F442451

General Info

Members Datasets Scaffolds Average Seq Length
431 254 396 263

Family's Representative Sequence

Representative Sequence 3300046692|Ga0495671_0084223|Ga0495671_0084223_154_1095
Length 313
Sequence MIIWAFPQRVAGLSAHTPAGLVPIFIGSLRSGPVSAAIPNAGFCLIKTMNYTPPQLRTVNVTRYVTPLREGGSLPAIAEADDEFLYVLKFRGAGQGVKALIAELIGGEIARLLGFKVPELVFANLDEAFGRSEADEEIQDLLKFSVGLNLALHYLSGAITFDPAVTIVDAKLASQIVWFDCLLTNVDRTARNTNMLIWHKELWMIDNGAALYFHHSWHNWQEMAARPFLQVKDHVLLPRANQLDLVDAEFKAILTPEKIRDIVALIPDEWITYRDFEETPDEVRNIYAEFLITRLAASDIFVTAAKQALYAGI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
17 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
18 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
19 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
20 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
21 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
22 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
23 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
24 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
25 2914759650 Rhizosphaericola mali Isolate Rhizosphere
26 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
27 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
28 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
29 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
30 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
31 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
32 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
33 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
34 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
35 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
36 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
40 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
220 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
238 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
253 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
254 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.42
Metatranscriptomes 0.23
Isolates 8.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.34
Nodule 0.46
Rhizoplane 0.93
Rhizosphere 82.13
Stem 0
Stem Tuber 0
Unclassified 11.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1358865 2162886007 Bacteria 1131
2 JGI24736J21556_1021789 3300001904 Bacteria 1005
3 JGI24737J22298_10000018 3300001990 Bacteria 46940
4 JGI24737J22298_10001304 3300001990 Bacteria 8835
5 JGI24735J21928_10000016 3300002067 Bacteria 157028
6 JGI24735J21928_10013304 3300002067 Bacteria 2588
7 JGI24744J21845_10015931 3300002077 Bacteria 1499
8 JGI25157J39369_1004803 3300002741 Bacteria 2350
9 JGI25157J39369_1010882 3300002741 Bacteria 1189
10 rootH1_10004109 3300003316 Bacteria 5999
11 rootH1_10037755 3300003316 Bacteria 3728
12 rootH1_10066407 3300003316 Bacteria 10110
13 rootH2_10016754 3300003320 Bacteria 51558
14 rootH2_10044421 3300003320 Bacteria 8661
15 rootH1_10029362 3300003316 Bacteria 1905
16 rootH1_10029362 3300003323 Bacteria 11059
17 Ga0065714_10064513 3300005288 Bacteria 45040
18 Ga0065704_10121736 3300005289 Bacteria 1761
19 Ga0065715_10239475 3300005293 Bacteria 1204
20 Ga0065715_10239735 3300005293 Bacteria 1178
21 Ga0070676_10000585 3300005328 Bacteria 17633
22 Ga0070683_100380730 3300005329 Bacteria 1345
23 Ga0070666_10255038 3300005335 Bacteria 1242
24 Ga0070682_100000012 3300005337 Bacteria 265658
25 Ga0068868_100004892 3300005338 Bacteria 9406
26 Ga0068868_100367230 3300005338 Bacteria 1236
27 Ga0070660_100008162 3300005339 Bacteria 7318
28 Ga0070689_100241074 3300005340 Bacteria 1489
29 Ga0070691_10001599 3300005341 Bacteria 9795
30 Ga0070692_10229991 3300005345 Bacteria 1100
31 Ga0070675_100167968 3300005354 Bacteria 1890
32 Ga0070671_100152245 3300005355 Bacteria 1953
33 Ga0070674_100086895 3300005356 Bacteria 2247
34 Ga0070659_100000372 3300005366 Bacteria 33822
35 Ga0070659_100013613 3300005366 Bacteria 6060
36 Ga0070708_100452778 3300005445 Bacteria 1211
37 Ga0070663_100000310 3300005455 Bacteria 25165
38 Ga0070678_100012587 3300005456 Bacteria 5268
39 Ga0070662_100000029 3300005457 Bacteria 82498
40 Ga0068867_100000896 3300005459 Bacteria 20195
41 Ga0068867_100064481 3300005459 Bacteria 2724
42 Ga0070685_10240768 3300005466 Unclassified 1194
43 Ga0070706_100001426 3300005467 Bacteria 25273
44 Ga0070698_100035586 3300005471 Bacteria 5148
45 Ga0070679_100012864 3300005530 Bacteria 8008
46 Ga0070679_100225686 3300005530 Bacteria 1833
47 Ga0070679_100567713 3300005530 Bacteria 1078
48 Ga0068853_100002432 3300005539 Bacteria 13929
49 Ga0068853_100292175 3300005539 Bacteria 1505
50 Ga0070672_100053822 3300005543 Bacteria 3148
51 Ga0070672_100126164 3300005543 Bacteria 2099
52 Ga0070665_100000032 3300005548 Bacteria 333352
53 Ga0070665_100000845 3300005548 Bacteria 39974
54 Ga0068855_100101670 3300005563 Bacteria 3309
55 Ga0068857_100012689 3300005577 Bacteria 7343
56 Ga0068854_100216540 3300005578 Bacteria 1513
57 Ga0068856_100000023 3300005614 Bacteria 141671
58 Ga0068856_100030049 3300005614 Bacteria 5311
59 Ga0068852_100033069 3300005616 Bacteria 4289
60 Ga0068852_100772301 3300005616 Bacteria 974
61 Ga0068852_100835928 3300005616 Bacteria 936
62 Ga0068864_100121169 3300005618 Bacteria 2339
63 Ga0068858_100059567 3300005842 Bacteria 3529
64 Ga0068860_100000041 3300005843 Bacteria 227790
65 Ga0068860_100197866 3300005843 Bacteria 1947
66 Ga0075364_10017866 3300006051 Bacteria 4435
67 Ga0075366_10001404 3300006195 Bacteria 12032
68 Ga0075366_10006182 3300006195 Bacteria 6536
69 Ga0097621_100000441 3300006237 Bacteria 29007
70 Ga0075370_10082022 3300006353 Bacteria 1854
71 Ga0068871_100000421 3300006358 Bacteria 29326
72 Ga0068865_100000105 3300006881 Bacteria 43336
73 Ga0079104_1000061 3300006946 Bacteria 161057
74 Ga0105240_10000160 3300009093 Bacteria 137390
75 Ga0105240_10000212 3300009093 Bacteria 117609
76 Ga0105240_10000757 3300009093 Bacteria 58956
77 Ga0105240_10004154 3300009093 Bacteria 22182
78 Ga0105240_10094583 3300009093 Bacteria 3644
79 Ga0105240_10254999 3300009093 Bacteria 2027
80 Ga0105240_10926739 3300009093 Bacteria 936
