F442412

General Info

Members Datasets Scaffolds Average Seq Length
431 275 411 424

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0024182|Ga0373927_0024182_1038_2438
Length 466
Sequence LRQTRRAARCLRLTQAGRSSRGLVGYNGPNPYRISSPLFGGTAMSLNAGRICVASIAALSLAISIAYAGEIRVACYSDGNECEVTQDLAKRFEAQNADVKVAVDKVPFKAIVEQLPVQLAAGEGPDIARVTELGGLSKYYLDITPYVKDAKYWEANFGQTLAWLRPTAGDKGIYGMMTQLTVTGPYVNKTLFEQANVPLPGPQATWDQWADAARKVAKATQVPFAIAFDRSGHRFAGPAISMGAKYFDAKGNLVVDDGYRAMAKKLYDWNRDGTMPKEVWGGVGGASYRDAFEEFANGRVVMYLSGSWQIRRMDTQIGKNFDWIAVPNPCGPAACTGMPGGAAFVALKRTKNPKDVGRFLDYLASEAVYAEYMARTENIPAHAGVAKKGVDYKISPQAKAAMNTFVAEVPKLSPVAYQIQGYKLNRAIFNPTAARLGQAIAGEMSLDDALKRISADIDEQVKAAAK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2643221736 Bosea sp. Root483D1 Isolate Unclassified
5 2818991467 Bosea vestrisii 3192 Isolate Unclassified
6 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
7 2841760612 Bosea sp. Tri-49 Isolate Nodule
8 2844104063 Bosea sp. Tri-39 Isolate Nodule
9 2851182111 Bosea sp. Tri-44 Isolate Nodule
10 2851246043 Bosea sp. Tri-54 Isolate Nodule
11 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
12 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
13 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
14 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
15 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
16 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
17 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
18 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
201 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
264 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
267 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
270 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
274 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
275 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.2
Metatranscriptomes 1.16
Isolates 4.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.92
Nodule 2.55
Rhizoplane 2.78
Rhizosphere 69.84
Stem 0
Stem Tuber 0
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000035 3300002704 Bacteria 99118
2 JGI25155J39150_1000492 3300002704 Bacteria 9606
3 JGI25156J39149_1000012 3300002705 Bacteria 194393
4 JGI25154J39366_1000029 3300002738 Bacteria 194393
5 JGI25154J39366_1000074 3300002738 Bacteria 92481
6 JGI25157J39369_1000014 3300002741 Bacteria 194393
7 JGI25159J45721_1005174 3300002987 Bacteria 4132
8 JGI25151J46595_10000056 3300003187 Bacteria 151555
9 JGI25151J46595_10033686 3300003187 Bacteria 1969
10 Ga0007410J51695_1035732 3300003574 Bacteria 1629
11 Ga0055537_1000092 3300003773 Bacteria 66301
12 Ga0055524_1000089 3300003775 Bacteria 115137
13 Ga0055524_1000306 3300003775 Bacteria 46611
14 Ga0055534_1008446 3300003784 Bacteria 2332
15 Ga0055528_1004400 3300003790 Bacteria 6792
16 Ga0055530_10003518 3300003791 Bacteria 8848
17 Ga0055540_1000030 3300003792 Bacteria 177871
18 Ga0055543_1003139 3300004625 Bacteria 5053
19 Ga0065165_1000026 3300005262 Bacteria 233376
20 Ga0065715_10147123 3300005293 Unclassified 1775
21 Ga0070658_10038602 3300005327 Bacteria 3850
22 Ga0070658_10045293 3300005327 Bacteria 3557
23 Ga0070676_10048341 3300005328 Bacteria 2487
24 Ga0070676_10072207 3300005328 Bacteria 2074
25 Ga0070670_100013503 3300005331 Bacteria 6997
26 Ga0070666_10123158 3300005335 Bacteria 1799
27 Ga0070680_100140940 3300005336 Bacteria 2022
28 Ga0070660_100001343 3300005339 Bacteria 16716
29 Ga0070660_100004781 3300005339 Bacteria 9365
30 Ga0070660_100014586 3300005339 Bacteria 5668
31 Ga0070660_100029777 3300005339 Bacteria 4094
32 Ga0070689_100020558 3300005340 Bacteria 4900
33 Ga0070661_100002642 3300005344 Bacteria 12259
34 Ga0070675_100002946 3300005354 Bacteria 12843
35 Ga0070675_100052801 3300005354 Bacteria 3342
36 Ga0070675_100081943 3300005354 Bacteria 2691
37 Ga0070671_100008285 3300005355 Bacteria 8319
38 Ga0070671_100023443 3300005355 Bacteria 5051
39 Ga0070671_100126820 3300005355 Bacteria 2149
40 Ga0070674_100069184 3300005356 Bacteria 2490
