F442456

General Info

Members Datasets Scaffolds Average Seq Length
431 199 431 186

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0058138|Ga0495684_0058138_484_1146
Length 220
Sequence MPGSSTSLKPSAPPMRETNRKKNNYDQKQNMRKLIAAINMTLDGFCDHTAMIADEEIHQHYNELLSNAGTLIYGRITYQLMESYWPSVVKNPTGNKPMDEFAVLINNISKIVFSRTLQHVDWKNTKLKREIIKEEVLDLKQSSNGGSKNILVGSPSLIVALTQLDLIDEYQLGVQPIVLGSGLPLFKNLKERVNLKLLRTKIFGCGAVTLYYEPTKRMSA

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 0.93
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10002473 3300002459 Bacteria 3721
2 rootH2_10035575 3300003320 Bacteria 8979
3 rootL2_10062326 3300003322 Bacteria 2124
4 Ga0065704_10086117 3300005289 Bacteria 3152
5 Ga0065712_10001194 3300005290 Bacteria 10859
6 Ga0065712_10096974 3300005290 Bacteria 2165
7 Ga0065715_10182249 3300005293 Bacteria 1468
8 Ga0065707_10011976 3300005295 Bacteria 2376
9 Ga0065707_10108703 3300005295 Bacteria 2499
10 Ga0070658_10219329 3300005327 Unclassified 1608
11 Ga0070676_10582107 3300005328 Bacteria 805
12 Ga0070683_100001600 3300005329 Bacteria 17515
13 Ga0070683_100012033 3300005329 Bacteria 7505
14 Ga0070683_100084866 3300005329 Bacteria 2968
15 Ga0070690_100050368 3300005330 Bacteria 2657
16 Ga0070690_100057802 3300005330 Bacteria 2490
17 Ga0070670_100037396 3300005331 Unclassified 4177
18 Ga0070670_100052540 3300005331 Bacteria 3499
19 Ga0070670_100083170 3300005331 Bacteria 2751
20 Ga0070670_100451093 3300005331 Bacteria 1140
21 Ga0068869_100025742 3300005334 Bacteria 4089
22 Ga0068869_100029859 3300005334 Bacteria 3822
23 Ga0068869_100058462 3300005334 Unclassified 2819
24 Ga0068869_100116956 3300005334 Bacteria 2034
25 Ga0068869_100149090 3300005334 Bacteria 1813
26 Ga0068869_100494017 3300005334 Bacteria 1021
27 Ga0068869_101077461 3300005334 Bacteria 702
28 Ga0070666_10000042 3300005335 Bacteria 112296
29 Ga0070666_10005402 3300005335 Bacteria 7835
30 Ga0070666_10075850 3300005335 Bacteria 2293
31 Ga0070666_10183414 3300005335 Bacteria 1469
32 Ga0070666_10388422 3300005335 Bacteria 1002
33 Ga0070682_100099133 3300005337 Bacteria 1920
34 Ga0070682_101018920 3300005337 Unclassified 688
35 Ga0068868_100005165 3300005338 Bacteria 9164
36 Ga0068868_100018531 3300005338 Bacteria 5206
37 Ga0068868_100093717 3300005338 Bacteria 2422
38 Ga0068868_100365369 3300005338 Bacteria 1239
39 Ga0070660_100126256 3300005339 Bacteria 2044
40 Ga0070660_100223248 3300005339 Bacteria 1532
41 Ga0070689_100024224 3300005340 Unclassified 4550
42 Ga0070689_100873976 3300005340 Bacteria 794
43 Ga0070669_100079437 3300005353 Bacteria 2440
44 Ga0070669_100135290 3300005353 Bacteria 1895
45 Ga0070669_100238255 3300005353 Bacteria 1444
46 Ga0070675_100012300 3300005354 Bacteria 6707
47 Ga0070675_100052455 3300005354 Unclassified 3353
48 Ga0070675_100211705 3300005354 Bacteria 1685
49 Ga0070675_100356611 3300005354 Unclassified 1298
50 Ga0070675_100605204 3300005354 Bacteria 994
51 Ga0070671_100028337 3300005355 Bacteria 4611
52 Ga0070671_100097556 3300005355 Bacteria 2465
53 Ga0070671_100633003 3300005355 Bacteria 925
54 Ga0070674_100106053 3300005356 Bacteria 2056
55 Ga0070673_100027073 3300005364 Bacteria 4246
56 Ga0070673_100060608 3300005364 Bacteria 2999
57 Ga0070673_100092570 3300005364 Bacteria 2473
58 Ga0070673_100223785 3300005364 Bacteria 1630
59 Ga0070688_100016133 3300005365 Unclassified 4264
60 Ga0070659_100013972 3300005366 Bacteria 5993
61 Ga0070659_100283668 3300005366 Bacteria 1378
62 Ga0070659_101271503 3300005366 Bacteria 652
63 Ga0070667_100014284 3300005367 Bacteria 6559
64 Ga0070701_10429923 3300005438 Unclassified 843
65 Ga0070700_100183409 3300005441 Bacteria 1458
66 Ga0070700_100232526 3300005441 Bacteria 1313
67 Ga0070678_100174738 3300005456 Bacteria 1753
68 Ga0070678_100528332 3300005456 Bacteria 1045
69 Ga0070678_100612647 3300005456 Unclassified 973
70 Ga0070662_100005292 3300005457 Bacteria 8238
71 Ga0070662_100332773 3300005457 Unclassified 1241
72 Ga0070681_10080272 3300005458 Bacteria 3218
73 Ga0070681_10348972 3300005458 Unclassified 1390
74 Ga0070685_10035486 3300005466 Unclassified 2813
75 Ga0070698_100001350 3300005471 Bacteria 27279
76 Ga0070698_100029464 3300005471 Bacteria 5699
77 Ga0070679_100026769 3300005530 Bacteria 5671
78 Ga0070684_100004763 3300005535 Bacteria 10369
79 Ga0070684_100004993 3300005535 Bacteria 10134
80 Ga0068853_100004129 3300005539 Bacteria 11192
81 Ga0068853_100062129 3300005539 Unclassified 3231
82 Ga0068853_100085615 3300005539 Bacteria 2763
83 Ga0068853_100142056 3300005539 Bacteria 2156
84 Ga0070686_100153125 3300005544 Unclassified 1617
85 Ga0068855_100065172 3300005563 Bacteria 4247
86 Ga0070664_100002698 3300005564 Bacteria 14321
87 Ga0070664_100003151 3300005564 Bacteria 13329
88 Ga0070664_100185365 3300005564 Unclassified 1852
89 Ga0070664_100405758 3300005564 Bacteria 1247
90 Ga0070664_100421759 3300005564 Bacteria 1222
91 Ga0068857_100126028 3300005577 Bacteria 2308
92 Ga0068857_100366621 3300005577 Bacteria 1336
93 Ga0068854_100013175 3300005578 Bacteria 5420
94 Ga0068856_100068021 3300005614 Bacteria 3520
95 Ga0068856_100717065 3300005614 Bacteria 1020
96 Ga0068852_100003800 3300005616 Bacteria 10597
97 Ga0068852_100007857 3300005616 Bacteria 7809
98 Ga0068859_100000768 3300005617 Bacteria 32376
99 Ga0068859_100389295 3300005617 Bacteria 1490
100 Ga0068864_100082025 3300005618 Bacteria 2829
101 Ga0068864_100401335 3300005618 Bacteria 1303
102 Ga0068864_101103824 3300005618 Unclassified 789
103 Ga0068864_101408549 3300005618 Unclassified 699
104 Ga0068866_10717684 3300005718 Unclassified 687
105 Ga0068851_10000094 3300005834 Bacteria 49249
106 Ga0068851_10081142 3300005834 Bacteria 1694
107 Ga0068851_10314498 3300005834 Unclassified 903
108 Ga0068870_10074249 3300005840 Bacteria 1862
109 Ga0068863_100009065 3300005841 Bacteria 9715
110 Ga0068863_100084614 3300005841 Bacteria 3006
111 Ga0068863_100128182 3300005841 Bacteria 2421
112 Ga0068863_100306477 3300005841 Bacteria 1541
113 Ga0068863_100598557 3300005841 Bacteria 1091
114 Ga0068863_100658628 3300005841 Bacteria 1039