81 Ga0105245_10073819 3300009098 Bacteria 3103
82 Ga0114129_10066023 3300009147 Bacteria 5047
83 Ga0114129_10242283 3300009147 Bacteria 2424
84 Ga0114129_11331304 3300009147 Bacteria 889
85 Ga0105243_10000006 3300009148 Bacteria 465541
86 Ga0105241_10000373 3300009174 Bacteria 34154
87 Ga0105241_10000834 3300009174 Bacteria 23357
88 Ga0105241_10002970 3300009174 Bacteria 12655
89 Ga0105241_10078784 3300009174 Bacteria 2575
90 Ga0105241_10089676 3300009174 Bacteria 2423
91 Ga0105241_10115191 3300009174 Bacteria 2157
92 Ga0105242_10015332 3300009176 Bacteria 5951
93 Ga0105242_10601402 3300009176 Bacteria 1062
94 Ga0105237_10000331 3300009545 Bacteria 66733
95 Ga0105237_10001699 3300009545 Bacteria 28501
96 Ga0105237_10003380 3300009545 Bacteria 18975
97 Ga0105237_10004940 3300009545 Bacteria 15232
98 Ga0105237_10005255 3300009545 Bacteria 14654
99 Ga0105237_10011977 3300009545 Bacteria 9166
100 Ga0105237_10020231 3300009545 Bacteria 6868
101 Ga0105237_10045574 3300009545 Bacteria 4412
102 Ga0105237_10048384 3300009545 Bacteria 4274
103 Ga0105237_10085898 3300009545 Bacteria 3136
104 Ga0105237_10955687 3300009545 Bacteria 864
105 Ga0105238_10017945 3300009551 Bacteria 7195
106 Ga0105238_10162353 3300009551 Bacteria 2210
107 Ga0105238_10170824 3300009551 Bacteria 2150
108 Ga0105239_10000002 3300010375 Bacteria 610298
109 Ga0105239_10000052 3300010375 Bacteria 164624
110 Ga0105239_10002380 3300010375 Bacteria 23985
111 Ga0105239_10002966 3300010375 Bacteria 21156
112 Ga0105239_10011697 3300010375 Bacteria 9795
113 Ga0105239_10028344 3300010375 Bacteria 6160
114 Ga0105239_10037752 3300010375 Bacteria 5294
115 Ga0105239_10037880 3300010375 Bacteria 5283
116 Ga0105239_10037916 3300010375 Bacteria 5282
117 Ga0105239_10071668 3300010375 Bacteria 3807
118 Ga0105239_10146776 3300010375 Bacteria 2631
119 Ga0105239_10518653 3300010375 Bacteria 1356
120 Ga0105246_10046592 3300011119 Bacteria 2958
121 Ga0157373_10006957 3300013100 Bacteria 8423
122 Ga0157373_10013277 3300013100 Bacteria 6045
123 Ga0157371_10000034 3300013102 Bacteria 223947
124 Ga0157371_10000242 3300013102 Bacteria 78183
125 Ga0157371_10007112 3300013102 Bacteria 9092
126 Ga0157371_10008352 3300013102 Bacteria 8261
127 Ga0157371_10011681 3300013102 Bacteria 6749
128 Ga0157371_10069642 3300013102 Bacteria 2491
129 Ga0157371_10089779 3300013102 Bacteria 2177
130 Ga0157371_10126033 3300013102 Bacteria 1821
131 Ga0157370_10001128 3300013104 Bacteria 33398
132 Ga0157370_10001827 3300013104 Bacteria 26213
133 Ga0157370_10014024 3300013104 Bacteria 8228
134 Ga0157370_10019228 3300013104 Bacteria 6860
135 Ga0157370_10020480 3300013104 Bacteria 6605
136 Ga0157370_10084607 3300013104 Bacteria 2981
137 Ga0157370_10090422 3300013104 Bacteria 2875
138 Ga0157370_10276793 3300013104 Bacteria 1551
139 Ga0157370_10400891 3300013104 Bacteria 1263
140 Ga0157369_10000002 3300013105 Bacteria 524510
141 Ga0157369_10000393 3300013105 Bacteria 58167
142 Ga0157369_10002590 3300013105 Bacteria 21621
143 Ga0157369_10107779 3300013105 Bacteria 2963
144 Ga0157369_10211174 3300013105 Bacteria 2034
145 Ga0157369_10454871 3300013105 Bacteria 1326
146 Ga0157369_10566618 3300013105 Bacteria 1173
147 Ga0157374_10000594 3300013296 Bacteria 32022
148 Ga0157374_10000644 3300013296 Bacteria 30752
149 Ga0157378_10035285 3300013297 Bacteria 4423
150 Ga0157378_10151004 3300013297 Bacteria 2164
151 Ga0163162_10000010 3300013306 Bacteria 302032
152 Ga0163162_10000330 3300013306 Bacteria 43379
153 Ga0163162_10000686 3300013306 Bacteria 31389
154 Ga0163162_10015626 3300013306 Bacteria 7418
155 Ga0163162_10172740 3300013306 Bacteria 2286
156 Ga0157372_10000034 3300013307 Bacteria 174784
157 Ga0157372_10000115 3300013307 Bacteria 84815
158 Ga0157372_10000904 3300013307 Bacteria 32244
159 Ga0157372_10001490 3300013307 Bacteria 25443
160 Ga0157372_10043824 3300013307 Bacteria 4957
161 Ga0157372_10128451 3300013307 Unclassified 2915
162 Ga0157372_10155689 3300013307 Bacteria 2639
163 Ga0157372_10254994 3300013307 Bacteria 2037
164 Ga0157375_10028237 3300013308 Bacteria 5256
165 Ga0157375_10275332 3300013308 Bacteria 1845
166 Ga0157380_10003400 3300014326 Bacteria 10921
167 Ga0182008_10000018 3300014497 Bacteria 230609
168 Ga0182008_10000565 3300014497 Bacteria 27364
169 Ga0182008_10013698 3300014497 Bacteria 4261
170 Ga0157376_10120499 3300014969 Bacteria 2324
171 Ga0182006_1000160 3300015261 Bacteria 71698
172 Ga0182006_1001076 3300015261 Bacteria 17536
173 Ga0182006_1002208 3300015261 Bacteria 10784
174 Ga0182006_1004847 3300015261 Bacteria 6534
175 Ga0182007_10000001 3300015262 Bacteria 1127301
176 Ga0163161_10009579 3300017792 Bacteria 6698
177 Ga0163161_10029874 3300017792 Bacteria 3874
178 Ga0163161_10078036 3300017792 Bacteria 2433
179 Ga0163161_10195395 3300017792 Bacteria 1557
180 Ga0163161_10232156 3300017792 Bacteria 1432
181 Ga0213872_10010846 3300021361 Bacteria 4324
182 Ga0213876_10015921 3300021384 Bacteria 3978
183 Ga0224712_10047099 3300022467 Bacteria 1658
184 Ga0209646_1001577 3300025246 Bacteria 5959
185 Ga0209026_1003556 3300025250 Bacteria 5040
186 Ga0209026_1004207 3300025250 Bacteria 4385
187 Ga0209233_1006380 3300025261 Bacteria 3808
188 Ga0209233_1010353 3300025261 Bacteria 2798
189 Ga0209676_1000001 3300025292 Bacteria 1852142
190 Ga0209050_1000018 3300025298 Bacteria 723263
191 Ga0207426_1000009 3300025302 Bacteria 797229
192 Ga0207647_10000022 3300025904 Bacteria 118094
193 Ga0207647_10000480 3300025904 Bacteria 32267
194 Ga0207647_10002941 3300025904 Bacteria 12819
195 Ga0207645_10000190 3300025907 Bacteria 49657
196 Ga0207654_10000277 3300025911 Bacteria 31254
197 Ga0207654_10138710 3300025911 Bacteria 1548
198 Ga0207654_10174091 3300025911 Bacteria 1400
199 Ga0207654_10239132 3300025911 Bacteria 1213
200 Ga0207695_10000027 3300025913 Bacteria 612456
201 Ga0207695_10000058 3300025913 Bacteria 366582
202 Ga0207695_10001864 3300025913 Bacteria 33004
203 Ga0207695_10006810 3300025913 Bacteria 14730
204 Ga0207695_10008831 3300025913 Bacteria 12549
205 Ga0207695_10046371 3300025913 Bacteria 4607
