47 Ga0055529_1000434 3300003763 Bacteria 42287
48 Ga0055529_1001748 3300003763 Bacteria 5427
49 Ga0065165_1000491 3300005262 Bacteria 61051
50 Ga0070670_100101129 3300005331 Bacteria 2482
51 Ga0070666_10000022 3300005335 Bacteria 166910
52 Ga0070682_100000545 3300005337 Bacteria 23388
53 Ga0070682_100005261 3300005337 Bacteria 7199
54 Ga0070682_100033718 3300005337 Bacteria 3113
55 Ga0070660_100029613 3300005339 Bacteria 4105
56 Ga0070689_100003954 3300005340 Bacteria 9951
57 Ga0070661_100010791 3300005344 Bacteria 6361
58 Ga0070661_100010909 3300005344 Bacteria 6329
59 Ga0070661_100027370 3300005344 Bacteria 4104
60 Ga0070688_100072378 3300005365 Bacteria 2209
61 Ga0070659_100001839 3300005366 Bacteria 15239
62 Ga0070659_100021158 3300005366 Bacteria 4949
63 Ga0070667_100021237 3300005367 Bacteria 5393
64 Ga0070713_100000528 3300005436 Bacteria 24207
65 Ga0070663_100003042 3300005455 Bacteria 9581
66 Ga0070663_100076075 3300005455 Bacteria 2454
67 Ga0070681_10021703 3300005458 Bacteria 6438
68 Ga0070681_10030264 3300005458 Bacteria 5431
69 Ga0070685_10019203 3300005466 Bacteria 3685
70 Ga0070679_100022097 3300005530 Bacteria 6215
71 Ga0068853_100012298 3300005539 Bacteria 6960
72 Ga0068853_100022623 3300005539 Bacteria 5252
73 Ga0070696_100036871 3300005546 Bacteria 3373
74 Ga0070693_100043646 3300005547 Bacteria 2532
75 Ga0068855_100014402 3300005563 Bacteria 9520
76 Ga0068855_100025893 3300005563 Bacteria 7016
77 Ga0068855_100037490 3300005563 Bacteria 5764
78 Ga0068855_100212996 3300005563 Bacteria 2170
79 Ga0068857_100000919 3300005577 Bacteria 22265
80 Ga0068857_100037673 3300005577 Bacteria 4284
81 Ga0068854_100002159 3300005578 Bacteria 12073
82 Ga0068854_100009529 3300005578 Bacteria 6269
83 Ga0068854_100012119 3300005578 Bacteria 5639
84 Ga0068856_100000309 3300005614 Bacteria 53501
85 Ga0068856_100001721 3300005614 Bacteria 22879
86 Ga0068851_10014483 3300005834 Bacteria 3745
87 Ga0068860_100024366 3300005843 Bacteria 5847
88 Ga0068860_100108121 3300005843 Bacteria 2658
89 Ga0105240_10000239 3300009093 Bacteria 109259
90 Ga0105240_10005578 3300009093 Bacteria 18704
91 Ga0105240_10014827 3300009093 Bacteria 10623
92 Ga0105240_10044650 3300009093 Bacteria 5628
93 Ga0105240_10048920 3300009093 Bacteria 5341
94 Ga0105240_10089803 3300009093 Bacteria 3757
95 Ga0105247_10023678 3300009101 Bacteria 3700
96 Ga0105237_10000011 3300009545 Bacteria 307361
97 Ga0105237_10002595 3300009545 Bacteria 22292
98 Ga0105238_10000760 3300009551 Bacteria 33531
99 Ga0105238_10001027 3300009551 Bacteria 28401
100 Ga0105238_10026337 3300009551 Bacteria 5927
101 Ga0105238_10032558 3300009551 Bacteria 5305
102 Ga0105239_10000027 3300010375 Bacteria 248028
103 Ga0105239_10006774 3300010375 Bacteria 13228
104 Ga0105239_10008383 3300010375 Bacteria 11775
105 Ga0105239_10211613 3300010375 Bacteria 2173
106 Ga0157314_1000064 3300012500 Bacteria 11359
107 Ga0157373_10025461 3300013100 Bacteria 4279
108 Ga0157373_10088317 3300013100 Bacteria 2184
109 Ga0157371_10012647 3300013102 Bacteria 6439
110 Ga0157370_10000858 3300013104 Bacteria 38572
111 Ga0157370_10020057 3300013104 Bacteria 6685
112 Ga0157370_10029304 3300013104 Bacteria 5405
113 Ga0157370_10086144 3300013104 Bacteria 2952
114 Ga0157369_10000735 3300013105 Bacteria 42239
115 Ga0157369_10007761 3300013105 Bacteria 12344
116 Ga0157374_10052023 3300013296 Bacteria 3813
117 Ga0163162_10000017 3300013306 Bacteria 233474
118 Ga0163162_10000132 3300013306 Bacteria 67582
119 Ga0157372_10049995 3300013307 Bacteria 4651
120 Ga0157372_10086002 3300013307 Bacteria 3567
121 Ga0157372_10169349 3300013307 Bacteria 2527
122 Ga0163163_10063316 3300014325 Bacteria 3667
123 Ga0182008_10002428 3300014497 Bacteria 11696
124 Ga0182008_10016603 3300014497 Bacteria 3825
125 Ga0182008_10050685 3300014497 Bacteria 2060
126 Ga0182006_1000061 3300015261 Bacteria 156823
127 Ga0182006_1012391 3300015261 Bacteria 3728
128 Ga0182005_1000036 3300015265 Bacteria 166586
129 Ga0182005_1001241 3300015265 Bacteria 10544
130 Ga0182005_1011886 3300015265 Bacteria 2469
131 Ga0183369_1018 3300015685 Bacteria 117953
132 Ga0183368_1003 3300015687 Bacteria 1276390
133 Ga0163161_10004779 3300017792 Bacteria 9430
134 Ga0209760_100655 3300025207 Bacteria 5674
135 Ga0209784_100104 3300025224 Bacteria 98272
136 Ga0209674_100012 3300025226 Bacteria 950162
137 Ga0209674_100079 3300025226 Bacteria 205836
138 Ga0209674_100694 3300025226 Bacteria 11709
139 Ga0209674_100856 3300025226 Bacteria 10021
140 Ga0209672_100005 3300025228 Bacteria 1069303
141 Ga0209672_100055 3300025228 Bacteria 221655
142 Ga0209672_100270 3300025228 Bacteria 38089
143 Ga0209672_103528 3300025228 Bacteria 3204
144 Ga0209563_100045 3300025230 Bacteria 377102
145 Ga0207427_100053 3300025231 Bacteria 217191
146 Ga0207427_100070 3300025231 Bacteria 160908
147 Ga0207427_100133 3300025231 Bacteria 92763
148 Ga0207427_100410 3300025231 Bacteria 24844
149 Ga0207427_103037 3300025231 Bacteria 3849
150 Ga0209437_100005 3300025233 Bacteria 1071596
151 Ga0209437_100059 3300025233 Bacteria 355048
152 Ga0209437_100108 3300025233 Bacteria 217191
153 Ga0209437_100214 3300025233 Bacteria 107034
154 Ga0209437_100420 3300025233 Bacteria 38499
155 Ga0209437_100988 3300025233 Bacteria 9970
156 Ga0209258_100006 3300025242 Bacteria 1069303
157 Ga0209258_100055 3300025242 Bacteria 337291
158 Ga0209258_100135 3300025242 Bacteria 170832
159 Ga0209258_100152 3300025242 Bacteria 160154
160 Ga0209258_100494 3300025242 Bacteria 39474
161 Ga0209258_100636 3300025242 Bacteria 27598
162 Ga0209646_1001599 3300025246 Bacteria 5853
163 Ga0209026_1000017 3300025250 Bacteria 385214
164 Ga0209026_1000055 3300025250 Bacteria 237197
165 Ga0209026_1000176 3300025250 Bacteria 97745
166 Ga0209026_1000319 3300025250 Bacteria 51342
167 Ga0209026_1001004 3300025250 Bacteria 13952
168 Ga0209677_101939 3300025253 Bacteria 8272
169 Ga0209148_1000001 3300025254 Bacteria 2545271
170 Ga0209148_1000002 3300025254 Bacteria 2399500
171 Ga0209148_1000012 3300025254 Bacteria 1069303
172 Ga0209148_1000014 3300025254 Bacteria 925277
173 Ga0209148_1000058 3300025254 Bacteria 357482
174 Ga0209148_1000102 3300025254 Bacteria 216658
175 Ga0209148_1002252 3300025254 Bacteria 7005