41 Ga0070673_100036598 3300005364 Bacteria 3732
42 Ga0070688_100071117 3300005365 Bacteria 2226
43 Ga0070667_100119984 3300005367 Bacteria 2287
44 Ga0070709_10001113 3300005434 Bacteria 14834
45 Ga0070714_100003536 3300005435 Bacteria 11675
46 Ga0070714_100022294 3300005435 Bacteria 5192
47 Ga0070714_100115242 3300005435 Bacteria 2385
48 Ga0070713_100070806 3300005436 Bacteria 2945
49 Ga0070710_10007073 3300005437 Bacteria 5417
50 Ga0070711_100002921 3300005439 Bacteria 9848
51 Ga0070711_100011734 3300005439 Bacteria 5448
52 Ga0070708_100245881 3300005445 Bacteria 1680
53 Ga0070663_100005591 3300005455 Bacteria 7482
54 Ga0070663_100014631 3300005455 Bacteria 5041
55 Ga0070662_100000538 3300005457 Bacteria 22958
56 Ga0070662_100176967 3300005457 Bacteria 1679
57 Ga0070681_10010450 3300005458 Bacteria 9166
58 Ga0070681_10025274 3300005458 Bacteria 5973
59 Ga0070685_10014628 3300005466 Bacteria 4158
60 Ga0070706_100021214 3300005467 Bacteria 5983
61 Ga0070698_100065155 3300005471 Bacteria 3669
62 Ga0070679_100033654 3300005530 Bacteria 5075
63 Ga0070679_100044707 3300005530 Bacteria 4412
64 Ga0070684_100020023 3300005535 Bacteria 5546
65 Ga0070684_100026381 3300005535 Bacteria 4894
66 Ga0070684_100048493 3300005535 Bacteria 3685
67 Ga0070697_100063455 3300005536 Bacteria 3016
68 Ga0070697_100196711 3300005536 Bacteria 1712
69 Ga0068853_100001262 3300005539 Bacteria 18106
70 Ga0068853_100105676 3300005539 Bacteria 2494
71 Ga0070672_100003558 3300005543 Bacteria 10094
72 Ga0070665_100013515 3300005548 Bacteria 8213
73 Ga0070665_100053968 3300005548 Bacteria 4031
74 Ga0068855_100005264 3300005563 Bacteria 15796
75 Ga0068855_100009632 3300005563 Bacteria 11654
76 Ga0068855_100080839 3300005563 Bacteria 3769
77 Ga0068855_100311951 3300005563 Bacteria 1740
78 Ga0070664_100002874 3300005564 Bacteria 13956
79 Ga0070664_100004706 3300005564 Bacteria 10948
80 Ga0070664_100031972 3300005564 Bacteria 4402
81 Ga0068857_100005417 3300005577 Bacteria 10882
82 Ga0068857_100027710 3300005577 Bacteria 4997
83 Ga0068854_100019387 3300005578 Bacteria 4583
84 Ga0068854_100038423 3300005578 Bacteria 3366
85 Ga0068856_100000623 3300005614 Bacteria 38692
86 Ga0068856_100000681 3300005614 Bacteria 36870
87 Ga0068856_100133438 3300005614 Bacteria 2488
88 Ga0068852_100000508 3300005616 Bacteria 25606
89 Ga0068852_100170143 3300005616 Bacteria 2042
90 Ga0068859_100082505 3300005617 Bacteria 3257
91 Ga0068859_100152989 3300005617 Bacteria 2383
92 Ga0068859_100218059 3300005617 Bacteria 1995
93 Ga0068864_100002897 3300005618 Bacteria 14183
94 Ga0068866_10041806 3300005718 Bacteria 2277
95 Ga0068861_100074105 3300005719 Bacteria 2646
96 Ga0068851_10023196 3300005834 Bacteria 3030
97 Ga0068863_100062742 3300005841 Bacteria 3514
98 Ga0068858_100029795 3300005842 Bacteria 5070
99 Ga0068860_100000277 3300005843 Bacteria 73951
100 Ga0081539_10068499 3300005985 Unclassified 1914
101 Ga0070717_10129872 3300006028 Bacteria 2166
102 Ga0075364_10055247 3300006051 Bacteria 2598
103 Ga0070716_100004430 3300006173 Bacteria 6717
104 Ga0070712_100002445 3300006175 Bacteria 11451
105 Ga0075370_10057810 3300006353 Bacteria 2205
106 Ga0068871_100007341 3300006358 Bacteria 7866
107 Ga0068871_100132040 3300006358 Bacteria 2118
108 Ga0075434_100056050 3300006871 Bacteria 3916
109 Ga0097620_100082505 3300006931 Bacteria 3257
110 Ga0097620_100152988 3300006931 Bacteria 2383
111 Ga0097620_100218041 3300006931 Bacteria 1995
112 Ga0075435_100040343 3300007076 Bacteria 3727
113 Ga0105240_10005956 3300009093 Bacteria 18039
114 Ga0105240_10015915 3300009093 Bacteria 10203
115 Ga0105245_10062780 3300009098 Bacteria 3352
116 Ga0105247_10015921 3300009101 Bacteria 4503
117 Ga0114129_10016867 3300009147 Bacteria 10398
118 Ga0114129_10333568 3300009147 Bacteria 2013
119 Ga0105241_10005920 3300009174 Bacteria 9021
120 Ga0105248_10003382 3300009177 Bacteria 17732
121 Ga0105248_10230608 3300009177 Bacteria 2084
122 Ga0105237_10001621 3300009545 Bacteria 29218
123 Ga0105237_10024847 3300009545 Bacteria 6130
124 Ga0105237_10037577 3300009545 Bacteria 4893