206 Ga0207695_10074173 3300025913 Unclassified 3464
207 Ga0207671_10000382 3300025914 Bacteria 62807
208 Ga0207671_10007729 3300025914 Bacteria 9263
209 Ga0207671_10009457 3300025914 Bacteria 8147
210 Ga0207671_10011032 3300025914 Bacteria 7397
211 Ga0207671_10021485 3300025914 Bacteria 4896
212 Ga0207671_10046114 3300025914 Bacteria 3224
213 Ga0207671_10153145 3300025914 Bacteria 1782
214 Ga0207671_10311857 3300025914 Bacteria 1244
215 Ga0207657_10018878 3300025919 Bacteria 6566
216 Ga0207657_10145886 3300025919 Bacteria 1930
217 Ga0207652_10009465 3300025921 Bacteria 7832
218 Ga0207694_10128615 3300025924 Bacteria 2028
219 Ga0207694_10181262 3300025924 Bacteria 1708
220 Ga0207687_10060938 3300025927 Bacteria 2663
221 Ga0207644_10161415 3300025931 Bacteria 1742
222 Ga0207690_10000508 3300025932 Bacteria 25218
223 Ga0207690_10008587 3300025932 Bacteria 6061
224 Ga0207690_10036509 3300025932 Bacteria 3183
225 Ga0207706_10000047 3300025933 Bacteria 119022
226 Ga0207686_10211783 3300025934 Bacteria 1394
227 Ga0207709_10000007 3300025935 Bacteria 752025
228 Ga0207704_10000073 3300025938 Bacteria 62449
229 Ga0207665_10300496 3300025939 Bacteria 1200
230 Ga0207691_10090515 3300025940 Bacteria 2742
231 Ga0207691_10230662 3300025940 Bacteria 1603
232 Ga0207667_10061478 3300025949 Bacteria 3929
233 Ga0207667_10359955 3300025949 Bacteria 1484
234 Ga0207667_10411617 3300025949 Bacteria 1376
235 Ga0207667_10438121 3300025949 Bacteria 1329
236 Ga0207651_10036875 3300025960 Bacteria 3197
237 Ga0207677_10021404 3300026023 Bacteria 3950
238 Ga0207677_10314544 3300026023 Bacteria 1299
239 Ga0207639_10008108 3300026041 Bacteria 7182
240 Ga0207639_10011234 3300026041 Bacteria 6211
241 Ga0207639_10120152 3300026041 Bacteria 2158
242 Ga0207639_10220162 3300026041 Bacteria 1639
243 Ga0207678_10011687 3300026067 Bacteria 7708
244 Ga0207702_10000314 3300026078 Bacteria 55437
245 Ga0207648_10000347 3300026089 Bacteria 50952
246 Ga0207648_10033495 3300026089 Bacteria 4532
247 Ga0207674_10010826 3300026116 Bacteria 10283
248 Ga0207683_10009669 3300026121 Bacteria 8218
249 Ga0207698_10808899 3300026142 Bacteria 940
250 Ga0209281_1000156 3300027111 Bacteria 163207
251 Ga0268266_10000030 3300028379 Bacteria 417120
252 Ga0268266_10004662 3300028379 Bacteria 13064
253 Ga0268264_10222610 3300028381 Bacteria 1738
254 Ga0307517_10011656 3300028786 Bacteria 12163
255 Ga0307515_10000001 3300028794 Bacteria 4259510
256 Ga0307515_10060039 3300028794 Bacteria 5436
257 Ga0307515_10100440 3300028794 Bacteria 3502
258 Ga0307515_10245230 3300028794 Bacteria 1554
259 Ga0265338_10019133 3300028800 Bacteria 7288
260 Ga0265327_10050432 3300031251 Bacteria 2178
261 Ga0265327_10073704 3300031251 Bacteria 1702
262 Ga0307509_10015731 3300031507 Bacteria 8807
263 Ga0307509_10164278 3300031507 Bacteria 2112
264 Ga0307514_10237021 3300031649 Bacteria 1098
265 Ga0307405_10000001 3300031731 Bacteria 1731270
266 Ga0307405_10000026 3300031731 Bacteria 118954
267 Ga0307405_10555122 3300031731 Bacteria 930
268 Ga0307406_10004533 3300031901 Bacteria 7568
269 Ga0307407_10000032 3300031903 Bacteria 87003
270 Ga0307412_10311901 3300031911 Bacteria 1248
271 Ga0307416_100000045 3300032002 Bacteria 126832
272 Ga0307414_10110458 3300032004 Bacteria 2091
273 Ga0307414_10135882 3300032004 Bacteria 1917
274 Ga0307414_10139811 3300032004 Bacteria 1894
275 Ga0307414_10246442 3300032004 Unclassified 1482
276 Ga0373941_0015679 3300035115 Bacteria 2048
277 Ga0373956_0044262 3300035119 Bacteria 1984
278 Ga0373955_0004566 3300035172 Bacteria 6135
279 Ga0373937_0001954 3300036401 Bacteria 17273
280 Ga0373925_0135677 3300037068 Bacteria 1923
281 Ga0395899_0000182 3300037312 Bacteria 92470
282 Ga0395899_0001230 3300037312 Bacteria 22392
283 Ga0395900_0000095 3300037418 Bacteria 164383
284 Ga0395900_0000721 3300037418 Bacteria 43960
285 Ga0395900_0017501 3300037418 Bacteria 7313
286 Ga0395900_0537460 3300037418 Bacteria 1115
287 Ga0395898_0009892 3300037466 Bacteria 9999
288 Ga0395905_0000149 3300037471 Bacteria 115709
289 Ga0395905_0052383 3300037471 Bacteria 3820
290 Ga0395901_0000198 3300038443 Bacteria 76490
291 Ga0395901_0006642 3300038443 Bacteria 11687
292 Ga0436365_0614130 3300039437 Bacteria 27402
293 Ga0436361_1137687 3300039447 Bacteria 23236
294 Ga0451807_1277672 3300041486 Bacteria 2871
295 Ga0451837_1512042 3300041494 Bacteria 1135
296 Ga0451853_1065215 3300041512 Bacteria 1157
297 Ga0451853_4074435 3300041512 Unclassified 1206
298 Ga0439448_0022643 3300042005 Bacteria 1955
299 Ga0451577_0167082 3300042876 Bacteria 1982
300 Ga0466969_0097285 3300044656 Bacteria 1389
301 Ga0466966_0048221 3300044684 Bacteria 2713
302 Ga0453684_0017328 3300044712 Bacteria 11167
303 Ga0466957_0007090 3300044842 Bacteria 6337
304 Ga0466959_0119515 3300045049 Bacteria 1875
305 Ga0466958_0144464 3300045836 Bacteria 1499
306 Ga0466958_0235277 3300045836 Bacteria 1170
307 Ga0495627_010636 3300046453 Bacteria 3335
308 Ga0495651_0111409 3300046462 Bacteria 2023
309 Ga0495651_0255992 3300046462 Bacteria 1193
310 Ga0495650_0000280 3300046471 Bacteria 97560
311 Ga0495585_0000062 3300046492 Bacteria 109539
312 Ga0495583_0100250 3300046506 Bacteria 1237
313 Ga0495606_0000003 3300046507 Bacteria 449402
314 Ga0495606_0006459 3300046507 Bacteria 10800
315 Ga0495606_0007777 3300046507 Bacteria 9483
316 Ga0495606_0020377 3300046507 Bacteria 4891
317 Ga0495606_0021730 3300046507 Bacteria 4694
318 Ga0495608_0182697 3300046511 Bacteria 1326
319 Ga0495610_0000438 3300046512 Bacteria 42940
320 Ga0495610_0006227 3300046512 Bacteria 8276
321 Ga0495616_0000785 3300046513 Bacteria 23183
322 Ga0495628_0016298 3300046516 Bacteria 6200
323 Ga0495630_0004859 3300046517 Bacteria 9435
324 Ga0495631_0022133 3300046518 Unclassified 2956
325 Ga0495637_0050152 3300046520 Bacteria 1751
326 Ga0495637_0069748 3300046520 Bacteria 1421
327 Ga0495643_0001478 3300046522 Bacteria 21446
328 Ga0495648_0249459 3300046524 Bacteria 858
329 Ga0495652_0087178 3300046529 Bacteria 2561
330 Ga0495621_0011623 3300046539 Bacteria 2729
331 Ga0495633_0000969 3300046558 Bacteria 23561
332 Ga0495667_0030982 3300046559 Bacteria 3592