176 Ga0209759_1000159 3300025256 Bacteria 116456
177 Ga0209759_1000267 3300025256 Bacteria 74733
178 Ga0209759_1000333 3300025256 Bacteria 62095
179 Ga0209759_1000386 3300025256 Bacteria 55050
180 Ga0209759_1003374 3300025256 Bacteria 6409
181 Ga0209129_1001030 3300025258 Bacteria 16563
182 Ga0209233_1000002 3300025261 Bacteria 2501366
183 Ga0209233_1000011 3300025261 Bacteria 1071611
184 Ga0209233_1000125 3300025261 Bacteria 217190
185 Ga0209233_1000273 3300025261 Bacteria 73280
186 Ga0209233_1007538 3300025261 Bacteria 3439
187 Ga0209455_1000008 3300025272 Bacteria 1069303
188 Ga0209455_1000014 3300025272 Bacteria 806601
189 Ga0209455_1000018 3300025272 Bacteria 718034
190 Ga0209455_1000019 3300025272 Bacteria 705658
191 Ga0209455_1000297 3300025272 Bacteria 51750
192 Ga0209455_1005964 3300025272 Bacteria 3669
193 Ga0209758_1000791 3300025297 Bacteria 45103
194 Ga0209758_1011221 3300025297 Bacteria 5224
195 Ga0209256_1005994 3300025299 Bacteria 6668
196 Ga0207656_10012697 3300025321 Bacteria 3207
197 Ga0207710_10031248 3300025900 Bacteria 2328
198 Ga0207680_10000001 3300025903 Bacteria 1091453
199 Ga0207647_10000020 3300025904 Bacteria 123888
200 Ga0207647_10005346 3300025904 Bacteria 9440
201 Ga0207647_10013042 3300025904 Bacteria 5775
202 Ga0207707_10015474 3300025912 Bacteria 6645
203 Ga0207695_10000082 3300025913 Bacteria 284333
204 Ga0207695_10000966 3300025913 Bacteria 51258
205 Ga0207695_10001405 3300025913 Bacteria 40582
206 Ga0207695_10005938 3300025913 Bacteria 15997
207 Ga0207695_10009237 3300025913 Bacteria 12219
208 Ga0207671_10000011 3300025914 Bacteria 530349
209 Ga0207671_10000359 3300025914 Bacteria 64927
210 Ga0207657_10037121 3300025919 Bacteria 4356
211 Ga0207694_10000200 3300025924 Bacteria 59994
212 Ga0207694_10000412 3300025924 Bacteria 39847
213 Ga0207650_10038687 3300025925 Bacteria 3485
214 Ga0207664_10000090 3300025929 Bacteria 84944
215 Ga0207690_10011842 3300025932 Bacteria 5216
216 Ga0207690_10082986 3300025932 Bacteria 2242
217 Ga0207670_10001106 3300025936 Bacteria 14192
218 Ga0207667_10005660 3300025949 Bacteria 15236
219 Ga0207667_10005765 3300025949 Bacteria 15112
220 Ga0207667_10010445 3300025949 Bacteria 10850
221 Ga0207640_10002357 3300025981 Bacteria 10129
222 Ga0207640_10005186 3300025981 Bacteria 7087
223 Ga0207640_10034050 3300025981 Bacteria 3176
224 Ga0207640_10064918 3300025981 Bacteria 2433
225 Ga0207658_10016086 3300025986 Bacteria 5139
226 Ga0207639_10026650 3300026041 Bacteria 4200
227 Ga0207678_10002215 3300026067 Bacteria 17557
228 Ga0207678_10025131 3300026067 Bacteria 5200
229 Ga0207678_10026512 3300026067 Bacteria 5055
230 Ga0207702_10000107 3300026078 Bacteria 96024
231 Ga0207702_10005749 3300026078 Bacteria 10799
232 Ga0207674_10000146 3300026116 Bacteria 82851
233 Ga0207674_10019170 3300026116 Bacteria 7417
234 Ga0268266_10000075 3300028379 Bacteria 218045
235 Ga0268264_10084556 3300028381 Bacteria 2721
236 Ga0307412_10000319 3300031911 Bacteria 30279
237 Ga0307510_10026778 3300033180 Bacteria 6618
238 Ga0395899_0000081 3300037312 Bacteria 169527
239 Ga0395899_0036345 3300037312 Bacteria 3695
240 Ga0395899_0066522 3300037312 Bacteria 2646
241 Ga0395900_0000024 3300037418 Bacteria 323480
242 Ga0395900_0007161 3300037418 Bacteria 11558
243 Ga0395900_0013304 3300037418 Bacteria 8411
244 Ga0395900_0056354 3300037418 Bacteria 4045
245 Ga0395898_0000044 3300037466 Bacteria 298164
246 Ga0395898_0000132 3300037466 Bacteria 192211
247 Ga0395898_0001869 3300037466 Bacteria 26933
248 Ga0395901_0005354 3300038443 Bacteria 12970
249 Ga0395901_0022062 3300038443 Bacteria 6526
250 Ga0395901_0106960 3300038443 Bacteria 2936
251 Ga0439436_0000021 3300041404 Bacteria 62628
252 Ga0439465_0000191 3300041413 Bacteria 15984
253 Ga0451793_0083499 3300041452 Bacteria 5887
254 Ga0451837_1353030 3300041494 Bacteria 2960
255 Ga0450908_000016 3300042184 Bacteria 40435
256 Ga0439459_0002557 3300042438 Bacteria 2819
257 Ga0466969_0002891 3300044656 Bacteria 9163
258 Ga0466969_0005770 3300044656 Bacteria 6578
259 Ga0466969_0016797 3300044656 Bacteria 3827
260 Ga0466982_0000012 3300044672 Bacteria 166823
261 Ga0466982_0000039 3300044672 Bacteria 41244
262 Ga0466965_0008825 3300044683 Bacteria 4675
263 Ga0466961_0005685 3300044693 Bacteria 7885
264 Ga0466961_0018469 3300044693 Bacteria 4485
265 Ga0466961_0023952 3300044693 Bacteria 3927
266 Ga0466961_0029948 3300044693 Bacteria 3497
267 Ga0466961_0042718 3300044693 Bacteria 2905
268 Ga0466971_0002536 3300044719 Bacteria 7724
269 Ga0466968_0000390 3300044735 Bacteria 14422
270 Ga0466970_0008937 3300044765 Bacteria 5052
271 Ga0466957_0003289 3300044842 Bacteria 8850
272 Ga0466957_0015402 3300044842 Bacteria 4466
273 Ga0466959_0006402 3300045049 Bacteria 8150
274 Ga0466958_0014726 3300045836 Bacteria 4467
275 Ga0466958_0065214 3300045836 Bacteria 2222
276 Ga0466967_0101399 3300045976 Bacteria 2631
277 Ga0466967_0112182 3300045976 Bacteria 2507
278 Ga0495617_000268 3300046452 Bacteria 30080
279 Ga0495617_000654 3300046452 Bacteria 17386
280 Ga0495638_0000019 3300046460 Bacteria 384671
281 Ga0495638_0000148 3300046460 Bacteria 110710
282 Ga0495638_0000164 3300046460 Bacteria 103139
283 Ga0495638_0002260 3300046460 Bacteria 15961
284 Ga0495638_0059261 3300046460 Bacteria 2371
285 Ga0495650_0000338 3300046471 Bacteria 83352
286 Ga0495650_0000498 3300046471 Bacteria 59590
287 Ga0495650_0000615 3300046471 Bacteria 48361
288 Ga0495650_0013895 3300046471 Bacteria 4228
289 Ga0495584_0004271 3300046491 Bacteria 7701
290 Ga0495585_0000007 3300046492 Bacteria 288113
291 Ga0495585_0000594 3300046492 Bacteria 33909
292 Ga0495607_0000029 3300046501 Bacteria 155005
293 Ga0495607_0000100 3300046501 Bacteria 91570
294 Ga0495607_0014023 3300046501 Bacteria 5233
295 Ga0495606_0000351 3300046507 Bacteria 78808
296 Ga0495606_0000427 3300046507 Bacteria 70054
297 Ga0495606_0001115 3300046507 Bacteria 38368
298 Ga0495606_0010129 3300046507 Bacteria 7868
299 Ga0495610_0000671 3300046512 Bacteria 33278
300 Ga0495616_0000793 3300046513 Bacteria 23126
301 Ga0495620_0000090 3300046515 Bacteria 73605
302 Ga0495631_0001043 3300046518 Bacteria 17180
303 Ga0495632_0000010 3300046519 Bacteria 272360
304 Ga0495632_0006875 3300046519 Bacteria 7241