125 Ga0105237_10057273 3300009545 Bacteria 3900
126 Ga0105238_10000239 3300009551 Bacteria 61402
127 Ga0105238_10147815 3300009551 Bacteria 2326
128 Ga0105249_10084287 3300009553 Bacteria 2960
129 Ga0105239_10092272 3300010375 Bacteria 3343
130 Ga0105246_10183406 3300011119 Bacteria 1613
131 Ga0157326_1000794 3300012513 Bacteria 3674
132 Ga0157373_10000948 3300013100 Bacteria 22482
133 Ga0157373_10133430 3300013100 Unclassified 1746
134 Ga0157371_10002760 3300013102 Bacteria 16497
135 Ga0157371_10085408 3300013102 Bacteria 2236
136 Ga0157371_10105424 3300013102 Bacteria 2000
137 Ga0157370_10002204 3300013104 Bacteria 23784
138 Ga0157370_10004071 3300013104 Bacteria 16949
139 Ga0157370_10071419 3300013104 Bacteria 3275
140 Ga0157370_10181283 3300013104 Bacteria 1957
141 Ga0157369_10013366 3300013105 Bacteria 9287
142 Ga0157369_10030277 3300013105 Bacteria 5971
143 Ga0157378_10015108 3300013297 Bacteria 6759
144 Ga0157372_10000712 3300013307 Bacteria 36536
145 Ga0157372_10006268 3300013307 Bacteria 12653
146 Ga0157372_10011635 3300013307 Bacteria 9367
147 Ga0157372_10031952 3300013307 Bacteria 5768
148 Ga0157372_10075903 3300013307 Bacteria 3794
149 Ga0157380_10008109 3300014326 Bacteria 7486
150 Ga0157380_10172141 3300014326 Bacteria 1893
151 Ga0157376_10035416 3300014969 Bacteria 4038
152 Ga0157376_10192146 3300014969 Bacteria 1873
153 Ga0209435_100002 3300025206 Bacteria 794178
154 Ga0209435_100734 3300025206 Bacteria 5447
155 Ga0207425_1008771 3300025245 Bacteria 2559
156 Ga0207425_1012580 3300025245 Bacteria 1981
157 Ga0209646_1000001 3300025246 Bacteria 3092932
158 Ga0209646_1000081 3300025246 Bacteria 201708
159 Ga0209026_1000040 3300025250 Bacteria 277470
160 Ga0209026_1001479 3300025250 Bacteria 10353
161 Ga0209759_1000001 3300025256 Bacteria 2799452
162 Ga0209759_1000613 3300025256 Bacteria 34432
163 Ga0209565_1000026 3300025263 Bacteria 365910
164 Ga0209565_1001969 3300025263 Bacteria 8039
165 Ga0209455_1000940 3300025272 Bacteria 14922
166 Ga0209673_1000009 3300025273 Bacteria 620735
167 Ga0209673_1000012 3300025273 Bacteria 579480
168 Ga0209130_1000123 3300025284 Bacteria 125840
169 Ga0209130_1000150 3300025284 Bacteria 108274
170 Ga0209130_1000516 3300025284 Bacteria 38937
171 Ga0209675_1000344 3300025291 Bacteria 40566
172 Ga0209675_1000360 3300025291 Bacteria 38963
173 Ga0209675_1012142 3300025291 Bacteria 2797
174 Ga0209676_1000051 3300025292 Bacteria 389016
175 Ga0209676_1012181 3300025292 Bacteria 3405
176 Ga0209025_1000016 3300025294 Bacteria 770739
177 Ga0209025_1006160 3300025294 Bacteria 9435
178 Ga0209025_1007516 3300025294 Bacteria 8096
179 Ga0209025_1009471 3300025294 Bacteria 6779
180 Ga0209564_1000035 3300025295 Bacteria 442446
181 Ga0209564_1001571 3300025295 Bacteria 22358
182 Ga0209564_1001782 3300025295 Bacteria 19937
183 Ga0209758_1001537 3300025297 Bacteria 26529
184 Ga0209758_1002683 3300025297 Bacteria 17553
185 Ga0209758_1007661 3300025297 Bacteria 7277
186 Ga0209758_1025543 3300025297 Bacteria 2588
187 Ga0209050_1000044 3300025298 Bacteria 391114
188 Ga0209050_1030865 3300025298 Bacteria 1682
189 Ga0209256_1000003 3300025299 Bacteria 1661127
190 Ga0209256_1000025 3300025299 Bacteria 442449
191 Ga0207426_1000062 3300025302 Bacteria 362040
192 Ga0207426_1009203 3300025302 Bacteria 3927
193 Ga0209051_1000031 3300025303 Bacteria 391114
194 Ga0209257_1000058 3300025304 Bacteria 381686
195 Ga0207697_10002253 3300025315 Bacteria 10083
196 Ga0207656_10007615 3300025321 Bacteria 3953
197 Ga0207682_10001337 3300025893 Bacteria 11351
198 Ga0207692_10000521 3300025898 Bacteria 13638
199 Ga0207710_10033749 3300025900 Bacteria 2246
200 Ga0207688_10013086 3300025901 Bacteria 4510
201 Ga0207688_10017622 3300025901 Bacteria 3884
202 Ga0207680_10067961 3300025903 Bacteria 2197
203 Ga0207699_10002343 3300025906 Bacteria 8947
204 Ga0207645_10040718 3300025907 Bacteria 2975
205 Ga0207645_10078778 3300025907 Bacteria 2111
206 Ga0207643_10000414 3300025908 Bacteria 28310
207 Ga0207705_10091402 3300025909 Bacteria 2229