333 Ga0495634_0020576 3300046642 Bacteria 4678
334 Ga0495611_0000015 3300046648 Bacteria 129696
335 Ga0495625_0000013 3300046660 Bacteria 345151
336 Ga0495625_0014099 3300046660 Bacteria 6395
337 Ga0495661_0000707 3300046665 Bacteria 33018
338 Ga0495661_0002423 3300046665 Bacteria 14355
339 Ga0495661_0064446 3300046665 Bacteria 2162
340 Ga0495657_0116246 3300046675 Bacteria 1689
341 Ga0495658_0246533 3300046683 Bacteria 1123
342 Ga0495613_0143935 3300046689 Bacteria 1702
343 Ga0495671_0084223 3300046692 Bacteria 1558
344 Ga0495649_0000010 3300046694 Bacteria 430552
345 Ga0495600_0119653 3300046809 Bacteria 1713
346 Ga0495660_0003973 3300046810 Bacteria 9028
347 Ga0495674_0148814 3300047319 Bacteria 1964
348 Ga0495672_0028697 3300047320 Bacteria 3515
349 Ga0495672_0037518 3300047320 Bacteria 2963
350 Ga0495672_0078848 3300047320 Bacteria 1841
351 Ga0495687_003782 3300047443 Bacteria 10686
352 Ga0495687_016713 3300047443 Bacteria 3682
353 Ga0495679_033965 3300047446 Bacteria 1626
354 Ga0495685_017775 3300047447 Bacteria 2437
355 Ga0495686_0000516 3300047472 Bacteria 55884
356 Ga0495686_0002234 3300047472 Bacteria 18719
357 Ga0495686_0055775 3300047472 Bacteria 2470
358 Ga0496108_0242482 3300048911 Bacteria 1568
359 Ga0496112_0045622 3300048915 Bacteria 4297
360 Ga0496117_0001275 3300048920 Bacteria 37368
361 Ga0496118_0205668 3300048921 Bacteria 1161
362 Ga0496122_0058313 3300048925 Bacteria 2859
363 Ga0496123_0002282 3300048926 Bacteria 24113
364 Ga0496123_0021055 3300048926 Bacteria 5081
365 Ga0496124_0066105 3300048927 Bacteria 3013
366 Ga0496125_0000185 3300048928 Bacteria 135607
367 Ga0496125_0039625 3300048928 Bacteria 4054
368 Ga0496126_0358628 3300048929 Bacteria 1191
369 Ga0501032_0035785 3300049569 Bacteria 3393
370 Ga0501033_0107511 3300049570 Bacteria 2032
371 Ga0501033_0266736 3300049570 Bacteria 1211
372 Ga0501034_0111715 3300049571 Bacteria 2723
373 Ga0501034_0334113 3300049571 Bacteria 1446
374 Ga0501038_0213919 3300049574 Bacteria 1541
375 Ga0501043_0060633 3300049579 Bacteria 2970
376 Ga0501047_0004399 3300049581 Bacteria 13262
377 Ga0501047_0081256 3300049581 Bacteria 3116
378 Ga0501047_0109635 3300049581 Bacteria 2643
379 Ga0501198_001956 3300049649 Bacteria 2737
380 Ga0501223_002032 3300049663 Bacteria 4536
381 Ga0501044_0046745 3300049823 Bacteria 4480
382 nmdc:mga00v17_13415_c1 3300050491 Bacteria 4548
383 nmdc:mga0k408_1769_c1 3300050493 Bacteria 11585
384 nmdc:mga0k408_44149_c1 3300050493 Bacteria 2570
385 nmdc:mga07m45_305014_c1 3300050496 Bacteria 926
386 nmdc:mga05p37_250165_c1 3300050507 Bacteria 2126
387 Ga0500635_0000742 3300053080 Bacteria 8157
388 Ga0500583_0001042 3300053092 Bacteria 7917
389 Ga0500641_0000137 3300053096 Bacteria 27164
390 Ga0500641_0000544 3300053096 Bacteria 13641
391 Ga0500556_0040272 3300053104 Bacteria 1641
392 Ga0500608_000501 3300053122 Bacteria 14634
393 Ga0500604_0003576 3300053151 Bacteria 4183
394 Ga0500622_0014238 3300053156 Bacteria 4276
395 Ga0500637_0033627 3300053178 Bacteria 2865
396 Ga0500584_007071 3300053726 Bacteria 4853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005341 Ga0070691_10001599 Ga0070691_100015992 233
2 3300005345 Ga0070692_10229991 Ga0070692_102299911 233
3 3300005530 Ga0070679_100012864 Ga0070679_1000128645 233
4 3300005577 Ga0068857_100012689 Ga0068857_1000126893 233
5 3300013105 Ga0157369_10566618 Ga0157369_105666181 233
6 3300025921 Ga0207652_10009465 Ga0207652_100094655 233
7 3300026116 Ga0207674_10010826 Ga0207674_100108265 233
8 3300010375 Ga0105239_10000052 Ga0105239_10000052139 249
9 3300005842 Ga0068858_100059567 Ga0068858_1000595672 250
10 3300005843 Ga0068860_100000041 Ga0068860_10000004157 250
11 3300013306 Ga0163162_10000686 Ga0163162_1000068622 250
12 3300014326 Ga0157380_10003400 Ga0157380_100034006 251
13 3300013102 Ga0157371_10069642 Ga0157371_100696423 252
14 3300013307 Ga0157372_10155689 Ga0157372_101556892 252
15 3300026142 Ga0207698_10808899 Ga0207698_108088991 255
16 3300031901 Ga0307406_10004533 Ga0307406_100045333 255
17 iso_pu_bacteria 8055592153 8055594223 255
18 3300042876 Ga0451577_0167082 Ga0451577_0167082_97_867 256
19 iso_pu_bacteria 2513020052 2513235096 256
20 iso_pu_bacteria 2881247448 2881249795 256
21 iso_pu_bacteria 2919683626 2919687656 256
22 iso_pu_bacteria 8056440228 8056443901 256
23 3300031649 Ga0307514_10237021 Ga0307514_102370212 257
24 iso_pu_bacteria 2914759650 2914762472 257
25 iso_pu_bacteria 2929239360 2929240657 257
26 3300001904 JGI24736J21556_1021789 JGI24736J21556_10217892 258
27 3300001990 JGI24737J22298_10001304 JGI24737J22298_100013043 258
28 3300002067 JGI24735J21928_10013304 JGI24735J21928_100133042 258
29 3300005329 Ga0070683_100380730 Ga0070683_1003807302 258
30 3300005366 Ga0070659_100013613 Ga0070659_1000136136 258
31 3300010375 Ga0105239_10000002 Ga0105239_10000002199 258
32 3300013100 Ga0157373_10006957 Ga0157373_100069576 258
33 3300013102 Ga0157371_10000242 Ga0157371_100002426 258
34 3300013104 Ga0157370_10014024 Ga0157370_100140246 258
35 3300013105 Ga0157369_10107779 Ga0157369_101077794 258
36 3300013307 Ga0157372_10000115 Ga0157372_1000011539 258
37 3300013307 Ga0157372_10128451 Ga0157372_101284512 258
38 3300025261 Ga0209233_1006380 Ga0209233_10063804 258
39 3300025904 Ga0207647_10000480 Ga0207647_1000048024 258
40 3300025932 Ga0207690_10008587 Ga0207690_100085875 258
41 3300053080 Ga0500635_0000742 Ga0500635_0000742_5265_6041 258
42 iso_pu_bacteria 2883068021 2883069627 258
43 3300005445 Ga0070708_100452778 Ga0070708_1004527781 259
44 3300005467 Ga0070706_100001426 Ga0070706_10000142611 259
45 3300005471 Ga0070698_100035586 Ga0070698_1000355863 259
46 3300006051 Ga0075364_10017866 Ga0075364_100178666 259
47 3300006946 Ga0079104_1000061 Ga0079104_100006183 259
48 3300009147 Ga0114129_11331304 Ga0114129_113313041 259
49 3300027111 Ga0209281_1000156 Ga0209281_100015653 259
50 3300035119 Ga0373956_0044262 Ga0373956_0044262_568_1353 259
51 3300046539 Ga0495621_0011623 Ga0495621_0011623_1286_2071 259
52 3300046683 Ga0495658_0246533 Ga0495658_0246533_286_1071 259