305 Ga0495643_0010699 3300046522 Bacteria 5637
306 Ga0495648_0002437 3300046524 Bacteria 17223
307 Ga0495668_0005845 3300046616 Bacteria 8213
308 Ga0495611_0000003 3300046648 Bacteria 395679
309 Ga0495611_0000018 3300046648 Bacteria 126654
310 Ga0495625_0000019 3300046660 Bacteria 298330
311 Ga0495625_0024870 3300046660 Bacteria 4548
312 Ga0495625_0048424 3300046660 Bacteria 3060
313 Ga0495661_0014491 3300046665 Bacteria 5280
314 Ga0495670_0005611 3300046691 Bacteria 6155
315 Ga0495670_0014969 3300046691 Bacteria 3817
316 Ga0495670_0021475 3300046691 Bacteria 3184
317 Ga0495671_0015974 3300046692 Bacteria 4017
318 Ga0495649_0001556 3300046694 Bacteria 17215
319 Ga0495649_0006507 3300046694 Bacteria 7269
320 Ga0495589_0000018 3300046794 Bacteria 204851
321 Ga0495660_0000164 3300046810 Bacteria 71324
322 Ga0495660_0000223 3300046810 Bacteria 56336
323 Ga0495683_0001417 3300047323 Bacteria 15814
324 Ga0495679_000017 3300047446 Bacteria 263230
325 Ga0495673_0000004 3300047469 Bacteria 1354526
326 Ga0495673_0000133 3300047469 Bacteria 137275
327 Ga0495673_0019181 3300047469 Bacteria 3430
328 Ga0495686_0000126 3300047472 Bacteria 157350
329 Ga0495686_0000527 3300047472 Bacteria 55036
330 Ga0495686_0007116 3300047472 Bacteria 8430
331 Ga0496100_0024083 3300048903 Bacteria 3708
332 Ga0496101_0000877 3300048904 Bacteria 17755
333 Ga0496104_0050245 3300048907 Bacteria 3935
334 Ga0496104_0069351 3300048907 Bacteria 3351
335 Ga0496105_0001031 3300048908 Bacteria 19253
336 Ga0496106_0001986 3300048909 Bacteria 15386
337 Ga0496115_0000238 3300048918 Bacteria 50050
338 Ga0496115_0001361 3300048918 Bacteria 17442
339 Ga0496117_0007041 3300048920 Bacteria 11126
340 Ga0496117_0088927 3300048920 Bacteria 1996
341 Ga0496118_0000973 3300048921 Bacteria 44701
342 Ga0496118_0005697 3300048921 Bacteria 14029
343 Ga0496118_0007314 3300048921 Bacteria 11745
344 Ga0496118_0013356 3300048921 Bacteria 7773
345 Ga0496119_0000322 3300048922 Bacteria 67165
346 Ga0496119_0022606 3300048922 Bacteria 4493
347 Ga0496120_0000143 3300048923 Bacteria 120051
348 Ga0496120_0000665 3300048923 Bacteria 50530
349 Ga0496121_0000108 3300048924 Bacteria 188757
350 Ga0496121_0000633 3300048924 Bacteria 65667
351 Ga0496121_0000938 3300048924 Bacteria 52758
352 Ga0496121_0005215 3300048924 Bacteria 16837
353 Ga0496121_0008205 3300048924 Bacteria 12385
354 Ga0496121_0013757 3300048924 Bacteria 8664
355 Ga0496121_0131372 3300048924 Bacteria 1873
356 Ga0496122_0016821 3300048925 Bacteria 6885
357 Ga0496122_0039071 3300048925 Bacteria 3790
358 Ga0496122_0044873 3300048925 Bacteria 3444
359 Ga0496122_0052136 3300048925 Bacteria 3101
360 Ga0496123_0010810 3300048926 Bacteria 8008
361 Ga0496123_0050698 3300048926 Bacteria 2771
362 Ga0496124_0000245 3300048927 Bacteria 104910
363 Ga0496124_0001259 3300048927 Bacteria 38660
364 Ga0496125_0000469 3300048928 Bacteria 72128
365 Ga0496125_0056325 3300048928 Bacteria 3193
366 Ga0496126_0005757 3300048929 Bacteria 14019
367 Ga0496126_0015409 3300048929 Bacteria 7691
368 Ga0496126_0051992 3300048929 Bacteria 3727
369 Ga0495678_000152 3300049459 Bacteria 83891
370 Ga0495682_0009407 3300049460 Bacteria 3814
371 Ga0501033_0002131 3300049570 Bacteria 17126
372 Ga0501033_0003284 3300049570 Bacteria 13373
373 Ga0501033_0017746 3300049570 Bacteria 5375
374 Ga0501034_0018960 3300049571 Bacteria 7049
375 Ga0501036_0015260 3300049572 Bacteria 6414
376 Ga0501036_0043021 3300049572 Bacteria 3824
377 Ga0501037_0047906 3300049573 Bacteria 3132
378 Ga0501037_0063406 3300049573 Bacteria 2694
379 Ga0501038_0067202 3300049574 Bacteria 3050
380 Ga0501043_0023957 3300049579 Bacteria 4789
381 Ga0501046_0059345 3300049580 Bacteria 2997
382 Ga0501047_0035308 3300049581 Bacteria 4830
383 Ga0501047_0041731 3300049581 Bacteria 4432
384 Ga0501047_0061589 3300049581 Bacteria 3620
385 Ga0501048_0014497 3300049582 Bacteria 5836
386 Ga0501069_0000354 3300049585 Bacteria 20610
387 Ga0501069_0023103 3300049585 Bacteria 3388
388 Ga0501070_0006644 3300049586 Bacteria 9847
389 Ga0501070_0056486 3300049586 Bacteria 3254
390 Ga0501070_0082917 3300049586 Bacteria 2654
391 Ga0501070_0086741 3300049586 Bacteria 2591
392 Ga0501070_0111782 3300049586 Bacteria 2258
393 Ga0501071_0024789 3300049587 Bacteria 4196
394 Ga0501072_0052691 3300049588 Bacteria 3203
395 Ga0501080_0015673 3300049742 Bacteria 6989
396 Ga0501035_0052480 3300049822 Bacteria 3648
397 Ga0501035_0073673 3300049822 Bacteria 3021
398 Ga0501044_0025855 3300049823 Bacteria 6223
399 Ga0501044_0037069 3300049823 Bacteria 5098
400 Ga0501044_0064651 3300049823 Bacteria 3734
401 Ga0501045_0020029 3300049824 Bacteria 4776
402 Ga0500643_000029 3300053087 Bacteria 211149
403 Ga0500651_0000352 3300053093 Bacteria 25798
404 Ga0500555_000934 3300053103 Bacteria 10221
405 Ga0500633_0002029 3300053160 Bacteria 4045
406 Ga0500645_000316 3300053730 Bacteria 34428
407 Ga0466962_0003050 3300061719 Bacteria 7985
408 Ga0466962_0007632 3300061719 Bacteria 5185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_1353030 Ga0451837_1353030_34_1836 507
2 3300044693 Ga0466961_0042718 Ga0466961_0042718_1192_2877 524
3 3300014497 Ga0182008_10016603 Ga0182008_100166031 529
4 3300042438 Ga0439459_0002557 Ga0439459_0002557_173_2131 529
5 3300048924 Ga0496121_0131372 Ga0496121_0131372_22_1659 529
6 3300049579 Ga0501043_0023957 Ga0501043_0023957_2337_4271 532
7 3300005436 Ga0070713_100000528 Ga0070713_10000052819 534
8 3300002741 JGI25157J39369_1000314 JGI25157J39369_100031417 535
9 3300025226 Ga0209674_100856 Ga0209674_1008563 535
10 3300025250 Ga0209026_1000017 Ga0209026_1000017215 535
11 3300002737 JGI25162J39368_1000758 JGI25162J39368_10007583 536
12 3300002772 JGI25164J39214_1000459 JGI25164J39214_100045914 536
13 3300003214 JGI25165J46597_1000757 JGI25165J46597_100075719 536
14 3300025228 Ga0209672_100005 Ga0209672_10000597 536
15 3300025230 Ga0209563_100045 Ga0209563_100045214 536
16 3300025231 Ga0207427_100410 Ga0207427_1004102 536
17 3300025233 Ga0209437_100420 Ga0209437_1004202 536
18 3300025242 Ga0209258_100006 Ga0209258_10000697 536
19 3300025254 Ga0209148_1000012 Ga0209148_100001297 536
20 3300025261 Ga0209233_1000273 Ga0209233_10002732 536
21 3300025272 Ga0209455_1000008 Ga0209455_100000897 536