115 Ga0068858_100024001 3300005842 Bacteria 5681
116 Ga0068858_100034737 3300005842 Bacteria 4676
117 Ga0068858_100357358 3300005842 Bacteria 1400
118 Ga0068860_100083787 3300005843 Bacteria 3033
119 Ga0068862_100152151 3300005844 Bacteria 2060
120 Ga0097621_100009202 3300006237 Bacteria 7163
121 Ga0097621_100024239 3300006237 Bacteria 4735
122 Ga0097621_100024760 3300006237 Bacteria 4691
123 Ga0097621_100036578 3300006237 Bacteria 3928
124 Ga0097621_100092023 3300006237 Bacteria 2539
125 Ga0097621_100188646 3300006237 Unclassified 1784
126 Ga0097621_100416211 3300006237 Bacteria 1205
127 Ga0097621_100428970 3300006237 Bacteria 1188
128 Ga0097621_100624215 3300006237 Bacteria 987
129 Ga0097621_100706368 3300006237 Bacteria 929
130 Ga0068871_100031618 3300006358 Bacteria 4175
131 Ga0068871_100065599 3300006358 Bacteria 2974
132 Ga0068871_100098379 3300006358 Bacteria 2447
133 Ga0068871_100198891 3300006358 Bacteria 1729
134 Ga0068871_101518776 3300006358 Bacteria 633
135 Ga0075428_100971815 3300006844 Bacteria 899
136 Ga0075430_100076718 3300006846 Bacteria 2801
137 Ga0075434_100343385 3300006871 Bacteria 1514
138 Ga0075429_100269057 3300006880 Bacteria 1492
139 Ga0068865_100362206 3300006881 Bacteria 1178
140 Ga0097620_100000768 3300006931 Bacteria 32376
141 Ga0097620_100389287 3300006931 Bacteria 1490
142 Ga0105240_10253693 3300009093 Bacteria 2033
143 Ga0105240_10265943 3300009093 Bacteria 1977
144 Ga0105240_10312264 3300009093 Bacteria 1795
145 Ga0111539_10018254 3300009094 Bacteria 8688
146 Ga0111539_10041305 3300009094 Bacteria 5546
147 Ga0111539_10099759 3300009094 Bacteria 3410
148 Ga0111539_10467128 3300009094 Bacteria 1469
149 Ga0105247_10054600 3300009101 Bacteria 2465
150 Ga0105247_10331147 3300009101 Bacteria 1065
151 Ga0105247_10913096 3300009101 Bacteria 679
152 Ga0114129_10065386 3300009147 Bacteria 5076
153 Ga0114129_10200659 3300009147 Bacteria 2702
154 Ga0105241_10000853 3300009174 Bacteria 23134
155 Ga0105241_10253198 3300009174 Bacteria 1494
156 Ga0105241_10294418 3300009174 Bacteria 1391
157 Ga0105242_10051728 3300009176 Unclassified 3349
158 Ga0105242_10455560 3300009176 Bacteria 1207
159 Ga0105242_10597172 3300009176 Bacteria 1066
160 Ga0105242_10702998 3300009176 Bacteria 989
161 Ga0105248_10169223 3300009177 Bacteria 2463
162 Ga0105237_10047976 3300009545 Bacteria 4294
163 Ga0105237_10124870 3300009545 Bacteria 2568
164 Ga0105237_10573781 3300009545 Bacteria 1135
165 Ga0105249_10010246 3300009553 Bacteria 8232
166 Ga0105249_10027531 3300009553 Bacteria 5128
167 Ga0105249_10584294 3300009553 Bacteria 1170
168 Ga0105239_10011867 3300010375 Bacteria 9720
169 Ga0105239_10136826 3300010375 Bacteria 2727
170 Ga0105246_10003384 3300011119 Bacteria 9663
171 Ga0105246_10024300 3300011119 Bacteria 3935
172 Ga0105246_10782223 3300011119 Bacteria 845
173 Ga0157373_10013015 3300013100 Bacteria 6105
174 Ga0157373_10072400 3300013100 Unclassified 2433
175 Ga0157373_10076585 3300013100 Unclassified 2360
176 Ga0157371_10013219 3300013102 Bacteria 6283
177 Ga0157371_10181143 3300013102 Bacteria 1507
178 Ga0157371_10297752 3300013102 Bacteria 1167
179 Ga0157370_10110586 3300013104 Bacteria 2568
180 Ga0157369_10005463 3300013105 Bacteria 14769
181 Ga0157369_10024028 3300013105 Bacteria 6782
182 Ga0157369_10785503 3300013105 Bacteria 979
183 Ga0157374_10012862 3300013296 Bacteria 7290
184 Ga0157374_10109734 3300013296 Unclassified 2653
185 Ga0157374_10261289 3300013296 Bacteria 1705
186 Ga0157374_10686147 3300013296 Bacteria 1037
187 Ga0157374_11018518 3300013296 Bacteria 847
188 Ga0157374_11575489 3300013296 Unclassified 681
189 Ga0157378_10000981 3300013297 Bacteria 26109
190 Ga0157378_10015086 3300013297 Bacteria 6763
191 Ga0157378_10029706 3300013297 Bacteria 4827
192 Ga0157378_10073750 3300013297 Unclassified 3069
193 Ga0157378_10082262 3300013297 Bacteria 2911
194 Ga0157378_10125896 3300013297 Bacteria 2366
195 Ga0157378_11154936 3300013297 Bacteria 813
196 Ga0163162_10019946 3300013306 Bacteria 6585
197 Ga0163162_10025120 3300013306 Bacteria 5888
198 Ga0163162_10043575 3300013306 Bacteria 4493
199 Ga0163162_10044216 3300013306 Bacteria 4460
200 Ga0163162_10067459 3300013306 Bacteria 3628
201 Ga0163162_10149285 3300013306 Bacteria 2454
202 Ga0163162_10698261 3300013306 Bacteria 1136
203 Ga0163162_10833229 3300013306 Unclassified 1038
204 Ga0163162_11123313 3300013306 Bacteria 891
205 Ga0157372_10148395 3300013307 Bacteria 2705
206 Ga0157372_10295762 3300013307 Bacteria 1883
207 Ga0157375_10004375 3300013308 Bacteria 12267
208 Ga0157375_10027163 3300013308 Bacteria 5347
209 Ga0157375_10052094 3300013308 Bacteria 4022
210 Ga0157375_10160576 3300013308 Bacteria 2389
211 Ga0157375_10204632 3300013308 Bacteria 2130
212 Ga0157375_10266430 3300013308 Bacteria 1875
213 Ga0157375_10439382 3300013308 Bacteria 1470
214 Ga0157375_10688100 3300013308 Bacteria 1177
215 Ga0157375_11129321 3300013308 Bacteria 918
216 Ga0157375_11668043 3300013308 Bacteria 754
217 Ga0163163_10078374 3300014325 Unclassified 3301
218 Ga0163163_10096128 3300014325 Bacteria 2983
219 Ga0163163_10486795 3300014325 Bacteria 1295
220 Ga0157380_10175610 3300014326 Bacteria 1877
221 Ga0157380_10242799 3300014326 Bacteria 1625
222 Ga0157380_10581891 3300014326 Unclassified 1104
223 Ga0157380_11978228 3300014326 Bacteria 644
224 Ga0157379_10321396 3300014968 Bacteria 1413
225 Ga0157376_10024192 3300014969 Bacteria 4765
226 Ga0157376_10059441 3300014969 Bacteria 3205
227 Ga0157376_10248842 3300014969 Bacteria 1659
228 Ga0157376_10250581 3300014969 Bacteria 1653
229 Ga0157376_10601904 3300014969 Bacteria 1094
230 Ga0157376_10849587 3300014969 Bacteria 928
231 Ga0163161_10008583 3300017792 Bacteria 7066
232 Ga0163161_10096780 3300017792 Bacteria 2192
233 Ga0163161_10310018 3300017792 Bacteria 1245
234 Ga0163161_10460441 3300017792 Bacteria 1029
235 Ga0163161_10505698 3300017792 Bacteria 985
236 Ga0209050_1057795 3300025298 Bacteria 936
237 Ga0207656_10000061 3300025321 Bacteria 42734
238 Ga0207656_10414530 3300025321 Bacteria 678