208 Ga0207707_10041769 3300025912 Bacteria 4005
209 Ga0207695_10000006 3300025913 Bacteria 1135309
210 Ga0207695_10012071 3300025913 Bacteria 10385
211 Ga0207695_10056317 3300025913 Bacteria 4092
212 Ga0207671_10026379 3300025914 Bacteria 4356
213 Ga0207693_10042705 3300025915 Bacteria 3569
214 Ga0207693_10242609 3300025915 Unclassified 1414
215 Ga0207663_10001919 3300025916 Bacteria 9848
216 Ga0207663_10023847 3300025916 Bacteria 3518
217 Ga0207660_10240360 3300025917 Bacteria 1426
218 Ga0207662_10005282 3300025918 Bacteria 6863
219 Ga0207657_10005578 3300025919 Bacteria 13141
220 Ga0207657_10010255 3300025919 Bacteria 9357
221 Ga0207657_10018390 3300025919 Bacteria 6672
222 Ga0207657_10064124 3300025919 Bacteria 3138
223 Ga0207649_10002419 3300025920 Bacteria 10450
224 Ga0207649_10006281 3300025920 Bacteria 6455
225 Ga0207652_10044987 3300025921 Bacteria 3763
226 Ga0207652_10098861 3300025921 Bacteria 2574
227 Ga0207646_10015337 3300025922 Bacteria 7239
228 Ga0207694_10008427 3300025924 Bacteria 7782
229 Ga0207694_10020791 3300025924 Bacteria 4968
230 Ga0207650_10002562 3300025925 Bacteria 12598
231 Ga0207650_10011677 3300025925 Bacteria 6051
232 Ga0207659_10014172 3300025926 Bacteria 5133
233 Ga0207687_10101146 3300025927 Bacteria 2121
234 Ga0207700_10056237 3300025928 Bacteria 2961
235 Ga0207664_10002495 3300025929 Bacteria 12185
236 Ga0207664_10011554 3300025929 Bacteria 6285
237 Ga0207664_10036407 3300025929 Bacteria 3804
238 Ga0207664_10039810 3300025929 Bacteria 3650
239 Ga0207664_10174821 3300025929 Bacteria 1840
240 Ga0207644_10006901 3300025931 Bacteria 7394
241 Ga0207690_10005354 3300025932 Bacteria 7561
242 Ga0207690_10034190 3300025932 Bacteria 3274
243 Ga0207690_10151201 3300025932 Bacteria 1721
244 Ga0207706_10000097 3300025933 Bacteria 91923
245 Ga0207706_10002147 3300025933 Bacteria 19283
246 Ga0207706_10058691 3300025933 Bacteria 3389
247 Ga0207665_10008257 3300025939 Bacteria 6873
248 Ga0207691_10004279 3300025940 Bacteria 13868
249 Ga0207691_10008856 3300025940 Bacteria 9657
250 Ga0207691_10027166 3300025940 Bacteria 5369
251 Ga0207711_10004625 3300025941 Bacteria 11699
252 Ga0207711_10199206 3300025941 Bacteria 1827
253 Ga0207689_10004210 3300025942 Bacteria 13081
254 Ga0207689_10011539 3300025942 Bacteria 7568
255 Ga0207679_10000958 3300025945 Bacteria 18521
256 Ga0207679_10004869 3300025945 Bacteria 8369
257 Ga0207679_10047955 3300025945 Bacteria 3107
258 Ga0207667_10004020 3300025949 Bacteria 18074
259 Ga0207667_10168371 3300025949 Bacteria 2252
260 Ga0207667_10213424 3300025949 Bacteria 1978
261 Ga0207651_10013946 3300025960 Bacteria 4623
262 Ga0207651_10024368 3300025960 Bacteria 3742
263 Ga0207651_10085759 3300025960 Bacteria 2286
264 Ga0207640_10034428 3300025981 Bacteria 3162
265 Ga0207640_10088305 3300025981 Bacteria 2140
266 Ga0207658_10016482 3300025986 Bacteria 5082
267 Ga0207677_10131816 3300026023 Bacteria 1899
268 Ga0207703_10222202 3300026035 Bacteria 1689
269 Ga0207639_10208775 3300026041 Bacteria 1680
270 Ga0207678_10002109 3300026067 Bacteria 18007
271 Ga0207678_10004663 3300026067 Bacteria 12308
272 Ga0207678_10010866 3300026067 Bacteria 8001
273 Ga0207708_10011178 3300026075 Bacteria 6679
274 Ga0207702_10001646 3300026078 Bacteria 22069
275 Ga0207702_10004787 3300026078 Bacteria 11928
276 Ga0207702_10010039 3300026078 Bacteria 7938
277 Ga0207648_10013837 3300026089 Bacteria 7485
278 Ga0207648_10066317 3300026089 Bacteria 3148
279 Ga0207676_10195226 3300026095 Bacteria 1784
280 Ga0207676_10232300 3300026095 Bacteria 1649
281 Ga0207674_10001678 3300026116 Bacteria 28471
282 Ga0207674_10003765 3300026116 Bacteria 18507
283 Ga0207674_10005121 3300026116 Bacteria 15644
284 Ga0207675_100007991 3300026118 Bacteria 9969
285 Ga0207675_100012715 3300026118 Bacteria 7865
286 Ga0207683_10028150 3300026121 Bacteria 4859
287 Ga0207698_10014111 3300026142 Bacteria 5298
288 Ga0207698_10051615 3300026142 Bacteria 3145
289 Ga0207698_10109028 3300026142 Bacteria 2316
290 Ga0207698_10153254 3300026142 Bacteria 2004