22 3300025932 Ga0207690_10082986 Ga0207690_100829862 538
23 3300044656 Ga0466969_0005770 Ga0466969_0005770_4481_6307 538
24 3300044693 Ga0466961_0023952 Ga0466961_0023952_1801_3627 538
25 3300045049 Ga0466959_0006402 Ga0466959_0006402_168_1994 538
26 3300002741 JGI25157J39369_1000213 JGI25157J39369_100021313 539
27 3300025250 Ga0209026_1000055 Ga0209026_100005580 539
28 3300025256 Ga0209759_1000267 Ga0209759_100026724 539
29 3300037312 Ga0395899_0000081 Ga0395899_0000081_24130_25971 539
30 3300037418 Ga0395900_0000024 Ga0395900_0000024_133837_135678 539
31 3300037466 Ga0395898_0000044 Ga0395898_0000044_152293_154134 539
32 3300044693 Ga0466961_0005685 Ga0466961_0005685_4722_6647 539
33 3300003760 Ga0055527_1000180 Ga0055527_100018017 540
34 3300003761 Ga0055535_1000691 Ga0055535_100069124 540
35 3300003761 Ga0055535_1000807 Ga0055535_10008076 540
36 3300003762 Ga0055542_1000326 Ga0055542_100032629 540
37 3300003763 Ga0055529_1000434 Ga0055529_100043425 540
38 3300005331 Ga0070670_100101129 Ga0070670_1001011292 540
39 3300005614 Ga0068856_100001721 Ga0068856_1000017212 540
40 3300010375 Ga0105239_10008383 Ga0105239_100083832 540
41 3300025226 Ga0209674_100079 Ga0209674_10007965 540
42 3300025228 Ga0209672_100055 Ga0209672_10005529 540
43 3300025242 Ga0209258_100152 Ga0209258_100152107 540
44 3300025253 Ga0209677_101939 Ga0209677_1019394 540
45 3300025254 Ga0209148_1000014 Ga0209148_1000014679 540
46 3300025272 Ga0209455_1000014 Ga0209455_1000014567 540
47 3300025925 Ga0207650_10038687 Ga0207650_100386872 540
48 3300026078 Ga0207702_10005749 Ga0207702_100057492 540
49 3300044656 Ga0466969_0016797 Ga0466969_0016797_348_2273 540
50 3300044765 Ga0466970_0008937 Ga0466970_0008937_1239_3164 540
51 3300044842 Ga0466957_0003289 Ga0466957_0003289_2363_4288 540
52 3300048925 Ga0496122_0039071 Ga0496122_0039071_1109_2911 540
53 3300048926 Ga0496123_0010810 Ga0496123_0010810_930_2732 540
54 3300002741 JGI25157J39369_1001344 JGI25157J39369_10013448 541
55 3300003762 Ga0055542_1001569 Ga0055542_10015693 541
56 3300003763 Ga0055529_1000137 Ga0055529_100013774 541
57 3300025228 Ga0209672_100270 Ga0209672_10027025 541
58 3300025242 Ga0209258_100055 Ga0209258_100055147 541
59 3300025250 Ga0209026_1001004 Ga0209026_10010048 541
60 3300025254 Ga0209148_1000058 Ga0209148_1000058124 541
61 3300025256 Ga0209759_1000159 Ga0209759_100015918 541
62 3300025256 Ga0209759_1000386 Ga0209759_10003868 541
63 3300025272 Ga0209455_1000018 Ga0209455_1000018124 541
64 3300048927 Ga0496124_0001259 Ga0496124_0001259_30921_32789 541
65 3300003752 Ga0055539_1001268 Ga0055539_10012681 542
66 3300005337 Ga0070682_100005261 Ga0070682_1000052612 542
67 3300005366 Ga0070659_100021158 Ga0070659_1000211584 542
68 3300005563 Ga0068855_100014402 Ga0068855_1000144028 542
69 3300013104 Ga0157370_10086144 Ga0157370_100861442 542
70 3300013307 Ga0157372_10169349 Ga0157372_101693493 542
71 3300005339 Ga0070660_100029613 Ga0070660_1000296131 544
72 3300005539 Ga0068853_100022623 Ga0068853_1000226235 544
73 3300013104 Ga0157370_10029304 Ga0157370_100293044 544
74 3300026041 Ga0207639_10026650 Ga0207639_100266503 544
75 3300005335 Ga0070666_10000022 Ga0070666_1000002258 545
76 3300005367 Ga0070667_100021237 Ga0070667_1000212372 545
77 3300005843 Ga0068860_100108121 Ga0068860_1001081213 545
78 3300013306 Ga0163162_10000132 Ga0163162_1000013220 545
79 3300025903 Ga0207680_10000001 Ga0207680_10000001464 545
80 3300025986 Ga0207658_10016086 Ga0207658_100160863 545
81 3300028379 Ga0268266_10000075 Ga0268266_10000075191 545
82 3300028381 Ga0268264_10084556 Ga0268264_100845563 545
83 3300048929 Ga0496126_0015409 Ga0496126_0015409_951_2750 545
84 3300013102 Ga0157371_10012647 Ga0157371_100126471 547
85 3300044656 Ga0466969_0002891 Ga0466969_0002891_6867_8768 547
86 3300049823 Ga0501044_0037069 Ga0501044_0037069_1249_3093 547
87 3300013100 Ga0157373_10025461 Ga0157373_100254613 548
88 3300010375 Ga0105239_10211613 Ga0105239_102116132 549
89 3300013104 Ga0157370_10000858 Ga0157370_100008586 549
90 3300013296 Ga0157374_10052023 Ga0157374_100520233 549
91 3300013306 Ga0163162_10000017 Ga0163162_10000017124 549
92 3300014325 Ga0163163_10063316 Ga0163163_100633163 549
93 3300015265 Ga0182005_1000036 Ga0182005_100003617 549
94 3300025981 Ga0207640_10064918 Ga0207640_100649182 549
95 3300003759 Ga0055525_1000184 Ga0055525_100018441 550
96 3300003760 Ga0055527_1000094 Ga0055527_100009445 550
97 3300003761 Ga0055535_1000421 Ga0055535_100042117 550
98 3300003762 Ga0055542_1000312 Ga0055542_100031217 550
99 3300003763 Ga0055529_1001748 Ga0055529_10017485 550
100 3300044672 Ga0466982_0000012 Ga0466982_0000012_101757_103568 550
101 3300044693 Ga0466961_0029948 Ga0466961_0029948_1355_3166 550
102 3300044719 Ga0466971_0002536 Ga0466971_0002536_4387_6198 550
103 3300046501 Ga0495607_0014023 Ga0495607_0014023_2022_3890 550
104 3300049570 Ga0501033_0002131 Ga0501033_0002131_3170_5239 550
105 3300049572 Ga0501036_0043021 Ga0501036_0043021_867_2936 550
106 3300049582 Ga0501048_0014497 Ga0501048_0014497_727_2796 550
107 3300061719 Ga0466962_0007632 Ga0466962_0007632_330_2141 550
108 3300013100 Ga0157373_10088317 Ga0157373_100883171 551
109 3300049580 Ga0501046_0059345 Ga0501046_0059345_109_2070 551
110 3300049581 Ga0501047_0035308 Ga0501047_0035308_671_2713 551
111 3300015685 Ga0183369_1018 Ga0183369_101860 552
112 3300025231 Ga0207427_100133 Ga0207427_10013377 552
113 3300025233 Ga0209437_100005 Ga0209437_100005649 552
114 3300025261 Ga0209233_1000011 Ga0209233_1000011293 552
115 3300037418 Ga0395900_0007161 Ga0395900_0007161_9518_11491 552
116 3300037466 Ga0395898_0001869 Ga0395898_0001869_1966_3939 552
117 3300038443 Ga0395901_0005354 Ga0395901_0005354_9448_11385 552
118 3300038443 Ga0395901_0022062 Ga0395901_0022062_1634_3607 552
119 3300045836 Ga0466958_0014726 Ga0466958_0014726_1789_3690 552
120 3300049585 Ga0501069_0023103 Ga0501069_0023103_945_2720 552
121 3300049586 Ga0501070_0006644 Ga0501070_0006644_2011_3786 552
122 3300049742 Ga0501080_0015673 Ga0501080_0015673_1997_3772 552
123 3300049822 Ga0501035_0073673 Ga0501035_0073673_536_2572 554
124 3300053093 Ga0500651_0000352 Ga0500651_0000352_17958_19748 554
125 3300005337 Ga0070682_100000545 Ga0070682_10000054517 555