239 Ga0207642_10088550 3300025899 Unclassified 1523
240 Ga0207680_10000448 3300025903 Bacteria 19470
241 Ga0207680_10122369 3300025903 Bacteria 1703
242 Ga0207645_10008025 3300025907 Bacteria 7404
243 Ga0207645_10013380 3300025907 Bacteria 5530
244 Ga0207643_10591105 3300025908 Bacteria 714
245 Ga0207654_10013270 3300025911 Bacteria 4236
246 Ga0207654_10295014 3300025911 Bacteria 1101
247 Ga0207707_10121698 3300025912 Bacteria 2282
248 Ga0207660_10174221 3300025917 Bacteria 1667
249 Ga0207662_10014701 3300025918 Unclassified 4394
250 Ga0207657_10002477 3300025919 Bacteria 19978
251 Ga0207652_10563186 3300025921 Bacteria 1023
252 Ga0207681_11046403 3300025923 Bacteria 685
253 Ga0207650_10025254 3300025925 Unclassified 4231
254 Ga0207650_10096300 3300025925 Bacteria 2270
255 Ga0207659_10116189 3300025926 Bacteria 2042
256 Ga0207659_10116294 3300025926 Bacteria 2042
257 Ga0207644_10063071 3300025931 Bacteria 2690
258 Ga0207644_10563618 3300025931 Bacteria 944
259 Ga0207644_10573679 3300025931 Bacteria 935
260 Ga0207690_10097803 3300025932 Bacteria 2089
261 Ga0207690_10450141 3300025932 Bacteria 1035
262 Ga0207706_10019501 3300025933 Bacteria 6102
263 Ga0207706_10064374 3300025933 Bacteria 3228
264 Ga0207686_10000502 3300025934 Bacteria 25653
265 Ga0207686_10035820 3300025934 Bacteria 2982
266 Ga0207686_10086417 3300025934 Bacteria 2060
267 Ga0207670_10021583 3300025936 Unclassified 3976
268 Ga0207670_10524996 3300025936 Bacteria 964
269 Ga0207669_10067624 3300025937 Bacteria 2228
270 Ga0207669_10187863 3300025937 Bacteria 1488
271 Ga0207669_10794795 3300025937 Unclassified 784
272 Ga0207704_10059717 3300025938 Bacteria 2355
273 Ga0207704_10662183 3300025938 Bacteria 861
274 Ga0207691_10040168 3300025940 Bacteria 4324
275 Ga0207691_11284656 3300025940 Bacteria 605
276 Ga0207689_10008911 3300025942 Bacteria 8701
277 Ga0207689_10009963 3300025942 Bacteria 8195
278 Ga0207689_10036403 3300025942 Bacteria 4086
279 Ga0207689_10055119 3300025942 Bacteria 3273
280 Ga0207689_10097532 3300025942 Unclassified 2414
281 Ga0207689_10114750 3300025942 Bacteria 2214
282 Ga0207689_10306985 3300025942 Bacteria 1315
283 Ga0207661_10009347 3300025944 Bacteria 7025
284 Ga0207661_10203862 3300025944 Bacteria 1740
285 Ga0207679_10110430 3300025945 Bacteria 2169
286 Ga0207679_10234175 3300025945 Unclassified 1552
287 Ga0207679_10465509 3300025945 Bacteria 1123
288 Ga0207667_10305601 3300025949 Bacteria 1625
289 Ga0207667_10340090 3300025949 Bacteria 1531
290 Ga0207651_10120582 3300025960 Bacteria 1988
291 Ga0207651_10341854 3300025960 Unclassified 1257
292 Ga0207712_10006327 3300025961 Bacteria 7469
293 Ga0207712_10010882 3300025961 Bacteria 5790
294 Ga0207640_10055915 3300025981 Bacteria 2588
295 Ga0207640_11071391 3300025981 Bacteria 712
296 Ga0207658_10395322 3300025986 Bacteria 1214
297 Ga0207658_10411569 3300025986 Bacteria 1190
298 Ga0207677_10006590 3300026023 Bacteria 6371
299 Ga0207677_10036751 3300026023 Bacteria 3195
300 Ga0207677_10275568 3300026023 Bacteria 1378
301 Ga0207677_10779985 3300026023 Unclassified 854
302 Ga0207703_10024333 3300026035 Bacteria 4765
303 Ga0207703_10103055 3300026035 Unclassified 2422
304 Ga0207703_10813823 3300026035 Bacteria 892
305 Ga0207703_10877053 3300026035 Bacteria 859
306 Ga0207703_11685877 3300026035 Bacteria 610
307 Ga0207639_10019816 3300026041 Bacteria 4804
308 Ga0207639_10108447 3300026041 Unclassified 2257
309 Ga0207639_10128558 3300026041 Bacteria 2094
310 Ga0207678_10101247 3300026067 Bacteria 2460
311 Ga0207708_10074703 3300026075 Bacteria 2598
312 Ga0207708_10166903 3300026075 Bacteria 1741
313 Ga0207708_10393413 3300026075 Bacteria 1145
314 Ga0207641_10000368 3300026088 Bacteria 53493
315 Ga0207641_10005736 3300026088 Bacteria 10545
316 Ga0207641_10030652 3300026088 Bacteria 4456
317 Ga0207641_10040272 3300026088 Unclassified 3911
318 Ga0207641_10320583 3300026088 Bacteria 1469
319 Ga0207648_10035158 3300026089 Bacteria 4415
320 Ga0207648_10077133 3300026089 Bacteria 2905
321 Ga0207648_10416124 3300026089 Bacteria 1220
322 Ga0207648_10786156 3300026089 Unclassified 885
323 Ga0207648_11626068 3300026089 Bacteria 607
324 Ga0207676_10035708 3300026095 Bacteria 3775
325 Ga0207676_10107827 3300026095 Unclassified 2324
326 Ga0207676_10201135 3300026095 Bacteria 1760
327 Ga0207676_10808992 3300026095 Bacteria 915
328 Ga0207674_10118109 3300026116 Bacteria 2622
329 Ga0207674_10146725 3300026116 Unclassified 2318
330 Ga0207674_10158422 3300026116 Bacteria 2219
331 Ga0207674_10398572 3300026116 Bacteria 1330
332 Ga0207675_100509626 3300026118 Unclassified 1199
333 Ga0207675_100613972 3300026118 Bacteria 1091
334 Ga0207675_100886029 3300026118 Bacteria 908
335 Ga0207683_10170547 3300026121 Bacteria 1970
336 Ga0207683_10281917 3300026121 Bacteria 1518
337 Ga0207683_11020685 3300026121 Bacteria 768
338 Ga0207698_10002653 3300026142 Bacteria 10637
339 Ga0207698_10099182 3300026142 Bacteria 2409
340 Ga0207428_10631988 3300027907 Bacteria 769
341 Ga0268265_10133483 3300028380 Bacteria 2067
342 Ga0268264_10337943 3300028381 Bacteria 1429
343 Ga0268264_10747463 3300028381 Bacteria 974
344 Ga0265334_10010041 3300028573 Bacteria 4000
345 Ga0265318_10008009 3300028577 Bacteria 4737
346 Ga0265323_10080200 3300028653 Bacteria 1103
347 Ga0265322_10027576 3300028654 Bacteria 1623
348 Ga0307515_10022252 3300028794 Bacteria 11180
349 Ga0307515_10023206 3300028794 Bacteria 10886
350 Ga0265338_10132602 3300028800 Bacteria 1964
351 Ga0265320_10058421 3300031240 Bacteria 1847
352 Ga0265340_10013130 3300031247 Bacteria 4359
353 Ga0265331_10018207 3300031250 Bacteria 3648
354 Ga0307513_10002630 3300031456 Bacteria 24801
355 Ga0307509_10100901 3300031507 Bacteria 2923
356 Ga0307408_100000346 3300031548 Bacteria 43502
357 Ga0307408_100351969 3300031548 Bacteria 1250
358 Ga0307413_10094204 3300031824 Bacteria 1960
359 Ga0307410_10104611 3300031852 Bacteria 2036
360 Ga0307410_10124833 3300031852 Bacteria 1883
361 Ga0307412_11237047 3300031911 Unclassified 670
362 Ga0307416_100229308 3300032002 Bacteria 1789