53 3300048911 Ga0496108_0242482 Ga0496108_0242482_101_886 259
54 3300048915 Ga0496112_0045622 Ga0496112_0045622_3372_4157 259
55 3300050491 nmdc:mga00v17_13415_c1 nmdc:mga00v17_13415_c1_2099_2878 259
56 3300050507 nmdc:mga05p37_250165_c1 nmdc:mga05p37_250165_c1_1009_1794 259
57 iso_pu_bacteria 2585427687 2586209509 259
58 iso_pu_bacteria 2739367663 2739645269 259
59 iso_pu_bacteria 2852623160 2852624973 259
60 iso_pu_bacteria 2904445276 2904445499 259
61 iso_pu_bacteria 2954016120 2954017805 259
62 3300002077 JGI24744J21845_10015931 JGI24744J21845_100159312 260
63 3300005328 Ga0070676_10000585 Ga0070676_1000058512 260
64 3300005338 Ga0068868_100004892 Ga0068868_10000489210 260
65 3300005338 Ga0068868_100367230 Ga0068868_1003672302 260
66 3300005355 Ga0070671_100152245 Ga0070671_1001522452 260
67 3300005456 Ga0070678_100012587 Ga0070678_1000125872 260
68 3300005457 Ga0070662_100000029 Ga0070662_10000002968 260
69 3300005459 Ga0068867_100000896 Ga0068867_1000008962 260
70 3300005543 Ga0070672_100053822 Ga0070672_1000538225 260
71 3300005548 Ga0070665_100000032 Ga0070665_100000032331 260
72 3300005563 Ga0068855_100101670 Ga0068855_1001016702 260
73 3300005616 Ga0068852_100033069 Ga0068852_1000330693 260
74 3300006237 Ga0097621_100000441 Ga0097621_10000044122 260
75 3300006358 Ga0068871_100000421 Ga0068871_1000004218 260
76 3300006881 Ga0068865_100000105 Ga0068865_10000010526 260
77 3300009093 Ga0105240_10000757 Ga0105240_1000075722 260
78 3300009093 Ga0105240_10094583 Ga0105240_100945836 260
79 3300009093 Ga0105240_10254999 Ga0105240_102549993 260
80 3300009098 Ga0105245_10073819 Ga0105245_100738191 260
81 3300009174 Ga0105241_10000373 Ga0105241_1000037319 260
82 3300009174 Ga0105241_10002970 Ga0105241_100029705 260
83 3300009174 Ga0105241_10078784 Ga0105241_100787844 260
84 3300009174 Ga0105241_10089676 Ga0105241_100896762 260
85 3300009176 Ga0105242_10015332 Ga0105242_100153326 260
86 3300009545 Ga0105237_10000331 Ga0105237_1000033162 260
87 3300009545 Ga0105237_10003380 Ga0105237_1000338015 260
88 3300010375 Ga0105239_10011697 Ga0105239_100116978 260
89 3300010375 Ga0105239_10071668 Ga0105239_100716684 260
90 3300010375 Ga0105239_10146776 Ga0105239_101467765 260
91 3300011119 Ga0105246_10046592 Ga0105246_100465923 260
92 3300013100 Ga0157373_10013277 Ga0157373_100132773 260
93 3300013102 Ga0157371_10126033 Ga0157371_101260332 260
94 3300013105 Ga0157369_10002590 Ga0157369_1000259010 260
95 3300013105 Ga0157369_10211174 Ga0157369_102111742 260
96 3300013296 Ga0157374_10000594 Ga0157374_1000059413 260
97 3300013296 Ga0157374_10000644 Ga0157374_1000064427 260
98 3300013297 Ga0157378_10035285 Ga0157378_100352856 260
99 3300013306 Ga0163162_10000010 Ga0163162_10000010139 260
100 3300013307 Ga0157372_10254994 Ga0157372_102549944 260
101 3300013308 Ga0157375_10028237 Ga0157375_100282371 260
102 3300021361 Ga0213872_10010846 Ga0213872_100108464 260
103 3300025904 Ga0207647_10000022 Ga0207647_1000002212 260
104 3300025907 Ga0207645_10000190 Ga0207645_100001906 260
105 3300025911 Ga0207654_10000277 Ga0207654_1000027720 260
106 3300025911 Ga0207654_10138710 Ga0207654_101387102 260
107 3300025911 Ga0207654_10174091 Ga0207654_101740911 260
108 3300025911 Ga0207654_10239132 Ga0207654_102391322 260
109 3300025913 Ga0207695_10000058 Ga0207695_10000058226 260
110 3300025913 Ga0207695_10006810 Ga0207695_1000681020 260
111 3300025913 Ga0207695_10074173 Ga0207695_100741735 260
112 3300025914 Ga0207671_10007729 Ga0207671_100077292 260
113 3300025914 Ga0207671_10311857 Ga0207671_103118571 260
114 3300025927 Ga0207687_10060938 Ga0207687_100609384 260
115 3300025931 Ga0207644_10161415 Ga0207644_101614153 260
116 3300025933 Ga0207706_10000047 Ga0207706_1000004793 260
117 3300025934 Ga0207686_10211783 Ga0207686_102117832 260
118 3300025938 Ga0207704_10000073 Ga0207704_1000007319 260
119 3300025940 Ga0207691_10090515 Ga0207691_100905155 260
120 3300025949 Ga0207667_10061478 Ga0207667_100614783 260
121 3300025949 Ga0207667_10438121 Ga0207667_104381212 260
122 3300025960 Ga0207651_10036875 Ga0207651_100368752 260
123 3300026023 Ga0207677_10021404 Ga0207677_100214042 260
124 3300026023 Ga0207677_10314544 Ga0207677_103145442 260
125 3300026041 Ga0207639_10011234 Ga0207639_1001123411 260
126 3300026089 Ga0207648_10000347 Ga0207648_1000034714 260
127 3300026121 Ga0207683_10009669 Ga0207683_1000966911 260
128 3300028379 Ga0268266_10000030 Ga0268266_100000303 260
129 3300028786 Ga0307517_10011656 Ga0307517_1001165610 260
130 3300031507 Ga0307509_10015731 Ga0307509_100157313 260
131 3300037312 Ga0395899_0001230 Ga0395899_0001230_6218_7003 260
132 3300037418 Ga0395900_0000095 Ga0395900_0000095_136679_137551 260
133 3300037418 Ga0395900_0000721 Ga0395900_0000721_18564_19349 260
134 3300037466 Ga0395898_0009892 Ga0395898_0009892_7331_8116 260
135 3300037471 Ga0395905_0052383 Ga0395905_0052383_1764_2549 260
136 3300038443 Ga0395901_0000198 Ga0395901_0000198_74562_75347 260
137 3300039447 Ga0436361_1137687 Ga0436361_1137687_21102_21887 260
138 3300042005 Ga0439448_0022643 Ga0439448_0022643_920_1705 260
139 3300045836 Ga0466958_0235277 Ga0466958_0235277_197_985 260
140 3300046506 Ga0495583_0100250 Ga0495583_0100250_47_832 260
141 3300046518 Ga0495631_0022133 Ga0495631_0022133_1289_2074 260
142 3300047443 Ga0495687_003782 Ga0495687_003782_7434_8219 260
143 3300048929 Ga0496126_0358628 Ga0496126_0358628_167_952 260
144 3300053096 Ga0500641_0000137 Ga0500641_0000137_418_1200 260
145 3300053122 Ga0500608_000501 Ga0500608_000501_103_888 260
146 3300053726 Ga0500584_007071 Ga0500584_007071_186_968 260
147 iso_pu_bacteria 2599185184 2599478998 260
148 iso_pu_bacteria 2738543023 2739304598 260
149 iso_pu_bacteria 2775506987 2776613284 260
150 iso_pu_bacteria 2839989709 2839991333 260
151 iso_pu_bacteria 2852627209 2852628547 260
152 iso_pu_bacteria 2896344016 2896346778 260
153 iso_pu_bacteria 2904780799 2904782237 260
154 iso_pu_bacteria 2910245624 2910246882 260
155 iso_pu_bacteria 2919177583 2919179640 260
156 iso_pu_bacteria 2919509842 2919512424 260
157 iso_pu_bacteria 2928078545 2928082687 260