126 3300005366 Ga0070659_100001839 Ga0070659_1000018398 555
127 3300005458 Ga0070681_10021703 Ga0070681_100217035 555
128 3300005458 Ga0070681_10030264 Ga0070681_100302642 555
129 3300005546 Ga0070696_100036871 Ga0070696_1000368712 555
130 3300005547 Ga0070693_100043646 Ga0070693_1000436463 555
131 3300005577 Ga0068857_100037673 Ga0068857_1000376733 555
132 3300009101 Ga0105247_10023678 Ga0105247_100236784 555
133 3300025900 Ga0207710_10031248 Ga0207710_100312482 555
134 3300026116 Ga0207674_10019170 Ga0207674_100191702 555
135 3300044693 Ga0466961_0018469 Ga0466961_0018469_2015_3904 555
136 3300005344 Ga0070661_100010909 Ga0070661_1000109094 556
137 3300005539 Ga0068853_100012298 Ga0068853_1000122982 556
138 3300005563 Ga0068855_100212996 Ga0068855_1002129961 556
139 3300025912 Ga0207707_10015474 Ga0207707_100154744 556
140 3300025919 Ga0207657_10037121 Ga0207657_100371212 556
141 3300025929 Ga0207664_10000090 Ga0207664_1000009074 556
142 3300025932 Ga0207690_10011842 Ga0207690_100118424 556
143 3300025949 Ga0207667_10010445 Ga0207667_100104455 556
144 3300037418 Ga0395900_0013304 Ga0395900_0013304_5325_7304 556
145 3300037418 Ga0395900_0056354 Ga0395900_0056354_941_2899 556
146 3300048920 Ga0496117_0007041 Ga0496117_0007041_3741_5594 556
147 3300048921 Ga0496118_0000973 Ga0496118_0000973_1207_3060 556
148 3300013307 Ga0157372_10086002 Ga0157372_100860023 557
149 3300045976 Ga0466967_0112182 Ga0466967_0112182_699_2492 557
150 3300005466 Ga0070685_10019203 Ga0070685_100192033 558
151 3300005530 Ga0070679_100022097 Ga0070679_1000220973 558
152 3300009093 Ga0105240_10000239 Ga0105240_100002393 558
153 3300009551 Ga0105238_10000760 Ga0105238_1000076026 558
154 3300025261 Ga0209233_1007538 Ga0209233_10075382 558
155 3300025913 Ga0207695_10000082 Ga0207695_10000082150 558
156 3300025924 Ga0207694_10000412 Ga0207694_1000041210 558
157 3300048921 Ga0496118_0007314 Ga0496118_0007314_8705_10540 558
158 3300049572 Ga0501036_0015260 Ga0501036_0015260_3292_5208 558
159 3300049587 Ga0501071_0024789 Ga0501071_0024789_119_1930 559
160 3300049588 Ga0501072_0052691 Ga0501072_0052691_561_2372 559
161 3300049824 Ga0501045_0020029 Ga0501045_0020029_1285_3096 559
162 3300002737 JGI25162J39368_1000355 JGI25162J39368_10003556 560
163 3300002741 JGI25157J39369_1000133 JGI25157J39369_100013326 560
164 3300002771 JGI25163J39215_1000277 JGI25163J39215_100027718 560
165 3300002772 JGI25164J39214_1000075 JGI25164J39214_100007566 560
166 3300002772 JGI25164J39214_1000135 JGI25164J39214_100013520 560
167 3300003214 JGI25165J46597_1000057 JGI25165J46597_1000057166 560
168 3300003214 JGI25165J46597_1000178 JGI25165J46597_100017826 560
169 3300003751 Ga0055538_1000579 Ga0055538_10005792 560
170 3300003761 Ga0055535_1000144 Ga0055535_10001443 560
171 3300003761 Ga0055535_1000350 Ga0055535_100035026 560
172 3300003762 Ga0055542_1000448 Ga0055542_10004486 560
173 3300003763 Ga0055529_1000153 Ga0055529_100015326 560
174 3300025207 Ga0209760_100655 Ga0209760_1006553 560
175 3300025224 Ga0209784_100104 Ga0209784_10010465 560
176 3300025231 Ga0207427_100053 Ga0207427_10005320 560
177 3300025231 Ga0207427_100070 Ga0207427_10007022 560
178 3300025233 Ga0209437_100059 Ga0209437_10005980 560
179 3300025233 Ga0209437_100108 Ga0209437_100108163 560
180 3300025242 Ga0209258_100494 Ga0209258_1004943 560
181 3300025246 Ga0209646_1001599 Ga0209646_10015993 560
182 3300025250 Ga0209026_1000176 Ga0209026_100017622 560
183 3300025254 Ga0209148_1000001 Ga0209148_1000001737 560
184 3300025256 Ga0209759_1000333 Ga0209759_100033322 560
185 3300025261 Ga0209233_1000002 Ga0209233_10000021494 560
186 3300025261 Ga0209233_1000125 Ga0209233_100012520 560
187 3300025272 Ga0209455_1000019 Ga0209455_100001965 560
188 3300047472 Ga0495686_0000527 Ga0495686_0000527_51953_53812 560
189 3300048907 Ga0496104_0050245 Ga0496104_0050245_179_2032 560
190 3300048908 Ga0496105_0001031 Ga0496105_0001031_134_1987 560
191 3300048922 Ga0496119_0000322 Ga0496119_0000322_23609_25462 560
192 3300048923 Ga0496120_0000143 Ga0496120_0000143_196_2049 560
193 3300049571 Ga0501034_0018960 Ga0501034_0018960_4871_6787 560
194 3300049573 Ga0501037_0047906 Ga0501037_0047906_1197_3113 560
195 3300049586 Ga0501070_0086741 Ga0501070_0086741_331_2247 560
196 3300049823 Ga0501044_0064651 Ga0501044_0064651_1262_3178 560
197 3300025226 Ga0209674_100694 Ga0209674_1006944 561
198 3300025233 Ga0209437_100988 Ga0209437_1009887 561
199 3300025254 Ga0209148_1002252 Ga0209148_10022522 561
200 3300049570 Ga0501033_0003284 Ga0501033_0003284_3551_5593 561
201 3300002772 JGI25164J39214_1001744 JGI25164J39214_10017444 562
202 3300009093 Ga0105240_10048920 Ga0105240_100489203 562
203 3300010375 Ga0105239_10000027 Ga0105239_10000027208 562
204 3300025913 Ga0207695_10001405 Ga0207695_1000140520 562
205 3300048924 Ga0496121_0000938 Ga0496121_0000938_39417_41267 562
206 3300009093 Ga0105240_10044650 Ga0105240_100446504 564
207 3300005578 Ga0068854_100009529 Ga0068854_1000095292 565
208 3300025258 Ga0209129_1001030 Ga0209129_100103013 565
209 3300025297 Ga0209758_1011221 Ga0209758_10112212 565
210 3300025981 Ga0207640_10034050 Ga0207640_100340501 565
211 3300026067 Ga0207678_10002215 Ga0207678_100022159 565
212 3300049585 Ga0501069_0000354 Ga0501069_0000354_15675_17606 565
213 3300049586 Ga0501070_0111782 Ga0501070_0111782_202_2004 565
214 3300005344 Ga0070661_100010791 Ga0070661_1000107915 566
215 3300005563 Ga0068855_100025893 Ga0068855_1000258936 566
216 3300009093 Ga0105240_10005578 Ga0105240_1000557818 566
217 3300009545 Ga0105237_10002595 Ga0105237_100025952 566
218 3300009551 Ga0105238_10001027 Ga0105238_100010279 566
219 3300009551 Ga0105238_10026337 Ga0105238_100263375 566
220 3300025299 Ga0209256_1005994 Ga0209256_10059944 566
221 3300025913 Ga0207695_10005938 Ga0207695_100059389 566
222 3300025914 Ga0207671_10000359 Ga0207671_1000035938 566
223 3300025924 Ga0207694_10000200 Ga0207694_1000020015 566
224 3300037312 Ga0395899_0036345 Ga0395899_0036345_1179_3047 566
225 3300037466 Ga0395898_0000132 Ga0395898_0000132_133335_135182 566
226 3300046471 Ga0495650_0000338 Ga0495650_0000338_62194_63993 566
227 3300001979 JGI24740J21852_10000678 JGI24740J21852_100006787 567
228 3300001989 JGI24739J22299_10000934 JGI24739J22299_100009349 567