363 Ga0307411_10233382 3300032005 Bacteria 1436
364 Ga0307415_100898399 3300032126 Unclassified 816
365 Ga0373956_0147181 3300035119 Bacteria 1107
366 Ga0373955_0025143 3300035172 Bacteria 3055
367 Ga0373931_0549225 3300035691 Bacteria 750
368 Ga0373933_0073573 3300035724 Bacteria 2082
369 Ga0373937_0026802 3300036401 Bacteria 5209
370 Ga0395901_1186768 3300038443 Bacteria 730
371 Ga0451797_1078936 3300041453 Bacteria 893
372 Ga0451807_1134984 3300041486 Bacteria 1152
373 Ga0439432_194927 3300042006 Unclassified 588
374 Ga0439460_0067251 3300042461 Bacteria 1104
375 Ga0451577_0000072 3300042876 Bacteria 237934
376 Ga0451577_0110179 3300042876 Bacteria 2462
377 Ga0451577_0140623 3300042876 Bacteria 2169
378 Ga0451577_0364449 3300042876 Unclassified 1311
379 Ga0451577_0692769 3300042876 Bacteria 923
380 Ga0453683_0000604 3300044673 Bacteria 39525
381 Ga0453684_0000186 3300044712 Bacteria 273302
382 Ga0453684_0053728 3300044712 Bacteria 5255
383 Ga0453684_0204031 3300044712 Bacteria 2302
384 Ga0453684_0347190 3300044712 Bacteria 1674
385 Ga0451576_0000065 3300045051 Bacteria 274445
386 Ga0451576_0850781 3300045051 Bacteria 957
387 Ga0451576_0873889 3300045051 Bacteria 944
388 Ga0495638_0035213 3300046460 Bacteria 3193
389 Ga0495638_0040680 3300046460 Bacteria 2945
390 Ga0495580_0100589 3300046472 Bacteria 2011
391 Ga0495580_0216636 3300046472 Bacteria 1316
392 Ga0495664_0088526 3300046477 Bacteria 1861
393 Ga0495594_0239268 3300046499 Bacteria 1035
394 Ga0495616_0015370 3300046513 Bacteria 4256
395 Ga0495628_0132282 3300046516 Bacteria 1907
396 Ga0495630_0227584 3300046517 Bacteria 1424
397 Ga0495652_0193712 3300046529 Bacteria 1549
398 Ga0495587_0045602 3300046536 Bacteria 2605
399 Ga0495598_0133414 3300046537 Bacteria 853
400 Ga0495598_0182286 3300046537 Bacteria 750
401 Ga0495621_0115862 3300046539 Bacteria 1032
402 Ga0495668_0082649 3300046616 Bacteria 1762
403 Ga0495634_0063647 3300046642 Bacteria 2447
404 Ga0495611_0042857 3300046648 Bacteria 2022
405 Ga0495657_0037939 3300046675 Bacteria 3318
406 Ga0495657_0188227 3300046675 Bacteria 1263
407 Ga0495670_0339378 3300046691 Bacteria 808
408 Ga0495600_0338817 3300046809 Bacteria 943
409 Ga0495636_0292530 3300047318 Bacteria 761
410 Ga0495674_0163607 3300047319 Bacteria 1861
411 Ga0495674_0670980 3300047319 Bacteria 816
412 Ga0495672_0111274 3300047320 Bacteria 1469
413 Ga0495676_0164088 3300047321 Bacteria 1569
414 Ga0495676_0635277 3300047321 Bacteria 694
415 Ga0495684_0058138 3300047471 Bacteria 2946
416 Ga0495686_0020405 3300047472 Bacteria 4418
417 Ga0496106_1103252 3300048909 Bacteria 622
418 Ga0496114_1271066 3300048917 Bacteria 623
419 Ga0501040_0361525 3300049576 Unclassified 1040
420 nmdc:mga0k408_3656_c1 3300050493 Bacteria 8138
421 nmdc:mga09592_166118_c1 3300050508 Bacteria 1908
422 nmdc:mga0qj67_380073_c1 3300050509 Bacteria 1141
423 nmdc:mga06r32_570936_c1 3300050510 Bacteria 1104
424 nmdc:mga08y16_12046_c1 3300050511 Bacteria 9086
425 nmdc:mga08y16_307766_c1 3300050511 Bacteria 1632
426 nmdc:mga08y16_439207_c1 3300050511 Bacteria 1332
427 nmdc:mga0n895_555928_c1 3300050512 Bacteria 1153
428 Ga0495619_0145252 3300053085 Bacteria 1635
429 Ga0500616_0018666 3300053153 Bacteria 3919
430 Ga0500622_0003772 3300053156 Bacteria 9895
431 Ga0500611_000037 3300053727 Bacteria 72513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100085615 Ga0068853_1000856153 152
2 3300026041 Ga0207639_10128558 Ga0207639_101285581 152
3 3300047320 Ga0495672_0111274 Ga0495672_0111274_631_1239 157
4 3300005295 Ga0065707_10108703 Ga0065707_101087034 159
5 3300013306 Ga0163162_10698261 Ga0163162_106982612 159
6 3300013308 Ga0157375_10688100 Ga0157375_106881001 159
7 3300014326 Ga0157380_11978228 Ga0157380_119782281 159
8 3300026088 Ga0207641_10030652 Ga0207641_100306527 159
9 3300046691 Ga0495670_0339378 Ga0495670_0339378_168_749 159
10 3300005471 Ga0070698_100001350 Ga0070698_10000135011 160
11 3300031548 Ga0307408_100351969 Ga0307408_1003519691 160
12 3300031824 Ga0307413_10094204 Ga0307413_100942042 160
13 3300031852 Ga0307410_10104611 Ga0307410_101046112 160
14 3300031911 Ga0307412_11237047 Ga0307412_112370471 160
15 3300032002 Ga0307416_100229308 Ga0307416_1002293081 160
16 3300032005 Ga0307411_10233382 Ga0307411_102333823 160
17 3300032126 Ga0307415_100898399 Ga0307415_1008983992 160
18 3300017792 Ga0163161_10096780 Ga0163161_100967801 161
19 3300025926 Ga0207659_10116294 Ga0207659_101162942 163
20 3300047318 Ga0495636_0292530 Ga0495636_0292530_28_591 163
21 3300009174 Ga0105241_10253198 Ga0105241_102531982 164
22 3300009545 Ga0105237_10047976 Ga0105237_100479765 164
23 3300010375 Ga0105239_10011867 Ga0105239_1001186711 164
24 3300027907 Ga0207428_10631988 Ga0207428_106319882 167
25 3300005331 Ga0070670_100083170 Ga0070670_1000831702 168
26 3300005335 Ga0070666_10005402 Ga0070666_100054028 168
27 3300006237 Ga0097621_100416211 Ga0097621_1004162112 168
28 3300013306 Ga0163162_11123313 Ga0163162_111233131 168
29 3300013308 Ga0157375_10204632 Ga0157375_102046322 168
30 3300025925 Ga0207650_10096300 Ga0207650_100963002 168
31 3300009176 Ga0105242_10597172 Ga0105242_105971722 171
32 3300005335 Ga0070666_10183414 Ga0070666_101834142 172
33 3300005618 Ga0068864_101103824 Ga0068864_1011038242 172
34 3300005834 Ga0068851_10000094 Ga0068851_1000009436 172
35 3300005841 Ga0068863_100009065 Ga0068863_1000090652 172
36 3300006237 Ga0097621_100024239 Ga0097621_1000242394 172
37 3300006358 Ga0068871_100031618 Ga0068871_1000316184 172
38 3300009176 Ga0105242_10455560 Ga0105242_104555601 172
39 3300009553 Ga0105249_10584294 Ga0105249_105842942 172
40 3300013306 Ga0163162_10149285 Ga0163162_101492854 172
41 3300013308 Ga0157375_10160576 Ga0157375_101605763 172
42 3300014325 Ga0163163_10078374 Ga0163163_100783742 172
43 3300014969 Ga0157376_10024192 Ga0157376_100241926 172
44 3300025321 Ga0207656_10000061 Ga0207656_1000006132 172
45 3300025903 Ga0207680_10122369 Ga0207680_101223691 172
46 3300025933 Ga0207706_10019501 Ga0207706_100195014 172
47 3300025934 Ga0207686_10000502 Ga0207686_1000050222 172