291 Ga0207698_10306768 3300026142 Bacteria 1480
292 Ga0209971_1007629 3300027682 Bacteria 2568
293 Ga0209974_10002997 3300027876 Bacteria 6113
294 Ga0209974_10003550 3300027876 Bacteria 5611
295 Ga0207428_10145278 3300027907 Bacteria 1808
296 Ga0268266_10149982 3300028379 Bacteria 2100
297 Ga0268265_10068014 3300028380 Bacteria 2760
298 Ga0268265_10126309 3300028380 Bacteria 2117
299 Ga0268264_10000158 3300028381 Bacteria 153433
300 Ga0307515_10000471 3300028794 Bacteria 96225
301 Ga0307515_10126937 3300028794 Bacteria 2841
302 Ga0307511_10076437 3300030521 Bacteria 2393
303 Ga0307513_10024581 3300031456 Bacteria 7005
304 Ga0307513_10075219 3300031456 Bacteria 3508
305 Ga0307408_100001250 3300031548 Bacteria 19089
306 Ga0307408_100031007 3300031548 Bacteria 3718
307 Ga0307508_10001991 3300031616 Bacteria 22312
308 Ga0307514_10001153 3300031649 Bacteria 35997
309 Ga0307514_10010135 3300031649 Bacteria 7888
310 Ga0316578_10044180 3300031728 Bacteria 2591
311 Ga0307516_10000535 3300031730 Bacteria 50751
312 Ga0307516_10022516 3300031730 Bacteria 6468
313 Ga0307516_10053779 3300031730 Bacteria 3936
314 Ga0307516_10124256 3300031730 Bacteria 2367
315 Ga0307410_10067317 3300031852 Bacteria 2470
316 Ga0307406_10022935 3300031901 Bacteria 3708
317 Ga0307412_10013943 3300031911 Bacteria 4727
318 Ga0307416_100034740 3300032002 Bacteria 3841
319 Ga0307411_10061536 3300032005 Bacteria 2499
320 Ga0307507_10019181 3300033179 Bacteria 7715
321 Ga0307507_10129906 3300033179 Bacteria 1976
322 Ga0316592_1011542 3300033524 Bacteria 1798
323 Ga0316586_1005895 3300033527 Bacteria 1742
324 Ga0316588_1013292 3300033528 Bacteria 1784
325 Ga0373926_0053211 3300035083 Bacteria 1465
326 Ga0373943_0048354 3300035170 Bacteria 2084
327 Ga0373935_0015470 3300035692 Bacteria 4612
328 Ga0373927_0024182 3300035695 Bacteria 3974
329 Ga0373927_0056276 3300035695 Bacteria 2542
330 Ga0373927_0128772 3300035695 Bacteria 1653
331 Ga0373947_0007587 3300035725 Bacteria 6278
332 Ga0316584_0048357 3300036712 Bacteria 3178
333 Ga0373925_0005419 3300037068 Bacteria 9506
334 Ga0316581_0024693 3300037588 Bacteria 1784
335 Ga0436364_1326813 3300037853 Bacteria 24311
336 Ga0436365_0481299 3300039437 Unclassified 1456
337 Ga0436365_1540706 3300039437 Bacteria 11543
338 Ga0436361_0708343 3300039447 Bacteria 2789
339 Ga0451853_1058914 3300041512 Bacteria 1572
340 Ga0466957_0062907 3300044842 Bacteria 2280
341 Ga0466960_0023085 3300044901 Bacteria 2789
342 Ga0466967_0147185 3300045976 Bacteria 2198
343 Ga0495629_0106862 3300046459 Bacteria 1952
344 Ga0495580_0044744 3300046472 Bacteria 3147
345 Ga0495639_0010452 3300046475 Bacteria 3999
346 Ga0495662_0056643 3300046476 Bacteria 1893
347 Ga0495664_0038233 3300046477 Bacteria 2833
348 Ga0495621_0027910 3300046539 Unclassified 1915
349 Ga0495645_0028265 3300046543 Bacteria 4075
350 Ga0495667_0026209 3300046559 Bacteria 3927
351 Ga0495658_0032757 3300046683 Bacteria 2840
352 Ga0495600_0068076 3300046809 Bacteria 2327
353 Ga0495581_0017290 3300047315 Bacteria 4190
354 Ga0496101_0212265 3300048904 Bacteria 1500
355 Ga0496102_0005493 3300048905 Bacteria 10759
356 Ga0496102_0034557 3300048905 Bacteria 4547
357 Ga0496105_0104398 3300048908 Bacteria 2340
358 Ga0496106_0001117 3300048909 Bacteria 19858
359 Ga0496106_0001440 3300048909 Bacteria 17829
360 Ga0496107_0009862 3300048910 Bacteria 6623
361 Ga0496108_0019688 3300048911 Bacteria 5544
362 Ga0496109_0053974 3300048912 Bacteria 3667
363 Ga0496109_0189964 3300048912 Bacteria 1930
364 Ga0496114_0335859 3300048917 Bacteria 1336
365 Ga0496115_0123105 3300048918 Bacteria 2135
366 Ga0496117_0005589 3300048920 Bacteria 13139
367 Ga0496118_0002954 3300048921 Bacteria 22046
368 Ga0496119_0047670 3300048922 Bacteria 2664
369 Ga0496119_0051615 3300048922 Bacteria 2526
370 Ga0496121_0003239 3300048924 Bacteria 23398
371 Ga0496121_0008312 3300048924 Bacteria 12270
372 Ga0496124_0002478 3300048927 Bacteria 24096
373 Ga0496125_0001087 3300048928 Bacteria 41885
374 Ga0496125_0001432 3300048928 Bacteria 34774
375 Ga0496126_0010447 3300048929 Bacteria 9728