229 3300002067 JGI24735J21928_10014448 JGI24735J21928_100144482 567
230 3300003578 Ga0006562J51391_1000801 Ga0006562J51391_10008012 567
231 3300003578 Ga0006562J51391_1000804 Ga0006562J51391_10008041 567
232 3300003761 Ga0055535_1001281 Ga0055535_100128112 567
233 3300003762 Ga0055542_1000700 Ga0055542_10007003 567
234 3300005455 Ga0070663_100003042 Ga0070663_1000030422 567
235 3300005577 Ga0068857_100000919 Ga0068857_1000009194 567
236 3300005578 Ga0068854_100002159 Ga0068854_10000215911 567
237 3300005834 Ga0068851_10014483 Ga0068851_100144832 567
238 3300009093 Ga0105240_10014827 Ga0105240_1001482711 567
239 3300009545 Ga0105237_10000011 Ga0105237_10000011235 567
240 3300010375 Ga0105239_10006774 Ga0105239_1000677411 567
241 3300012500 Ga0157314_1000064 Ga0157314_10000645 567
242 3300015261 Ga0182006_1012391 Ga0182006_10123912 567
243 3300025228 Ga0209672_103528 Ga0209672_1035282 567
244 3300025242 Ga0209258_100135 Ga0209258_10013533 567
245 3300025254 Ga0209148_1000102 Ga0209148_100010233 567
246 3300025272 Ga0209455_1000297 Ga0209455_100029718 567
247 3300025272 Ga0209455_1005964 Ga0209455_10059643 567
248 3300025297 Ga0209758_1000791 Ga0209758_10007919 567
249 3300025321 Ga0207656_10012697 Ga0207656_100126973 567
250 3300025904 Ga0207647_10005346 Ga0207647_100053465 567
251 3300025913 Ga0207695_10000966 Ga0207695_1000096642 567
252 3300025914 Ga0207671_10000011 Ga0207671_10000011233 567
253 3300025949 Ga0207667_10005660 Ga0207667_1000566011 567
254 3300025981 Ga0207640_10005186 Ga0207640_100051867 567
255 3300026067 Ga0207678_10026512 Ga0207678_100265122 567
256 3300026116 Ga0207674_10000146 Ga0207674_1000014642 567
257 3300031911 Ga0307412_10000319 Ga0307412_100003195 567
258 3300033180 Ga0307510_10026778 Ga0307510_100267782 567
259 3300041404 Ga0439436_0000021 Ga0439436_0000021_36669_38468 567
260 3300041413 Ga0439465_0000191 Ga0439465_0000191_10384_12183 567
261 3300044683 Ga0466965_0008825 Ga0466965_0008825_307_2154 567
262 3300044735 Ga0466968_0000390 Ga0466968_0000390_11413_13215 567
263 3300044842 Ga0466957_0015402 Ga0466957_0015402_644_2491 567
264 3300045836 Ga0466958_0065214 Ga0466958_0065214_96_1943 567
265 3300046512 Ga0495610_0000671 Ga0495610_0000671_7299_9098 567
266 3300046691 Ga0495670_0005611 Ga0495670_0005611_1237_3036 567
267 3300046694 Ga0495649_0006507 Ga0495649_0006507_721_2520 567
268 3300048924 Ga0496121_0008205 Ga0496121_0008205_5273_7138 567
269 3300048928 Ga0496125_0000469 Ga0496125_0000469_39919_41784 567
270 3300049823 Ga0501044_0025855 Ga0501044_0025855_2969_4891 567
271 3300061719 Ga0466962_0003050 Ga0466962_0003050_629_2476 567
272 3300001989 JGI24739J22299_10011145 JGI24739J22299_100111452 568
273 3300002067 JGI24735J21928_10003840 JGI24735J21928_100038403 568
274 3300005563 Ga0068855_100037490 Ga0068855_1000374902 568
275 3300005578 Ga0068854_100012119 Ga0068854_1000121192 568
276 3300005614 Ga0068856_100000309 Ga0068856_10000030943 568
277 3300009093 Ga0105240_10089803 Ga0105240_100898032 568
278 3300013105 Ga0157369_10007761 Ga0157369_1000776110 568
279 3300015687 Ga0183368_1003 Ga0183368_1003275 568
280 3300025904 Ga0207647_10013042 Ga0207647_100130422 568
281 3300025913 Ga0207695_10009237 Ga0207695_100092375 568
282 3300025949 Ga0207667_10005765 Ga0207667_1000576512 568
283 3300025981 Ga0207640_10002357 Ga0207640_100023572 568
284 3300026078 Ga0207702_10000107 Ga0207702_1000010719 568
285 3300046507 Ga0495606_0010129 Ga0495606_0010129_1133_3004 568
286 3300048909 Ga0496106_0001986 Ga0496106_0001986_6922_8781 568
287 3300048918 Ga0496115_0000238 Ga0496115_0000238_18874_20730 568
288 3300048927 Ga0496124_0000245 Ga0496124_0000245_96584_98452 568
289 iso_pu_bacteria 2687453130 2687584410 568
290 3300003316 rootH1_10037425 rootH1_100374252 569
291 3300014497 Ga0182008_10050685 Ga0182008_100506851 569
292 3300015261 Ga0182006_1000061 Ga0182006_100006172 569
293 3300015265 Ga0182005_1011886 Ga0182005_10118862 569
294 3300046616 Ga0495668_0005845 Ga0495668_0005845_4177_5979 569
295 3300046810 Ga0495660_0000223 Ga0495660_0000223_2271_4073 569
296 3300047469 Ga0495673_0000004 Ga0495673_0000004_770462_772264 569
297 3300048903 Ga0496100_0024083 Ga0496100_0024083_1412_3214 569
298 3300048904 Ga0496101_0000877 Ga0496101_0000877_14752_16554 569
299 3300048921 Ga0496118_0005697 Ga0496118_0005697_1207_3057 569
300 3300048924 Ga0496121_0000633 Ga0496121_0000633_62722_64584 569
301 3300048924 Ga0496121_0013757 Ga0496121_0013757_2078_3928 569
302 3300048925 Ga0496122_0016821 Ga0496122_0016821_4568_6370 569
303 3300048929 Ga0496126_0005757 Ga0496126_0005757_11042_12892 569
304 3300049586 Ga0501070_0056486 Ga0501070_0056486_1316_3178 569
305 3300003320 rootH2_10051054 rootH2_100510542 570
306 3300005344 Ga0070661_100027370 Ga0070661_1000273702 570
307 3300017792 Ga0163161_10004779 Ga0163161_100047792 570
308 3300025226 Ga0209674_100012 Ga0209674_1000124 570
309 3300025250 Ga0209026_1000319 Ga0209026_100031929 570
310 3300046452 Ga0495617_000268 Ga0495617_000268_26753_28558 570
311 3300046452 Ga0495617_000654 Ga0495617_000654_1218_3083 570
312 3300046460 Ga0495638_0000148 Ga0495638_0000148_34638_36443 570
313 3300046460 Ga0495638_0059261 Ga0495638_0059261_224_2089 570
314 3300046492 Ga0495585_0000007 Ga0495585_0000007_51087_52892 570
315 3300046501 Ga0495607_0000029 Ga0495607_0000029_152012_153817 570
316 3300046507 Ga0495606_0000351 Ga0495606_0000351_75776_77641 570
317 3300046515 Ga0495620_0000090 Ga0495620_0000090_1212_3077 570
318 3300046518 Ga0495631_0001043 Ga0495631_0001043_14061_15866 570
319 3300046524 Ga0495648_0002437 Ga0495648_0002437_1344_3149 570
320 3300046648 Ga0495611_0000003 Ga0495611_0000003_190020_191825 570
321 3300046660 Ga0495625_0000019 Ga0495625_0000019_114825_116630 570
322 3300046660 Ga0495625_0048424 Ga0495625_0048424_51_1916 570
323 3300046665 Ga0495661_0014491 Ga0495661_0014491_1217_3088 570
324 3300046691 Ga0495670_0021475 Ga0495670_0021475_1313_3118 570
325 3300046692 Ga0495671_0015974 Ga0495671_0015974_416_2221 570
326 3300046794 Ga0495589_0000018 Ga0495589_0000018_44367_46172 570
327 3300046810 Ga0495660_0000164 Ga0495660_0000164_2514_4319 570
328 3300047446 Ga0495679_000017 Ga0495679_000017_71388_73193 570