48 3300025936 Ga0207670_10524996 Ga0207670_105249963 172
49 3300025981 Ga0207640_10055915 Ga0207640_100559152 172
50 3300026088 Ga0207641_10000368 Ga0207641_1000036813 172
51 3300026088 Ga0207641_10040272 Ga0207641_100402722 172
52 3300031852 Ga0307410_10124833 Ga0307410_101248332 172
53 3300046460 Ga0495638_0040680 Ga0495638_0040680_2376_2924 172
54 3300047319 Ga0495674_0670980 Ga0495674_0670980_51_599 172
55 3300047321 Ga0495676_0635277 Ga0495676_0635277_110_667 172
56 3300003320 rootH2_10035575 rootH2_1003557510 173
57 3300003322 rootL2_10062326 rootL2_100623261 173
58 3300005354 Ga0070675_100356611 Ga0070675_1003566111 173
59 3300005355 Ga0070671_100028337 Ga0070671_1000283371 173
60 3300005364 Ga0070673_100223785 Ga0070673_1002237853 173
61 3300005438 Ga0070701_10429923 Ga0070701_104299231 173
62 3300005544 Ga0070686_100153125 Ga0070686_1001531252 173
63 3300005564 Ga0070664_100185365 Ga0070664_1001853653 173
64 3300005718 Ga0068866_10717684 Ga0068866_107176841 173
65 3300005834 Ga0068851_10314498 Ga0068851_103144981 173
66 3300006871 Ga0075434_100343385 Ga0075434_1003433852 173
67 3300013296 Ga0157374_11575489 Ga0157374_115754891 173
68 3300013297 Ga0157378_10015086 Ga0157378_100150862 173
69 3300025937 Ga0207669_10187863 Ga0207669_101878632 173
70 3300025940 Ga0207691_10040168 Ga0207691_100401682 173
71 3300025945 Ga0207679_10234175 Ga0207679_102341753 173
72 3300026035 Ga0207703_10103055 Ga0207703_101030552 173
73 3300026075 Ga0207708_10166903 Ga0207708_101669031 173
74 3300042006 Ga0439432_194927 Ga0439432_194927_29_577 173
75 3300042876 Ga0451577_0692769 Ga0451577_0692769_362_913 173
76 3300046472 Ga0495580_0100589 Ga0495580_0100589_479_1039 173
77 3300046517 Ga0495630_0227584 Ga0495630_0227584_792_1352 173
78 3300046529 Ga0495652_0193712 Ga0495652_0193712_859_1509 173
79 3300046648 Ga0495611_0042857 Ga0495611_0042857_221_781 173
80 3300046675 Ga0495657_0188227 Ga0495657_0188227_120_680 173
81 3300047319 Ga0495674_0163607 Ga0495674_0163607_742_1302 173
82 3300047321 Ga0495676_0164088 Ga0495676_0164088_290_850 173
83 3300053085 Ga0495619_0145252 Ga0495619_0145252_488_1048 173
84 3300002459 JGI24751J29686_10002473 JGI24751J29686_100024732 174
85 3300005289 Ga0065704_10086117 Ga0065704_100861172 174
86 3300005290 Ga0065712_10001194 Ga0065712_1000119410 174
87 3300005290 Ga0065712_10096974 Ga0065712_100969742 174
88 3300005293 Ga0065715_10182249 Ga0065715_101822492 174
89 3300005295 Ga0065707_10011976 Ga0065707_100119763 174
90 3300005327 Ga0070658_10219329 Ga0070658_102193292 174
91 3300005328 Ga0070676_10582107 Ga0070676_105821071 174
92 3300005329 Ga0070683_100001600 Ga0070683_1000016009 174
93 3300005329 Ga0070683_100012033 Ga0070683_1000120334 174
94 3300005329 Ga0070683_100084866 Ga0070683_1000848663 174
95 3300005330 Ga0070690_100050368 Ga0070690_1000503684 174
96 3300005330 Ga0070690_100057802 Ga0070690_1000578023 174
97 3300005331 Ga0070670_100037396 Ga0070670_1000373965 174
98 3300005331 Ga0070670_100052540 Ga0070670_1000525404 174
99 3300005331 Ga0070670_100451093 Ga0070670_1004510931 174
100 3300005334 Ga0068869_100025742 Ga0068869_1000257422 174
101 3300005334 Ga0068869_100029859 Ga0068869_1000298594 174
102 3300005334 Ga0068869_100058462 Ga0068869_1000584624 174
103 3300005334 Ga0068869_100116956 Ga0068869_1001169562 174
104 3300005334 Ga0068869_100149090 Ga0068869_1001490903 174
105 3300005334 Ga0068869_100494017 Ga0068869_1004940172 174
106 3300005334 Ga0068869_101077461 Ga0068869_1010774611 174
107 3300005335 Ga0070666_10000042 Ga0070666_1000004213 174
108 3300005335 Ga0070666_10075850 Ga0070666_100758503 174
109 3300005335 Ga0070666_10388422 Ga0070666_103884221 174
110 3300005337 Ga0070682_100099133 Ga0070682_1000991333 174
111 3300005337 Ga0070682_101018920 Ga0070682_1010189201 174
112 3300005338 Ga0068868_100005165 Ga0068868_1000051652 174
113 3300005338 Ga0068868_100018531 Ga0068868_1000185314 174
114 3300005338 Ga0068868_100093717 Ga0068868_1000937172 174
115 3300005338 Ga0068868_100365369 Ga0068868_1003653692 174
116 3300005339 Ga0070660_100126256 Ga0070660_1001262563 174
117 3300005339 Ga0070660_100223248 Ga0070660_1002232481 174
118 3300005340 Ga0070689_100024224 Ga0070689_1000242245 174
119 3300005340 Ga0070689_100873976 Ga0070689_1008739762 174
120 3300005353 Ga0070669_100079437 Ga0070669_1000794373 174
121 3300005353 Ga0070669_100135290 Ga0070669_1001352902 174
122 3300005353 Ga0070669_100238255 Ga0070669_1002382552 174
123 3300005354 Ga0070675_100012300 Ga0070675_1000123007 174
124 3300005354 Ga0070675_100052455 Ga0070675_1000524555 174
125 3300005354 Ga0070675_100211705 Ga0070675_1002117052 174
126 3300005354 Ga0070675_100605204 Ga0070675_1006052041 174
127 3300005355 Ga0070671_100097556 Ga0070671_1000975562 174
128 3300005355 Ga0070671_100633003 Ga0070671_1006330031 174
129 3300005356 Ga0070674_100106053 Ga0070674_1001060532 174
130 3300005364 Ga0070673_100027073 Ga0070673_1000270738 174
131 3300005364 Ga0070673_100060608 Ga0070673_1000606081 174
132 3300005364 Ga0070673_100092570 Ga0070673_1000925702 174
133 3300005365 Ga0070688_100016133 Ga0070688_1000161335 174
134 3300005366 Ga0070659_100013972 Ga0070659_1000139729 174
135 3300005366 Ga0070659_100283668 Ga0070659_1002836682 174
136 3300005366 Ga0070659_101271503 Ga0070659_1012715031 174
137 3300005367 Ga0070667_100014284 Ga0070667_1000142842 174
138 3300005441 Ga0070700_100183409 Ga0070700_1001834092 174
139 3300005441 Ga0070700_100232526 Ga0070700_1002325261 174
140 3300005456 Ga0070678_100174738 Ga0070678_1001747382 174
141 3300005456 Ga0070678_100528332 Ga0070678_1005283322 174
142 3300005456 Ga0070678_100612647 Ga0070678_1006126471 174
143 3300005457 Ga0070662_100005292 Ga0070662_1000052923 174
144 3300005457 Ga0070662_100332773 Ga0070662_1003327732 174
145 3300005458 Ga0070681_10080272 Ga0070681_100802723 174
146 3300005458 Ga0070681_10348972 Ga0070681_103489722 174
147 3300005466 Ga0070685_10035486 Ga0070685_100354864 174
148 3300005471 Ga0070698_100029464 Ga0070698_1000294644 174
149 3300005530 Ga0070679_100026769 Ga0070679_1000267695 174