376 Ga0501308_003595 3300049128 Bacteria 1445
377 Ga0501032_0021246 3300049569 Bacteria 4514
378 Ga0501033_0056901 3300049570 Bacteria 2890
379 Ga0501034_0172942 3300049571 Bacteria 2126
380 Ga0501037_0071562 3300049573 Bacteria 2523
381 Ga0501047_0014279 3300049581 Bacteria 7552
382 Ga0501047_0084525 3300049581 Bacteria 3050
383 Ga0501069_0028124 3300049585 Bacteria 3083
384 Ga0501069_0063411 3300049585 Unclassified 2064
385 Ga0501070_0000487 3300049586 Bacteria 36109
386 Ga0501070_0000615 3300049586 Bacteria 32680
387 Ga0501070_0038320 3300049586 Bacteria 3999
388 Ga0501073_0061088 3300049589 Bacteria 2630
389 Ga0501080_0005407 3300049742 Bacteria 11390
390 Ga0501035_0001891 3300049822 Bacteria 21065
391 Ga0501035_0008042 3300049822 Bacteria 9829
392 Ga0501044_0012896 3300049823 Bacteria 9047
393 Ga0501044_0013416 3300049823 Bacteria 8860
394 Ga0501044_0129186 3300049823 Bacteria 2522
395 nmdc:mga0k408_6151_c1 3300050493 Bacteria 3918
396 nmdc:mga08y16_190378_c1 3300050511 Bacteria 2128
397 nmdc:mga08y16_25291_c1 3300050511 Bacteria 6259
398 nmdc:mga0rr50_114368_c1 3300050513 Bacteria 2140
399 nmdc:mga0a205_208337_c1 3300050515 Bacteria 1844
400 Ga0495601_0016780 3300053077 Bacteria 4441
401 Ga0500635_0004299 3300053080 Bacteria 3662
402 Ga0500644_0051359 3300053088 Bacteria 1415
403 Ga0500651_0002029 3300053093 Bacteria 10515
404 Ga0500569_008241 3300053109 Bacteria 2377
405 Ga0500593_000199 3300053117 Bacteria 24418
406 Ga0500622_0004627 3300053156 Bacteria 8536
407 Ga0500634_0005589 3300053161 Bacteria 5987
408 Ga0500639_060258 3300053163 Bacteria 1957
409 Ga0500636_0013161 3300053177 Bacteria 4854
410 Ga0500636_0020142 3300053177 Bacteria 3947
411 Ga0500645_000278 3300053730 Bacteria 36629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037588 Ga0316581_0024693 Ga0316581_0024693_21_1214 395
2 3300044842 Ga0466957_0062907 Ga0466957_0062907_1051_2244 395
3 3300048917 Ga0496114_0335859 Ga0496114_0335859_37_1227 395
4 3300025925 Ga0207650_10011677 Ga0207650_100116773 408
5 3300005617 Ga0068859_100152989 Ga0068859_1001529892 410
6 3300006931 Ga0097620_100152988 Ga0097620_1001529882 410
7 3300037853 Ga0436364_1326813 Ga0436364_1326813_14775_16025 410
8 3300049128 Ga0501308_003595 Ga0501308_003595_90_1355 410
9 3300050493 nmdc:mga0k408_6151_c1 nmdc:mga0k408_6151_c1_578_1828 411
10 iso_pu_bacteria 2508501050 2508729437 411
11 iso_pu_bacteria 2511231002 2511243190 411
12 iso_pu_bacteria 2835312727 2835316083 411
13 3300026118 Ga0207675_100007991 Ga0207675_1000079918 413
14 3300026121 Ga0207683_10028150 Ga0207683_100281505 413
15 3300048904 Ga0496101_0212265 Ga0496101_0212265_86_1354 413
16 iso_pu_bacteria 2643221736 2644744320 413
17 iso_pu_bacteria 2841760612 2841765562 413
18 iso_pu_bacteria 2844104063 2844107172 413
19 iso_pu_bacteria 2851182111 2851186149 413
20 iso_pu_bacteria 2851246043 2851249212 413
21 iso_pu_bacteria 2917699015 2917700936 413
22 iso_pu_bacteria 8054002106 8054007514 413
23 iso_pu_bacteria 8057529695 8057532264 413
24 3300025915 Ga0207693_10242609 Ga0207693_102426091 414
25 3300027876 Ga0209974_10002997 Ga0209974_100029973 414
26 3300033524 Ga0316592_1011542 Ga0316592_10115421 414
27 3300033528 Ga0316588_1013292 Ga0316588_10132921 414
28 3300048928 Ga0496125_0001432 Ga0496125_0001432_18195_19469 414
29 iso_pu_bacteria 2818991467 2819721959 414
30 3300003574 Ga0007410J51695_1035732 Ga0007410J51695_10357321 415
31 3300005843 Ga0068860_100000277 Ga0068860_10000027725 415
32 3300005985 Ga0081539_10068499 Ga0081539_100684992 415
33 3300009098 Ga0105245_10062780 Ga0105245_100627803 415
34 3300009101 Ga0105247_10015921 Ga0105247_100159212 415
35 3300009545 Ga0105237_10001621 Ga0105237_1000162116 415
36 3300009545 Ga0105237_10037577 Ga0105237_100375773 415
37 3300010375 Ga0105239_10092272 Ga0105239_100922723 415
38 3300025900 Ga0207710_10033749 Ga0207710_100337492 415
39 3300025914 Ga0207671_10026379 Ga0207671_100263794 415
40 3300028381 Ga0268264_10000158 Ga0268264_1000015813 415
41 3300030521 Ga0307511_10076437 Ga0307511_100764372 415