329 3300047469 Ga0495673_0019181 Ga0495673_0019181_1238_3043 570
330 3300048922 Ga0496119_0022606 Ga0496119_0022606_1538_3391 570
331 3300048923 Ga0496120_0000665 Ga0496120_0000665_16952_18805 570
332 3300048926 Ga0496123_0050698 Ga0496123_0050698_592_2394 570
333 3300049459 Ga0495678_000152 Ga0495678_000152_32162_33967 570
334 3300053087 Ga0500643_000029 Ga0500643_000029_190478_192283 570
335 3300053103 Ga0500555_000934 Ga0500555_000934_449_2254 570
336 3300053730 Ga0500645_000316 Ga0500645_000316_18619_20424 570
337 iso_pu_bacteria 2593339238 2595447444 570
338 3300005337 Ga0070682_100033718 Ga0070682_1000337183 571
339 3300005455 Ga0070663_100076075 Ga0070663_1000760752 571
340 3300038443 Ga0395901_0106960 Ga0395901_0106960_505_2490 571
341 3300046507 Ga0495606_0000427 Ga0495606_0000427_1146_2951 571
342 3300046691 Ga0495670_0014969 Ga0495670_0014969_988_2793 571
343 iso_pu_bacteria 2593339239 2595450212 571
344 iso_pu_bacteria 2842918807 2842920522 571
345 iso_pu_bacteria 2919404418 2919406761 571
346 iso_pu_bacteria 2953994433 2953995806 571
347 3300049574 Ga0501038_0067202 Ga0501038_0067202_662_2650 572
348 iso_pu_bacteria 2718218334 2721025926 572
349 iso_pu_bacteria 2734482264 2735834110 572
350 iso_pu_bacteria 2738543009 2739225520 572
351 iso_pu_bacteria 2739367700 2739732538 572
352 iso_pu_bacteria 2842914999 2842917843 572
353 iso_pu_bacteria 2919085039 2919086049 572
354 3300046471 Ga0495650_0013895 Ga0495650_0013895_1153_2958 573
355 3300046491 Ga0495584_0004271 Ga0495584_0004271_4250_6055 573
356 3300046492 Ga0495585_0000594 Ga0495585_0000594_21622_23427 573
357 3300046513 Ga0495616_0000793 Ga0495616_0000793_7285_9090 573
358 3300046519 Ga0495632_0006875 Ga0495632_0006875_4259_6064 573
359 3300047323 Ga0495683_0001417 Ga0495683_0001417_13856_15661 573
360 3300047472 Ga0495686_0007116 Ga0495686_0007116_2000_3805 573
361 3300048924 Ga0496121_0005215 Ga0496121_0005215_1130_2935 573
362 iso_pu_bacteria 2818991440 2819566040 573
363 iso_pu_bacteria 2884338543 2884342086 573
364 iso_pu_bacteria 2884411467 2884412620 573
365 iso_pu_bacteria 2904463128 2904466311 573
366 iso_pu_bacteria 2928963466 2928965255 573
367 3300013307 Ga0157372_10049995 Ga0157372_100499954 574
368 3300025242 Ga0209258_100636 Ga0209258_1006362 574
369 3300037312 Ga0395899_0066522 Ga0395899_0066522_609_2594 574
370 3300045976 Ga0466967_0101399 Ga0466967_0101399_396_2234 574
371 3300046471 Ga0495650_0000615 Ga0495650_0000615_5756_7561 574
372 3300046522 Ga0495643_0010699 Ga0495643_0010699_3683_5488 574
373 3300046648 Ga0495611_0000018 Ga0495611_0000018_56163_57968 574
374 3300047469 Ga0495673_0000133 Ga0495673_0000133_67226_69031 574
375 3300049570 Ga0501033_0017746 Ga0501033_0017746_481_2469 574
376 3300049573 Ga0501037_0063406 Ga0501037_0063406_431_2419 574
377 3300049581 Ga0501047_0041731 Ga0501047_0041731_999_2987 574
378 3300049581 Ga0501047_0061589 Ga0501047_0061589_502_2487 574
379 3300049586 Ga0501070_0082917 Ga0501070_0082917_169_2157 574
380 3300049822 Ga0501035_0052480 Ga0501035_0052480_1539_3527 574
381 3300053160 Ga0500633_0002029 Ga0500633_0002029_1424_3229 574
382 iso_pu_bacteria 2895395659 2895398899 574
383 3300003578 Ga0006562J51391_1037726 Ga0006562J51391_10377262 575
384 3300003578 Ga0006562J51391_1037727 Ga0006562J51391_10377272 575
385 3300005262 Ga0065165_1000491 Ga0065165_10004916 575
386 3300014497 Ga0182008_10002428 Ga0182008_100024282 575
387 3300015265 Ga0182005_1001241 Ga0182005_10012412 575
388 3300042184 Ga0450908_000016 Ga0450908_000016_19328_21127 575
389 3300044672 Ga0466982_0000039 Ga0466982_0000039_36624_38486 575
390 iso_pu_bacteria 2537561836 2538834784 575
391 iso_pu_bacteria 2643221562 2643829279 575
392 iso_pu_bacteria 2643221577 2643895726 575
393 iso_pu_bacteria 2643221685 2644477919 575
394 iso_pu_bacteria 2939611941 2939613007 575
395 3300005340 Ga0070689_100003954 Ga0070689_1000039547 576
396 3300005843 Ga0068860_100024366 Ga0068860_1000243663 576
397 3300009551 Ga0105238_10032558 Ga0105238_100325584 576
398 3300025936 Ga0207670_10001106 Ga0207670_100011063 576
399 3300026067 Ga0207678_10025131 Ga0207678_100251314 576
400 3300046460 Ga0495638_0002260 Ga0495638_0002260_12901_14751 576
401 3300046471 Ga0495650_0000498 Ga0495650_0000498_23238_25088 576
402 3300046501 Ga0495607_0000100 Ga0495607_0000100_87944_89815 576
403 3300046519 Ga0495632_0000010 Ga0495632_0000010_38291_40093 576
404 3300048907 Ga0496104_0069351 Ga0496104_0069351_364_2214 576
405 3300048920 Ga0496117_0088927 Ga0496117_0088927_156_1970 576
406 3300048921 Ga0496118_0013356 Ga0496118_0013356_4852_6666 576
407 3300048924 Ga0496121_0000108 Ga0496121_0000108_161119_162933 576
408 3300048925 Ga0496122_0052136 Ga0496122_0052136_1274_3088 576
409 3300048929 Ga0496126_0051992 Ga0496126_0051992_1475_3289 576
410 iso_pu_bacteria 2941471342 2941474097 576
411 3300002737 JGI25162J39368_1002161 JGI25162J39368_10021612 577
412 3300003762 Ga0055542_1001094 Ga0055542_10010942 577
413 3300005365 Ga0070688_100072378 Ga0070688_1000723781 577
414 3300025231 Ga0207427_103037 Ga0207427_1030372 577
415 3300025233 Ga0209437_100214 Ga0209437_10021454 577
416 3300025254 Ga0209148_1000002 Ga0209148_1000002822 577
417 3300025256 Ga0209759_1003374 Ga0209759_10033745 577
418 3300041452 Ga0451793_0083499 Ga0451793_0083499_867_2825 577
419 3300046460 Ga0495638_0000019 Ga0495638_0000019_368163_370121 577
420 3300046460 Ga0495638_0000164 Ga0495638_0000164_88086_89939 577
421 3300046507 Ga0495606_0001115 Ga0495606_0001115_15949_17802 577
422 3300046660 Ga0495625_0024870 Ga0495625_0024870_79_1932 577
423 3300046694 Ga0495649_0001556 Ga0495649_0001556_11031_12884 577
424 3300047472 Ga0495686_0000126 Ga0495686_0000126_39746_41551 577
425 3300048918 Ga0496115_0001361 Ga0496115_0001361_2806_4659 577
426 3300049460 Ga0495682_0009407 Ga0495682_0009407_389_2242 577
427 3300013104 Ga0157370_10020057 Ga0157370_100200575 579
428 3300013105 Ga0157369_10000735 Ga0157369_100007353 580
429 3300048925 Ga0496122_0044873 Ga0496122_0044873_506_2320 580
430 3300048928 Ga0496125_0056325 Ga0496125_0056325_1230_3044 580
431 3300001904 JGI24736J21556_1002449 JGI24736J21556_10024491 581
432 3300025904 Ga0207647_10000020 Ga0207647_1000002017 581