150 3300005535 Ga0070684_100004763 Ga0070684_1000047639 174
151 3300005535 Ga0070684_100004993 Ga0070684_1000049936 174
152 3300005539 Ga0068853_100004129 Ga0068853_1000041299 174
153 3300005539 Ga0068853_100062129 Ga0068853_1000621292 174
154 3300005539 Ga0068853_100142056 Ga0068853_1001420563 174
155 3300005563 Ga0068855_100065172 Ga0068855_1000651722 174
156 3300005564 Ga0070664_100002698 Ga0070664_10000269810 174
157 3300005564 Ga0070664_100003151 Ga0070664_1000031519 174
158 3300005564 Ga0070664_100405758 Ga0070664_1004057582 174
159 3300005564 Ga0070664_100421759 Ga0070664_1004217592 174
160 3300005577 Ga0068857_100126028 Ga0068857_1001260284 174
161 3300005577 Ga0068857_100366621 Ga0068857_1003666212 174
162 3300005578 Ga0068854_100013175 Ga0068854_1000131756 174
163 3300005614 Ga0068856_100068021 Ga0068856_1000680214 174
164 3300005614 Ga0068856_100717065 Ga0068856_1007170652 174
165 3300005616 Ga0068852_100003800 Ga0068852_10000380011 174
166 3300005616 Ga0068852_100007857 Ga0068852_1000078577 174
167 3300005617 Ga0068859_100000768 Ga0068859_10000076811 174
168 3300005617 Ga0068859_100389295 Ga0068859_1003892952 174
169 3300005618 Ga0068864_100082025 Ga0068864_1000820254 174
170 3300005618 Ga0068864_100401335 Ga0068864_1004013351 174
171 3300005618 Ga0068864_101408549 Ga0068864_1014085491 174
172 3300005834 Ga0068851_10081142 Ga0068851_100811422 174
173 3300005840 Ga0068870_10074249 Ga0068870_100742491 174
174 3300005841 Ga0068863_100084614 Ga0068863_1000846145 174
175 3300005841 Ga0068863_100128182 Ga0068863_1001281823 174
176 3300005841 Ga0068863_100306477 Ga0068863_1003064771 174
177 3300005841 Ga0068863_100598557 Ga0068863_1005985571 174
178 3300005841 Ga0068863_100658628 Ga0068863_1006586282 174
179 3300005842 Ga0068858_100024001 Ga0068858_1000240014 174
180 3300005842 Ga0068858_100034737 Ga0068858_1000347376 174
181 3300005842 Ga0068858_100357358 Ga0068858_1003573582 174
182 3300005843 Ga0068860_100083787 Ga0068860_1000837874 174
183 3300005844 Ga0068862_100152151 Ga0068862_1001521513 174
184 3300006237 Ga0097621_100009202 Ga0097621_1000092027 174
185 3300006237 Ga0097621_100024760 Ga0097621_1000247606 174
186 3300006237 Ga0097621_100036578 Ga0097621_1000365786 174
187 3300006237 Ga0097621_100092023 Ga0097621_1000920233 174
188 3300006237 Ga0097621_100188646 Ga0097621_1001886461 174
189 3300006237 Ga0097621_100428970 Ga0097621_1004289701 174
190 3300006237 Ga0097621_100624215 Ga0097621_1006242152 174
191 3300006237 Ga0097621_100706368 Ga0097621_1007063681 174
192 3300006358 Ga0068871_100065599 Ga0068871_1000655992 174
193 3300006358 Ga0068871_100098379 Ga0068871_1000983794 174
194 3300006358 Ga0068871_100198891 Ga0068871_1001988912 174
195 3300006358 Ga0068871_101518776 Ga0068871_1015187761 174
196 3300006844 Ga0075428_100971815 Ga0075428_1009718152 174
197 3300006846 Ga0075430_100076718 Ga0075430_1000767182 174
198 3300006880 Ga0075429_100269057 Ga0075429_1002690572 174
199 3300006881 Ga0068865_100362206 Ga0068865_1003622062 174
200 3300006931 Ga0097620_100000768 Ga0097620_10000076811 174
201 3300006931 Ga0097620_100389287 Ga0097620_1003892872 174
202 3300009093 Ga0105240_10253693 Ga0105240_102536932 174
203 3300009093 Ga0105240_10265943 Ga0105240_102659432 174
204 3300009093 Ga0105240_10312264 Ga0105240_103122641 174
205 3300009094 Ga0111539_10018254 Ga0111539_1001825412 174
206 3300009094 Ga0111539_10041305 Ga0111539_100413056 174
207 3300009094 Ga0111539_10099759 Ga0111539_100997592 174
208 3300009094 Ga0111539_10467128 Ga0111539_104671283 174
209 3300009101 Ga0105247_10054600 Ga0105247_100546002 174
210 3300009101 Ga0105247_10331147 Ga0105247_103311472 174
211 3300009101 Ga0105247_10913096 Ga0105247_109130961 174
212 3300009147 Ga0114129_10065386 Ga0114129_100653865 174
213 3300009147 Ga0114129_10200659 Ga0114129_102006592 174
214 3300009174 Ga0105241_10000853 Ga0105241_100008538 174
215 3300009174 Ga0105241_10294418 Ga0105241_102944182 174
216 3300009176 Ga0105242_10051728 Ga0105242_100517282 174
217 3300009176 Ga0105242_10702998 Ga0105242_107029982 174
218 3300009177 Ga0105248_10169223 Ga0105248_101692234 174
219 3300009545 Ga0105237_10124870 Ga0105237_101248703 174
220 3300009545 Ga0105237_10573781 Ga0105237_105737812 174
221 3300009553 Ga0105249_10010246 Ga0105249_100102469 174
222 3300009553 Ga0105249_10027531 Ga0105249_100275315 174
223 3300010375 Ga0105239_10136826 Ga0105239_101368261 174
224 3300011119 Ga0105246_10003384 Ga0105246_1000338414 174
225 3300011119 Ga0105246_10024300 Ga0105246_100243005 174
226 3300011119 Ga0105246_10782223 Ga0105246_107822231 174
227 3300013100 Ga0157373_10013015 Ga0157373_100130154 174
228 3300013100 Ga0157373_10072400 Ga0157373_100724003 174
229 3300013100 Ga0157373_10076585 Ga0157373_100765853 174
230 3300013102 Ga0157371_10013219 Ga0157371_100132192 174
231 3300013102 Ga0157371_10181143 Ga0157371_101811432 174
232 3300013102 Ga0157371_10297752 Ga0157371_102977522 174
233 3300013104 Ga0157370_10110586 Ga0157370_101105862 174
234 3300013105 Ga0157369_10005463 Ga0157369_100054634 174
235 3300013105 Ga0157369_10024028 Ga0157369_100240287 174
236 3300013105 Ga0157369_10785503 Ga0157369_107855032 174
237 3300013296 Ga0157374_10012862 Ga0157374_100128624 174
238 3300013296 Ga0157374_10109734 Ga0157374_101097345 174
239 3300013296 Ga0157374_10261289 Ga0157374_102612892 174
240 3300013296 Ga0157374_10686147 Ga0157374_106861471 174
241 3300013296 Ga0157374_11018518 Ga0157374_110185181 174
242 3300013297 Ga0157378_10000981 Ga0157378_1000098118 174
243 3300013297 Ga0157378_10029706 Ga0157378_100297064 174
244 3300013297 Ga0157378_10073750 Ga0157378_100737504 174
245 3300013297 Ga0157378_10082262 Ga0157378_100822622 174
246 3300013297 Ga0157378_10125896 Ga0157378_101258962 174
247 3300013297 Ga0157378_11154936 Ga0157378_111549362 174
248 3300013306 Ga0163162_10019946 Ga0163162_100199461 174
249 3300013306 Ga0163162_10025120 Ga0163162_100251209 174
250 3300013306 Ga0163162_10043575 Ga0163162_100435754 174
251 3300013306 Ga0163162_10044216 Ga0163162_100442162 174