158 iso_pu_bacteria 2928147474 2928148729 260
159 iso_pu_bacteria 2932082852 2932086477 260
160 iso_pu_bacteria 2958512119 2958513462 260
161 3300003320 rootH2_10044421 rootH2_100444215 261
162 3300009551 Ga0105238_10162353 Ga0105238_101623534 261
163 3300047472 Ga0495686_0000516 Ga0495686_0000516_54545_55342 261
164 3300003316 rootH1_10004109 rootH1_100041093 262
165 3300003320 rootH2_10016754 rootH2_1001675422 262
166 3300005455 Ga0070663_100000310 Ga0070663_10000031024 262
167 3300006195 Ga0075366_10001404 Ga0075366_100014049 262
168 3300006353 Ga0075370_10082022 Ga0075370_100820221 262
169 3300013102 Ga0157371_10011681 Ga0157371_100116816 262
170 3300013104 Ga0157370_10084607 Ga0157370_100846073 262
171 3300013105 Ga0157369_10000393 Ga0157369_100003932 262
172 3300013307 Ga0157372_10000034 Ga0157372_10000034100 262
173 3300022467 Ga0224712_10047099 Ga0224712_100470993 262
174 3300026067 Ga0207678_10011687 Ga0207678_1001168711 262
175 3300031911 Ga0307412_10311901 Ga0307412_103119012 262
176 3300032004 Ga0307414_10110458 Ga0307414_101104582 262
177 3300032004 Ga0307414_10246442 Ga0307414_102464421 262
178 3300037312 Ga0395899_0000182 Ga0395899_0000182_28509_29300 262
179 3300037418 Ga0395900_0017501 Ga0395900_0017501_1279_2070 262
180 3300037471 Ga0395905_0000149 Ga0395905_0000149_93177_93968 262
181 3300038443 Ga0395901_0006642 Ga0395901_0006642_6518_7309 262
182 3300044656 Ga0466969_0097285 Ga0466969_0097285_442_1233 262
183 3300044684 Ga0466966_0048221 Ga0466966_0048221_1885_2676 262
184 3300045049 Ga0466959_0119515 Ga0466959_0119515_590_1381 262
185 3300045836 Ga0466958_0144464 Ga0466958_0144464_638_1429 262
186 3300046462 Ga0495651_0255992 Ga0495651_0255992_381_1172 262
187 3300047472 Ga0495686_0002234 Ga0495686_0002234_9518_10309 262
188 3300049581 Ga0501047_0081256 Ga0501047_0081256_1571_2359 262
189 3300049649 Ga0501198_001956 Ga0501198_001956_1858_2646 262
190 3300049663 Ga0501223_002032 Ga0501223_002032_3246_4034 262
191 3300050493 nmdc:mga0k408_1769_c1 nmdc:mga0k408_1769_c1_2399_3190 262
192 3300050496 nmdc:mga07m45_305014_c1 nmdc:mga07m45_305014_c1_52_843 262
193 iso_pu_bacteria 2902048731 2902048747 262
194 3300002741 JGI25157J39369_1004803 JGI25157J39369_10048033 263
195 3300005288 Ga0065714_10064513 Ga0065714_1006451328 263
196 3300005293 Ga0065715_10239735 Ga0065715_102397351 263
197 3300005337 Ga0070682_100000012 Ga0070682_10000001227 263
198 3300005339 Ga0070660_100008162 Ga0070660_1000081628 263
199 3300005356 Ga0070674_100086895 Ga0070674_1000868952 263
200 3300005366 Ga0070659_100000372 Ga0070659_10000037218 263
201 3300005459 Ga0068867_100064481 Ga0068867_1000644813 263
202 3300005539 Ga0068853_100292175 Ga0068853_1002921752 263
203 3300005614 Ga0068856_100000023 Ga0068856_10000002389 263
204 3300005616 Ga0068852_100835928 Ga0068852_1008359281 263
205 3300005618 Ga0068864_100121169 Ga0068864_1001211692 263
206 3300005843 Ga0068860_100197866 Ga0068860_1001978662 263
207 3300009093 Ga0105240_10926739 Ga0105240_109267391 263
208 3300009147 Ga0114129_10242283 Ga0114129_102422833 263
209 3300009174 Ga0105241_10115191 Ga0105241_101151912 263
210 3300009176 Ga0105242_10601402 Ga0105242_106014022 263
211 3300009545 Ga0105237_10011977 Ga0105237_100119771 263
212 3300009545 Ga0105237_10085898 Ga0105237_100858982 263
213 3300010375 Ga0105239_10037752 Ga0105239_100377527 263
214 3300010375 Ga0105239_10037916 Ga0105239_100379162 263
215 3300013102 Ga0157371_10000034 Ga0157371_10000034114 263
216 3300013104 Ga0157370_10020480 Ga0157370_100204802 263
217 3300013104 Ga0157370_10276793 Ga0157370_102767931 263
218 3300013105 Ga0157369_10000002 Ga0157369_10000002167 263
219 3300013297 Ga0157378_10151004 Ga0157378_101510042 263
220 3300013306 Ga0163162_10000330 Ga0163162_1000033015 263
221 3300013307 Ga0157372_10000904 Ga0157372_1000090422 263
222 3300013307 Ga0157372_10043824 Ga0157372_100438244 263
223 3300014497 Ga0182008_10013698 Ga0182008_100136981 263
224 3300015261 Ga0182006_1001076 Ga0182006_100107618 263
225 3300015262 Ga0182007_10000001 Ga0182007_10000001607 263
226 3300017792 Ga0163161_10009579 Ga0163161_100095794 263
227 3300017792 Ga0163161_10078036 Ga0163161_100780362 263
228 3300017792 Ga0163161_10195395 Ga0163161_101953952 263
229 3300017792 Ga0163161_10232156 Ga0163161_102321563 263
230 3300025246 Ga0209646_1001577 Ga0209646_10015778 263
231 3300025250 Ga0209026_1004207 Ga0209026_10042073 263
232 3300025261 Ga0209233_1010353 Ga0209233_10103533 263
233 3300025292 Ga0209676_1000001 Ga0209676_10000011097 263
234 3300025298 Ga0209050_1000018 Ga0209050_1000018487 263
235 3300025914 Ga0207671_10153145 Ga0207671_101531452 263
236 3300025919 Ga0207657_10018878 Ga0207657_100188789 263
237 3300025932 Ga0207690_10000508 Ga0207690_1000050814 263
238 3300025949 Ga0207667_10359955 Ga0207667_103599551 263
239 3300026041 Ga0207639_10220162 Ga0207639_102201622 263
240 3300026078 Ga0207702_10000314 Ga0207702_1000031444 263
241 3300026089 Ga0207648_10033495 Ga0207648_100334955 263
242 3300028381 Ga0268264_10222610 Ga0268264_102226102 263
243 3300028794 Ga0307515_10000001 Ga0307515_100000013081 263
244 3300028794 Ga0307515_10060039 Ga0307515_100600393 263
245 3300028794 Ga0307515_10100440 Ga0307515_101004402 263
246 3300028794 Ga0307515_10245230 Ga0307515_102452302 263
247 3300031251 Ga0265327_10073704 Ga0265327_100737043 263
248 3300031507 Ga0307509_10164278 Ga0307509_101642781 263
249 3300031731 Ga0307405_10000026 Ga0307405_1000002693 263
250 3300031903 Ga0307407_10000032 Ga0307407_1000003235 263
251 3300032002 Ga0307416_100000045 Ga0307416_10000004598 263
252 3300035115 Ga0373941_0015679 Ga0373941_0015679_748_1542 263
253 3300041486 Ga0451807_1277672 Ga0451807_1277672_374_1186 263
254 3300041494 Ga0451837_1512042 Ga0451837_1512042_37_834 263
255 3300041512 Ga0451853_1065215 Ga0451853_1065215_149_940 263
256 3300044842 Ga0466957_0007090 Ga0466957_0007090_1456_2250 263
257 3300046462 Ga0495651_0111409 Ga0495651_0111409_46_840 263
258 3300046512 Ga0495610_0006227 Ga0495610_0006227_2681_3493 263
259 3300046520 Ga0495637_0050152 Ga0495637_0050152_614_1426 263