42 3300031456 Ga0307513_10075219 Ga0307513_100752192 415
43 3300031728 Ga0316578_10044180 Ga0316578_100441802 415
44 3300031730 Ga0307516_10053779 Ga0307516_100537793 415
45 3300031730 Ga0307516_10124256 Ga0307516_101242562 415
46 3300033179 Ga0307507_10019181 Ga0307507_100191813 415
47 3300033527 Ga0316586_1005895 Ga0316586_10058952 415
48 3300035083 Ga0373926_0053211 Ga0373926_0053211_118_1395 415
49 3300035170 Ga0373943_0048354 Ga0373943_0048354_465_1742 415
50 3300035692 Ga0373935_0015470 Ga0373935_0015470_852_2129 415
51 3300035695 Ga0373927_0056276 Ga0373927_0056276_872_2149 415
52 3300048909 Ga0496106_0001440 Ga0496106_0001440_5943_7220 415
53 3300048920 Ga0496117_0005589 Ga0496117_0005589_10779_12056 415
54 3300048921 Ga0496118_0002954 Ga0496118_0002954_13519_14796 415
55 3300048922 Ga0496119_0051615 Ga0496119_0051615_422_1699 415
56 3300048924 Ga0496121_0003239 Ga0496121_0003239_5890_7167 415
57 3300048927 Ga0496124_0002478 Ga0496124_0002478_14958_16235 415
58 3300048928 Ga0496125_0001087 Ga0496125_0001087_15523_16800 415
59 3300048929 Ga0496126_0010447 Ga0496126_0010447_5782_7059 415
60 3300049569 Ga0501032_0021246 Ga0501032_0021246_2596_3867 415
61 3300049570 Ga0501033_0056901 Ga0501033_0056901_330_1601 415
62 3300049581 Ga0501047_0014279 Ga0501047_0014279_970_2241 415
63 3300049581 Ga0501047_0084525 Ga0501047_0084525_1143_2414 415
64 3300049585 Ga0501069_0028124 Ga0501069_0028124_579_1850 415
65 3300049585 Ga0501069_0063411 Ga0501069_0063411_370_1641 415
66 3300049586 Ga0501070_0000487 Ga0501070_0000487_28258_29529 415
67 3300049586 Ga0501070_0000615 Ga0501070_0000615_16231_17502 415
68 3300049586 Ga0501070_0038320 Ga0501070_0038320_1180_2451 415
69 3300049589 Ga0501073_0061088 Ga0501073_0061088_1274_2545 415
70 3300049742 Ga0501080_0005407 Ga0501080_0005407_8727_9998 415
71 3300049822 Ga0501035_0001891 Ga0501035_0001891_19308_20579 415
72 3300049822 Ga0501035_0008042 Ga0501035_0008042_1930_3201 415
73 3300049823 Ga0501044_0012896 Ga0501044_0012896_5003_6274 415
74 3300049823 Ga0501044_0013416 Ga0501044_0013416_4173_5444 415
75 3300049823 Ga0501044_0129186 Ga0501044_0129186_682_1953 415
76 3300053080 Ga0500635_0004299 Ga0500635_0004299_444_1721 415
77 3300053109 Ga0500569_008241 Ga0500569_008241_1050_2324 415
78 3300053156 Ga0500622_0004627 Ga0500622_0004627_2941_4215 415
79 3300053163 Ga0500639_060258 Ga0500639_060258_292_1569 415
80 3300053177 Ga0500636_0013161 Ga0500636_0013161_2080_3354 415
81 iso_pu_bacteria 2906626472 2906631645 415
82 iso_pu_bacteria 2932794094 2932796145 415
83 iso_pu_bacteria 2932801729 2932807721 415
84 iso_pu_bacteria 2935883170 2935887428 415
85 iso_pu_bacteria 3005483717 3005490349 415
86 3300002987 JGI25159J45721_1005174 JGI25159J45721_10051742 416
87 3300003187 JGI25151J46595_10000056 JGI25151J46595_10000056132 416
88 3300003187 JGI25151J46595_10033686 JGI25151J46595_100336862 416
89 3300003775 Ga0055524_1000089 Ga0055524_1000089104 416
90 3300005262 Ga0065165_1000026 Ga0065165_1000026107 416
91 3300005293 Ga0065715_10147123 Ga0065715_101471232 416
92 3300005331 Ga0070670_100013503 Ga0070670_1000135035 416
93 3300005335 Ga0070666_10123158 Ga0070666_101231581 416
94 3300005354 Ga0070675_100002946 Ga0070675_1000029463 416
95 3300005355 Ga0070671_100023443 Ga0070671_1000234433 416
96 3300005364 Ga0070673_100036598 Ga0070673_1000365983 416
97 3300005367 Ga0070667_100119984 Ga0070667_1001199842 416
98 3300005457 Ga0070662_100176967 Ga0070662_1001769671 416
99 3300005543 Ga0070672_100003558 Ga0070672_1000035583 416
100 3300005548 Ga0070665_100013515 Ga0070665_1000135156 416
101 3300006358 Ga0068871_100132040 Ga0068871_1001320402 416
102 3300009177 Ga0105248_10003382 Ga0105248_1000338210 416
103 3300013100 Ga0157373_10133430 Ga0157373_101334302 416
104 3300025245 Ga0207425_1008771 Ga0207425_10087712 416
105 3300025284 Ga0209130_1000150 Ga0209130_100015051 416
106 3300025291 Ga0209675_1000344 Ga0209675_100034424 416
107 3300025294 Ga0209025_1000016 Ga0209025_1000016352 416
108 3300025294 Ga0209025_1007516 Ga0209025_10075162 416