252 3300013306 Ga0163162_10067459 Ga0163162_100674594 174
253 3300013306 Ga0163162_10833229 Ga0163162_108332292 174
254 3300013307 Ga0157372_10148395 Ga0157372_101483954 174
255 3300013307 Ga0157372_10295762 Ga0157372_102957622 174
256 3300013308 Ga0157375_10004375 Ga0157375_1000437510 174
257 3300013308 Ga0157375_10027163 Ga0157375_100271633 174
258 3300013308 Ga0157375_10052094 Ga0157375_100520944 174
259 3300013308 Ga0157375_10266430 Ga0157375_102664302 174
260 3300013308 Ga0157375_10439382 Ga0157375_104393822 174
261 3300013308 Ga0157375_11129321 Ga0157375_111293212 174
262 3300013308 Ga0157375_11668043 Ga0157375_116680431 174
263 3300014325 Ga0163163_10096128 Ga0163163_100961282 174
264 3300014325 Ga0163163_10486795 Ga0163163_104867951 174
265 3300014326 Ga0157380_10175610 Ga0157380_101756101 174
266 3300014326 Ga0157380_10242799 Ga0157380_102427992 174
267 3300014326 Ga0157380_10581891 Ga0157380_105818911 174
268 3300014968 Ga0157379_10321396 Ga0157379_103213962 174
269 3300014969 Ga0157376_10059441 Ga0157376_100594413 174
270 3300014969 Ga0157376_10248842 Ga0157376_102488422 174
271 3300014969 Ga0157376_10250581 Ga0157376_102505811 174
272 3300014969 Ga0157376_10601904 Ga0157376_106019042 174
273 3300014969 Ga0157376_10849587 Ga0157376_108495872 174
274 3300017792 Ga0163161_10008583 Ga0163161_100085835 174
275 3300017792 Ga0163161_10310018 Ga0163161_103100182 174
276 3300017792 Ga0163161_10460441 Ga0163161_104604411 174
277 3300017792 Ga0163161_10505698 Ga0163161_105056982 174
278 3300025298 Ga0209050_1057795 Ga0209050_10577952 174
279 3300025321 Ga0207656_10414530 Ga0207656_104145301 174
280 3300025899 Ga0207642_10088550 Ga0207642_100885502 174
281 3300025903 Ga0207680_10000448 Ga0207680_1000044813 174
282 3300025907 Ga0207645_10008025 Ga0207645_100080253 174
283 3300025907 Ga0207645_10013380 Ga0207645_100133802 174
284 3300025908 Ga0207643_10591105 Ga0207643_105911051 174
285 3300025911 Ga0207654_10013270 Ga0207654_100132703 174
286 3300025911 Ga0207654_10295014 Ga0207654_102950141 174
287 3300025912 Ga0207707_10121698 Ga0207707_101216981 174
288 3300025917 Ga0207660_10174221 Ga0207660_101742212 174
289 3300025918 Ga0207662_10014701 Ga0207662_100147013 174
290 3300025919 Ga0207657_10002477 Ga0207657_1000247710 174
291 3300025921 Ga0207652_10563186 Ga0207652_105631862 174
292 3300025923 Ga0207681_11046403 Ga0207681_110464031 174
293 3300025925 Ga0207650_10025254 Ga0207650_100252544 174
294 3300025926 Ga0207659_10116189 Ga0207659_101161893 174
295 3300025931 Ga0207644_10063071 Ga0207644_100630716 174
296 3300025931 Ga0207644_10563618 Ga0207644_105636181 174
297 3300025931 Ga0207644_10573679 Ga0207644_105736792 174
298 3300025932 Ga0207690_10097803 Ga0207690_100978032 174
299 3300025932 Ga0207690_10450141 Ga0207690_104501412 174
300 3300025933 Ga0207706_10064374 Ga0207706_100643745 174
301 3300025934 Ga0207686_10035820 Ga0207686_100358203 174
302 3300025934 Ga0207686_10086417 Ga0207686_100864172 174
303 3300025936 Ga0207670_10021583 Ga0207670_100215832 174
304 3300025937 Ga0207669_10067624 Ga0207669_100676242 174
305 3300025937 Ga0207669_10794795 Ga0207669_107947952 174
306 3300025938 Ga0207704_10059717 Ga0207704_100597172 174
307 3300025938 Ga0207704_10662183 Ga0207704_106621831 174
308 3300025940 Ga0207691_11284656 Ga0207691_112846561 174
309 3300025942 Ga0207689_10008911 Ga0207689_100089117 174
310 3300025942 Ga0207689_10009963 Ga0207689_100099632 174
311 3300025942 Ga0207689_10036403 Ga0207689_100364033 174
312 3300025942 Ga0207689_10055119 Ga0207689_100551194 174
313 3300025942 Ga0207689_10097532 Ga0207689_100975322 174
314 3300025942 Ga0207689_10114750 Ga0207689_101147502 174
315 3300025942 Ga0207689_10306985 Ga0207689_103069851 174
316 3300025944 Ga0207661_10009347 Ga0207661_100093476 174
317 3300025944 Ga0207661_10203862 Ga0207661_102038621 174
318 3300025945 Ga0207679_10110430 Ga0207679_101104303 174
319 3300025945 Ga0207679_10465509 Ga0207679_104655092 174
320 3300025949 Ga0207667_10305601 Ga0207667_103056011 174
321 3300025949 Ga0207667_10340090 Ga0207667_103400901 174
322 3300025960 Ga0207651_10120582 Ga0207651_101205822 174
323 3300025960 Ga0207651_10341854 Ga0207651_103418541 174
324 3300025961 Ga0207712_10006327 Ga0207712_100063278 174
325 3300025961 Ga0207712_10010882 Ga0207712_100108825 174
326 3300025981 Ga0207640_11071391 Ga0207640_110713912 174
327 3300025986 Ga0207658_10395322 Ga0207658_103953222 174
328 3300025986 Ga0207658_10411569 Ga0207658_104115691 174
329 3300026023 Ga0207677_10006590 Ga0207677_100065908 174
330 3300026023 Ga0207677_10036751 Ga0207677_100367511 174
331 3300026023 Ga0207677_10275568 Ga0207677_102755682 174
332 3300026023 Ga0207677_10779985 Ga0207677_107799852 174
333 3300026035 Ga0207703_10024333 Ga0207703_100243332 174
334 3300026035 Ga0207703_10813823 Ga0207703_108138232 174
335 3300026035 Ga0207703_10877053 Ga0207703_108770532 174
336 3300026035 Ga0207703_11685877 Ga0207703_116858771 174
337 3300026041 Ga0207639_10019816 Ga0207639_100198163 174
338 3300026041 Ga0207639_10108447 Ga0207639_101084472 174
339 3300026067 Ga0207678_10101247 Ga0207678_101012472 174
340 3300026075 Ga0207708_10074703 Ga0207708_100747033 174
341 3300026075 Ga0207708_10393413 Ga0207708_103934132 174
342 3300026088 Ga0207641_10005736 Ga0207641_100057368 174
343 3300026088 Ga0207641_10320583 Ga0207641_103205832 174
344 3300026089 Ga0207648_10035158 Ga0207648_100351583 174
345 3300026089 Ga0207648_10077133 Ga0207648_100771334 174
346 3300026089 Ga0207648_10416124 Ga0207648_104161242 174
347 3300026089 Ga0207648_10786156 Ga0207648_107861561 174
348 3300026089 Ga0207648_11626068 Ga0207648_116260681 174
349 3300026095 Ga0207676_10035708 Ga0207676_100357087 174
350 3300026095 Ga0207676_10107827 Ga0207676_101078271 174
351 3300026095 Ga0207676_10201135 Ga0207676_102011353 174
352 3300026095 Ga0207676_10808992 Ga0207676_108089922 174
353 3300026116 Ga0207674_10118109 Ga0207674_101181093 174
354 3300026116 Ga0207674_10146725 Ga0207674_101467252 174
355 3300026116 Ga0207674_10158422 Ga0207674_101584222 174