260 3300046529 Ga0495652_0087178 Ga0495652_0087178_1009_1803 263
261 3300046665 Ga0495661_0000707 Ga0495661_0000707_28393_29187 263
262 3300046665 Ga0495661_0064446 Ga0495661_0064446_555_1349 263
263 3300047320 Ga0495672_0078848 Ga0495672_0078848_1010_1804 263
264 3300047447 Ga0495685_017775 Ga0495685_017775_1467_2264 263
265 3300049581 Ga0501047_0109635 Ga0501047_0109635_296_1090 263
266 3300053151 Ga0500604_0003576 Ga0500604_0003576_3043_3849 263
267 3300053156 Ga0500622_0014238 Ga0500622_0014238_1183_1974 263
268 iso_pu_bacteria 2738541302 2738853652 263
269 iso_pu_bacteria 2739367651 2739588882 263
270 iso_pu_bacteria 2818991437 2819548009 263
271 iso_pu_bacteria 2842722452 2842726335 263
272 iso_pu_bacteria 2842909656 2842910586 263
273 iso_pu_bacteria 2849281842 2849282161 263
274 iso_pu_bacteria 2945997725 2946000899 263
275 2162886007 SwRhRL2b_contig_1358865 SwRhRL2b_0615.00006870 264
276 3300001990 JGI24737J22298_10000018 JGI24737J22298_1000001811 264
277 3300002067 JGI24735J21928_10000016 JGI24735J21928_10000016123 264
278 3300002741 JGI25157J39369_1010882 JGI25157J39369_10108822 264
279 3300003316 rootH1_10037755 rootH1_100377555 264
280 3300003316 rootH1_10066407 rootH1_1006640711 264
281 3300003323 rootH1_10029362 rootH1_100293628 264
282 3300005289 Ga0065704_10121736 Ga0065704_101217362 264
283 3300005293 Ga0065715_10239475 Ga0065715_102394751 264
284 3300005335 Ga0070666_10255038 Ga0070666_102550381 264
285 3300005340 Ga0070689_100241074 Ga0070689_1002410742 264
286 3300005354 Ga0070675_100167968 Ga0070675_1001679681 264
287 3300005466 Ga0070685_10240768 Ga0070685_102407681 264
288 3300005530 Ga0070679_100225686 Ga0070679_1002256862 264
289 3300005530 Ga0070679_100567713 Ga0070679_1005677131 264
290 3300005539 Ga0068853_100002432 Ga0068853_1000024327 264
291 3300005543 Ga0070672_100126164 Ga0070672_1001261643 264
292 3300005548 Ga0070665_100000845 Ga0070665_1000008456 264
293 3300005578 Ga0068854_100216540 Ga0068854_1002165402 264
294 3300005614 Ga0068856_100030049 Ga0068856_1000300496 264
295 3300005616 Ga0068852_100772301 Ga0068852_1007723012 264
296 3300006195 Ga0075366_10006182 Ga0075366_100061828 264
297 3300009093 Ga0105240_10000160 Ga0105240_1000016028 264
298 3300009093 Ga0105240_10000212 Ga0105240_1000021227 264
299 3300009093 Ga0105240_10004154 Ga0105240_100041543 264
300 3300009147 Ga0114129_10066023 Ga0114129_100660234 264
301 3300009148 Ga0105243_10000006 Ga0105243_1000000648 264
302 3300009174 Ga0105241_10000834 Ga0105241_100008345 264
303 3300009545 Ga0105237_10001699 Ga0105237_100016992 264
304 3300009545 Ga0105237_10004940 Ga0105237_1000494011 264
305 3300009545 Ga0105237_10005255 Ga0105237_1000525514 264
306 3300009545 Ga0105237_10020231 Ga0105237_100202316 264
307 3300009545 Ga0105237_10045574 Ga0105237_100455741 264
308 3300009545 Ga0105237_10048384 Ga0105237_100483843 264
309 3300009545 Ga0105237_10955687 Ga0105237_109556871 264
310 3300009551 Ga0105238_10017945 Ga0105238_100179452 264
311 3300009551 Ga0105238_10170824 Ga0105238_101708243 264
312 3300010375 Ga0105239_10002380 Ga0105239_100023805 264
313 3300010375 Ga0105239_10002966 Ga0105239_100029667 264
314 3300010375 Ga0105239_10028344 Ga0105239_100283441 264
315 3300010375 Ga0105239_10037880 Ga0105239_100378804 264
316 3300010375 Ga0105239_10518653 Ga0105239_105186531 264
317 3300013102 Ga0157371_10007112 Ga0157371_100071125 264
318 3300013102 Ga0157371_10008352 Ga0157371_100083526 264
319 3300013102 Ga0157371_10089779 Ga0157371_100897792 264
320 3300013104 Ga0157370_10001128 Ga0157370_1000112820 264
321 3300013104 Ga0157370_10001827 Ga0157370_100018279 264
322 3300013104 Ga0157370_10019228 Ga0157370_100192287 264
323 3300013104 Ga0157370_10090422 Ga0157370_100904222 264
324 3300013104 Ga0157370_10400891 Ga0157370_104008912 264
325 3300013105 Ga0157369_10454871 Ga0157369_104548711 264
326 3300013306 Ga0163162_10015626 Ga0163162_100156269 264
327 3300013306 Ga0163162_10172740 Ga0163162_101727402 264
328 3300013307 Ga0157372_10001490 Ga0157372_1000149025 264
329 3300013308 Ga0157375_10275332 Ga0157375_102753322 264
330 3300014497 Ga0182008_10000018 Ga0182008_1000001845 264
331 3300014497 Ga0182008_10000565 Ga0182008_100005657 264
332 3300014969 Ga0157376_10120499 Ga0157376_101204992 264
333 3300015261 Ga0182006_1000160 Ga0182006_100016067 264
334 3300015261 Ga0182006_1002208 Ga0182006_10022085 264
335 3300015261 Ga0182006_1004847 Ga0182006_10048473 264
336 3300017792 Ga0163161_10029874 Ga0163161_100298743 264
337 3300021384 Ga0213876_10015921 Ga0213876_100159213 264
338 3300025250 Ga0209026_1003556 Ga0209026_10035566 264
339 3300025302 Ga0207426_1000009 Ga0207426_1000009275 264
340 3300025904 Ga0207647_10002941 Ga0207647_1000294112 264
341 3300025913 Ga0207695_10000027 Ga0207695_10000027202 264
342 3300025913 Ga0207695_10001864 Ga0207695_1000186426 264
343 3300025913 Ga0207695_10008831 Ga0207695_100088319 264
344 3300025913 Ga0207695_10046371 Ga0207695_100463711 264
345 3300025914 Ga0207671_10000382 Ga0207671_100003821 264
346 3300025914 Ga0207671_10009457 Ga0207671_100094573 264
347 3300025914 Ga0207671_10011032 Ga0207671_100110324 264
348 3300025914 Ga0207671_10021485 Ga0207671_100214854 264
349 3300025914 Ga0207671_10046114 Ga0207671_100461142 264
350 3300025919 Ga0207657_10145886 Ga0207657_101458865 264
351 3300025924 Ga0207694_10128615 Ga0207694_101286151 264
352 3300025924 Ga0207694_10181262 Ga0207694_101812621 264
353 3300025932 Ga0207690_10036509 Ga0207690_100365095 264
354 3300025935 Ga0207709_10000007 Ga0207709_10000007289 264
355 3300025939 Ga0207665_10300496 Ga0207665_103004962 264
356 3300025940 Ga0207691_10230662 Ga0207691_102306622 264
357 3300025949 Ga0207667_10411617 Ga0207667_104116172 264
358 3300026041 Ga0207639_10008108 Ga0207639_100081085 264
359 3300026041 Ga0207639_10120152 Ga0207639_101201522 264
360 3300028379 Ga0268266_10004662 Ga0268266_100046624 264
361 3300028800 Ga0265338_10019133 Ga0265338_100191332 264
362 3300031251 Ga0265327_10050432 Ga0265327_100504322 264
363 3300031731 Ga0307405_10000001 Ga0307405_100000011609 264