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04348

LppC

LppC putative lipoprotein

261

602

0.93

PF04348

LppC

LppC putative lipoprotein

59

227

0.92

PF13458

Peripla_BP_6

Periplasmic binding protein

265

561

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ckm-assembly1.cif.gz_A lpoa (yram) c-domain from haemophilus influenzae, a regulator of pbp1a 0.8511 228 559
3ckm-assembly1.cif.gz_A lpoa (yram) c-domain from haemophilus influenzae, a regulator of pbp1a 0.8437 228 559
4pyr-assembly1.cif.gz_A structure of a putative branched-chain amino acid abc transporter from chromobacterium violaceum atcc 12472 0.8435 224 551
4pyr-assembly1.cif.gz_A structure of a putative branched-chain amino acid abc transporter from chromobacterium violaceum atcc 12472 0.8409 224 551
3hut-assembly1.cif.gz_A crystal structure of a putative branched-chain amino acid abc transporter from rhodospirillum rubrum 0.782 228 559
ID Description Score Start End Superfamily
3sg0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8574 344 472 3.40.50.2300
3hutA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8572 340 472 3.40.50.2300
3td9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8503 341 469 3.40.50.2300
4gnrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.846 228 318 3.40.50.2300
af_Q7F0I0_252_364_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8409 82 168 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7V2SYW4-F1-model_v4 Penicillin-binding protein activator 0.8963 296 559 GO:0009252
GO:0030234
GO:0031241
AF-A0A7V2SYW4-F1-model_v4 Penicillin-binding protein activator 0.8861 296 559 GO:0009252
GO:0030234
GO:0031241
AF-A0A176S452-F1-model_v4 LppC putative lipoprotein 0.8797 232 559 GO:0009252
GO:0030234
GO:0031241
AF-A0A176S452-F1-model_v4 LppC putative lipoprotein 0.8717 232 559 GO:0009252
GO:0030234
GO:0031241
AF-A0A356R1Y9-F1-model_v4 Penicillin-binding protein activator 0.869 226 559 GO:0009252
GO:0030234
GO:0031241

Feature Viewer

pLDDT pTM Quality
83.62 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map