356 3300026116 Ga0207674_10398572 Ga0207674_103985722 174
357 3300026118 Ga0207675_100509626 Ga0207675_1005096261 174
358 3300026118 Ga0207675_100613972 Ga0207675_1006139721 174
359 3300026118 Ga0207675_100886029 Ga0207675_1008860291 174
360 3300026121 Ga0207683_10170547 Ga0207683_101705474 174
361 3300026121 Ga0207683_10281917 Ga0207683_102819172 174
362 3300026121 Ga0207683_11020685 Ga0207683_110206851 174
363 3300026142 Ga0207698_10002653 Ga0207698_100026536 174
364 3300026142 Ga0207698_10099182 Ga0207698_100991821 174
365 3300028380 Ga0268265_10133483 Ga0268265_101334834 174
366 3300028381 Ga0268264_10337943 Ga0268264_103379432 174
367 3300028381 Ga0268264_10747463 Ga0268264_107474632 174
368 3300028573 Ga0265334_10010041 Ga0265334_100100414 174
369 3300028577 Ga0265318_10008009 Ga0265318_100080095 174
370 3300028653 Ga0265323_10080200 Ga0265323_100802001 174
371 3300028654 Ga0265322_10027576 Ga0265322_100275762 174
372 3300028794 Ga0307515_10022252 Ga0307515_100222522 174
373 3300028794 Ga0307515_10023206 Ga0307515_1002320612 174
374 3300028800 Ga0265338_10132602 Ga0265338_101326022 174
375 3300031240 Ga0265320_10058421 Ga0265320_100584212 174
376 3300031247 Ga0265340_10013130 Ga0265340_100131304 174
377 3300031250 Ga0265331_10018207 Ga0265331_100182072 174
378 3300031456 Ga0307513_10002630 Ga0307513_100026307 174
379 3300031507 Ga0307509_10100901 Ga0307509_101009012 174
380 3300031548 Ga0307408_100000346 Ga0307408_10000034629 174
381 3300035119 Ga0373956_0147181 Ga0373956_0147181_378_1031 174
382 3300035172 Ga0373955_0025143 Ga0373955_0025143_115_768 174
383 3300035691 Ga0373931_0549225 Ga0373931_0549225_46_624 174
384 3300035724 Ga0373933_0073573 Ga0373933_0073573_18_581 174
385 3300036401 Ga0373937_0026802 Ga0373937_0026802_3132_3785 174
386 3300038443 Ga0395901_1186768 Ga0395901_1186768_26_616 174
387 3300041453 Ga0451797_1078936 Ga0451797_1078936_206_772 174
388 3300041486 Ga0451807_1134984 Ga0451807_1134984_271_825 174
389 3300042461 Ga0439460_0067251 Ga0439460_0067251_343_906 174
390 3300042876 Ga0451577_0000072 Ga0451577_0000072_153180_153746 174
391 3300042876 Ga0451577_0110179 Ga0451577_0110179_943_1497 174
392 3300042876 Ga0451577_0140623 Ga0451577_0140623_1398_1964 174
393 3300042876 Ga0451577_0364449 Ga0451577_0364449_586_1140 174
394 3300044673 Ga0453683_0000604 Ga0453683_0000604_36683_37249 174
395 3300044712 Ga0453684_0000186 Ga0453684_0000186_119557_120123 174
396 3300044712 Ga0453684_0053728 Ga0453684_0053728_4343_4909 174
397 3300044712 Ga0453684_0204031 Ga0453684_0204031_1075_1629 174
398 3300044712 Ga0453684_0347190 Ga0453684_0347190_621_1181 174
399 3300045051 Ga0451576_0000065 Ga0451576_0000065_120700_121266 174
400 3300045051 Ga0451576_0850781 Ga0451576_0850781_294_860 174
401 3300045051 Ga0451576_0873889 Ga0451576_0873889_73_627 174
402 3300046460 Ga0495638_0035213 Ga0495638_0035213_1076_1642 174
403 3300046472 Ga0495580_0216636 Ga0495580_0216636_387_941 174
404 3300046477 Ga0495664_0088526 Ga0495664_0088526_819_1472 174
405 3300046499 Ga0495594_0239268 Ga0495594_0239268_55_618 174
406 3300046513 Ga0495616_0015370 Ga0495616_0015370_2512_3066 174
407 3300046516 Ga0495628_0132282 Ga0495628_0132282_576_1229 174
408 3300046536 Ga0495587_0045602 Ga0495587_0045602_1396_2049 174
409 3300046537 Ga0495598_0133414 Ga0495598_0133414_67_630 174
410 3300046537 Ga0495598_0182286 Ga0495598_0182286_96_659 174
411 3300046539 Ga0495621_0115862 Ga0495621_0115862_154_717 174
412 3300046616 Ga0495668_0082649 Ga0495668_0082649_422_976 174
413 3300046642 Ga0495634_0063647 Ga0495634_0063647_1617_2270 174
414 3300046675 Ga0495657_0037939 Ga0495657_0037939_1225_1788 174
415 3300046809 Ga0495600_0338817 Ga0495600_0338817_72_725 174
416 3300047471 Ga0495684_0058138 Ga0495684_0058138_484_1146 174
417 3300047472 Ga0495686_0020405 Ga0495686_0020405_687_1241 174
418 3300048909 Ga0496106_1103252 Ga0496106_1103252_13_567 174
419 3300048917 Ga0496114_1271066 Ga0496114_1271066_14_577 174
420 3300049576 Ga0501040_0361525 Ga0501040_0361525_435_989 174
421 3300050493 nmdc:mga0k408_3656_c1 nmdc:mga0k408_3656_c1_2187_2783 174
422 3300050508 nmdc:mga09592_166118_c1 nmdc:mga09592_166118_c1_765_1328 174
423 3300050509 nmdc:mga0qj67_380073_c1 nmdc:mga0qj67_380073_c1_353_916 174
424 3300050510 nmdc:mga06r32_570936_c1 nmdc:mga06r32_570936_c1_19_582 174
425 3300050511 nmdc:mga08y16_12046_c1 nmdc:mga08y16_12046_c1_2372_2953 174
426 3300050511 nmdc:mga08y16_307766_c1 nmdc:mga08y16_307766_c1_245_844 174
427 3300050511 nmdc:mga08y16_439207_c1 nmdc:mga08y16_439207_c1_59_613 174
428 3300050512 nmdc:mga0n895_555928_c1 nmdc:mga0n895_555928_c1_446_1000 174
429 3300053153 Ga0500616_0018666 Ga0500616_0018666_2102_2656 174
430 3300053156 Ga0500622_0003772 Ga0500622_0003772_1429_1986 174
431 3300053727 Ga0500611_000037 Ga0500611_000037_14331_14897 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

32

209

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8018 12 170
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7873 6 171
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7542 11 170
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7498 3 173
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7421 22 170
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7937 12 169 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7737 6 174 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.752 11 170 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7434 3 170 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7421 22 170 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A3C1RF82-F1-model_v4 Dihydrofolate reductase 0.9721 14 174 GO:0008703
GO:0009231
AF-A0A3C1RF82-F1-model_v4 Dihydrofolate reductase 0.9433 14 174 GO:0008703
GO:0009231
AF-S3V117-F1-model_v4 deleted 0.939 56 172
AF-A0A410G0X1-F1-model_v4 Uncharacterized protein 0.9323 1 173 GO:0008703
GO:0009231
AF-A0A1G7D7N8-F1-model_v4 deleted 0.9321 12 134

Feature Viewer

pLDDT pTM Quality
86.11 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map