364 3300031731 Ga0307405_10555122 Ga0307405_105551221 264
365 3300032004 Ga0307414_10135882 Ga0307414_101358822 264
366 3300032004 Ga0307414_10139811 Ga0307414_101398112 264
367 3300035172 Ga0373955_0004566 Ga0373955_0004566_1949_2791 264
368 3300036401 Ga0373937_0001954 Ga0373937_0001954_7946_8788 264
369 3300037068 Ga0373925_0135677 Ga0373925_0135677_33_830 264
370 3300037418 Ga0395900_0537460 Ga0395900_0537460_272_1069 264
371 3300039437 Ga0436365_0614130 Ga0436365_0614130_15506_16303 264
372 3300041512 Ga0451853_4074435 Ga0451853_4074435_18_815 264
373 3300044712 Ga0453684_0017328 Ga0453684_0017328_2196_2993 264
374 3300046453 Ga0495627_010636 Ga0495627_010636_2318_3112 264
375 3300046471 Ga0495650_0000280 Ga0495650_0000280_11125_11922 264
376 3300046492 Ga0495585_0000062 Ga0495585_0000062_80218_81015 264
377 3300046507 Ga0495606_0000003 Ga0495606_0000003_122507_123304 264
378 3300046507 Ga0495606_0006459 Ga0495606_0006459_6963_7781 264
379 3300046507 Ga0495606_0007777 Ga0495606_0007777_8081_8878 264
380 3300046507 Ga0495606_0020377 Ga0495606_0020377_2168_2965 264
381 3300046507 Ga0495606_0021730 Ga0495606_0021730_2456_3250 264
382 3300046511 Ga0495608_0182697 Ga0495608_0182697_22_819 264
383 3300046512 Ga0495610_0000438 Ga0495610_0000438_30514_31311 264
384 3300046513 Ga0495616_0000785 Ga0495616_0000785_4126_4923 264
385 3300046516 Ga0495628_0016298 Ga0495628_0016298_4938_5780 264
386 3300046517 Ga0495630_0004859 Ga0495630_0004859_7817_8659 264
387 3300046520 Ga0495637_0069748 Ga0495637_0069748_306_1103 264
388 3300046522 Ga0495643_0001478 Ga0495643_0001478_2929_3723 264
389 3300046524 Ga0495648_0249459 Ga0495648_0249459_15_845 264
390 3300046558 Ga0495633_0000969 Ga0495633_0000969_8462_9259 264
391 3300046559 Ga0495667_0030982 Ga0495667_0030982_2605_3447 264
392 3300046642 Ga0495634_0020576 Ga0495634_0020576_1698_2540 264
393 3300046648 Ga0495611_0000015 Ga0495611_0000015_83091_83921 264
394 3300046660 Ga0495625_0000013 Ga0495625_0000013_283260_284057 264
395 3300046660 Ga0495625_0014099 Ga0495625_0014099_3898_4692 264
396 3300046665 Ga0495661_0002423 Ga0495661_0002423_1925_2722 264
397 3300046675 Ga0495657_0116246 Ga0495657_0116246_504_1346 264
398 3300046689 Ga0495613_0143935 Ga0495613_0143935_390_1232 264
399 3300046692 Ga0495671_0084223 Ga0495671_0084223_154_1095 264
400 3300046694 Ga0495649_0000010 Ga0495649_0000010_61020_61817 264
401 3300046809 Ga0495600_0119653 Ga0495600_0119653_371_1213 264
402 3300046810 Ga0495660_0003973 Ga0495660_0003973_7756_8553 264
403 3300047319 Ga0495674_0148814 Ga0495674_0148814_320_1162 264
404 3300047320 Ga0495672_0028697 Ga0495672_0028697_1758_2555 264
405 3300047320 Ga0495672_0037518 Ga0495672_0037518_773_1573 264
406 3300047443 Ga0495687_016713 Ga0495687_016713_418_1215 264
407 3300047446 Ga0495679_033965 Ga0495679_033965_176_973 264
408 3300047472 Ga0495686_0055775 Ga0495686_0055775_100_897 264
409 3300048920 Ga0496117_0001275 Ga0496117_0001275_29919_30716 264
410 3300048921 Ga0496118_0205668 Ga0496118_0205668_64_861 264
411 3300048925 Ga0496122_0058313 Ga0496122_0058313_1276_2073 264
412 3300048926 Ga0496123_0002282 Ga0496123_0002282_7153_7968 264
413 3300048926 Ga0496123_0021055 Ga0496123_0021055_4067_4864 264
414 3300048927 Ga0496124_0066105 Ga0496124_0066105_1564_2361 264
415 3300048928 Ga0496125_0000185 Ga0496125_0000185_93968_94762 264
416 3300048928 Ga0496125_0039625 Ga0496125_0039625_2551_3366 264
417 3300049569 Ga0501032_0035785 Ga0501032_0035785_1076_1873 264
418 3300049570 Ga0501033_0107511 Ga0501033_0107511_630_1427 264
419 3300049570 Ga0501033_0266736 Ga0501033_0266736_41_838 264
420 3300049571 Ga0501034_0111715 Ga0501034_0111715_888_1685 264
421 3300049571 Ga0501034_0334113 Ga0501034_0334113_540_1337 264
422 3300049574 Ga0501038_0213919 Ga0501038_0213919_89_886 264
423 3300049579 Ga0501043_0060633 Ga0501043_0060633_1635_2432 264
424 3300049581 Ga0501047_0004399 Ga0501047_0004399_7337_8134 264
425 3300049823 Ga0501044_0046745 Ga0501044_0046745_3086_3883 264
426 3300050493 nmdc:mga0k408_44149_c1 nmdc:mga0k408_44149_c1_1409_2206 264
427 3300053092 Ga0500583_0001042 Ga0500583_0001042_5906_6703 264
428 3300053096 Ga0500641_0000544 Ga0500641_0000544_3201_3995 264
429 3300053104 Ga0500556_0040272 Ga0500556_0040272_438_1232 264
430 3300053178 Ga0500637_0033627 Ga0500637_0033627_1901_2698 264
431 iso_pu_bacteria 2738541283 2738756281 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20613

HipA_2

HipA-like kinase

61

301

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i91-assembly2.cif.gz_B crystal structure of human chromobox homolog 8 (cbx8) with h3k9 peptide 0.7661 10 32
3p7j-assembly1.cif.gz_B drosophila hp1a chromo shadow domain 0.7644 10 32
6d08-assembly1.cif.gz_A crystal structure of an engineered bump-hole complex of mutant human chromobox homolog 1 (cbx1) with h3k9bn peptide 0.7487 10 34
6d08-assembly2.cif.gz_B crystal structure of an engineered bump-hole complex of mutant human chromobox homolog 1 (cbx1) with h3k9bn peptide 0.7459 10 34
2fmm-assembly1.cif.gz_A-2 crystal structure of emsy-hp1 complex 0.7362 10 34
ID Description Score Start End Superfamily
af_Q9U3C6_94_162_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8264 10 40 2.40.50.40
4qucA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7565 10 32 2.40.50.40
1knaA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7489 10 32 2.40.50.40
6d08A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7487 10 34 2.40.50.40
af_Q2G2A7_273_342_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7286 12 40 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1M6GFS8-F1-model_v4 HipA-like kinase domain-containing protein 0.9933 5 264
AF-A0A2P8E5Z8-F1-model_v4 HipA-like kinase domain-containing protein 0.987 5 264
AF-A0A1I1JRJ8-F1-model_v4 HipA-like kinase domain-containing protein 0.9844 1 264
AF-A0A2X2IXD1-F1-model_v4 HipA-like kinase domain-containing protein 0.9835 5 191
AF-A0A4Q3T132-F1-model_v4 Aminotransferase class I and II 0.9813 5 100 GO:0008483

Feature Viewer

pLDDT pTM Quality
93.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map