109 3300025295 Ga0209564_1000035 Ga0209564_1000035106 416
110 3300025297 Ga0209758_1001537 Ga0209758_100153718 416
111 3300025297 Ga0209758_1007661 Ga0209758_10076614 416
112 3300025297 Ga0209758_1025543 Ga0209758_10255432 416
113 3300025299 Ga0209256_1000025 Ga0209256_1000025340 416
114 3300025302 Ga0207426_1009203 Ga0207426_10092032 416
115 3300025903 Ga0207680_10067961 Ga0207680_100679613 416
116 3300025907 Ga0207645_10078778 Ga0207645_100787782 416
117 3300025926 Ga0207659_10014172 Ga0207659_100141724 416
118 3300025933 Ga0207706_10058691 Ga0207706_100586912 416
119 3300025940 Ga0207691_10004279 Ga0207691_100042794 416
120 3300025941 Ga0207711_10004625 Ga0207711_100046259 416
121 3300025960 Ga0207651_10024368 Ga0207651_100243683 416
122 3300025981 Ga0207640_10088305 Ga0207640_100883052 416
123 3300025986 Ga0207658_10016482 Ga0207658_100164822 416
124 3300026089 Ga0207648_10066317 Ga0207648_100663173 416
125 3300026142 Ga0207698_10109028 Ga0207698_101090281 416
126 3300028794 Ga0307515_10126937 Ga0307515_101269372 416
127 3300031730 Ga0307516_10022516 Ga0307516_100225162 416
128 3300039437 Ga0436365_1540706 Ga0436365_1540706_2614_3897 416
129 3300048912 Ga0496109_0189964 Ga0496109_0189964_306_1568 416
130 3300048922 Ga0496119_0047670 Ga0496119_0047670_1212_2489 416
131 3300048924 Ga0496121_0008312 Ga0496121_0008312_5348_6625 416
132 3300050511 nmdc:mga08y16_190378_c1 nmdc:mga08y16_190378_c1_680_1936 416
133 3300005434 Ga0070709_10001113 Ga0070709_100011135 417
134 3300005436 Ga0070713_100070806 Ga0070713_1000708063 417
135 3300005437 Ga0070710_10007073 Ga0070710_100070732 417
136 3300005439 Ga0070711_100002921 Ga0070711_1000029218 417
137 3300006028 Ga0070717_10129872 Ga0070717_101298722 417
138 3300006173 Ga0070716_100004430 Ga0070716_1000044305 417
139 3300006175 Ga0070712_100002445 Ga0070712_1000024459 417
140 3300006353 Ga0075370_10057810 Ga0075370_100578102 417
141 3300025272 Ga0209455_1000940 Ga0209455_100094013 417
142 3300025297 Ga0209758_1002683 Ga0209758_10026838 417
143 3300025898 Ga0207692_10000521 Ga0207692_100005216 417
144 3300025906 Ga0207699_10002343 Ga0207699_100023437 417
145 3300025913 Ga0207695_10000006 Ga0207695_10000006270 417
146 3300025915 Ga0207693_10042705 Ga0207693_100427053 417
147 3300025916 Ga0207663_10001919 Ga0207663_100019192 417
148 3300025927 Ga0207687_10101146 Ga0207687_101011461 417
149 3300025928 Ga0207700_10056237 Ga0207700_100562373 417
150 3300025929 Ga0207664_10039810 Ga0207664_100398103 417
151 3300025939 Ga0207665_10008257 Ga0207665_100082575 417
152 3300026041 Ga0207639_10208775 Ga0207639_102087751 417
153 3300026142 Ga0207698_10153254 Ga0207698_101532542 417
154 3300039437 Ga0436365_0481299 Ga0436365_0481299_65_1339 417
155 3300039447 Ga0436361_0708343 Ga0436361_0708343_352_1629 417
156 3300044901 Ga0466960_0023085 Ga0466960_0023085_96_1391 417
157 iso_pu_bacteria 2904479285 2904480997 417
158 iso_pu_bacteria 8019648815 8019653389 417
159 3300005328 Ga0070676_10048341 Ga0070676_100483412 418
160 3300005339 Ga0070660_100001343 Ga0070660_1000013437 418
161 3300005339 Ga0070660_100004781 Ga0070660_1000047813 418
162 3300005344 Ga0070661_100002642 Ga0070661_1000026425 418
163 3300005354 Ga0070675_100081943 Ga0070675_1000819432 418
164 3300005355 Ga0070671_100008285 Ga0070671_1000082855 418
165 3300005355 Ga0070671_100126820 Ga0070671_1001268202 418
166 3300005435 Ga0070714_100003536 Ga0070714_1000035369 418
167 3300005439 Ga0070711_100011734 Ga0070711_1000117343 418
168 3300005455 Ga0070663_100005591 Ga0070663_1000055913 418
169 3300005457 Ga0070662_100000538 Ga0070662_10000053813 418
170 3300005458 Ga0070681_10025274 Ga0070681_100252744 418
171 3300005467 Ga0070706_100021214 Ga0070706_1000212142 418
172 3300005530 Ga0070679_100044707 Ga0070679_1000447072 418
173 3300005535 Ga0070684_100026381 Ga0070684_1000263815 418
174 3300005539 Ga0068853_100001262 Ga0068853_1000012625 418
175 3300005563 Ga0068855_100005264 Ga0068855_1000052646 418
176 3300005563 Ga0068855_100009632 Ga0068855_1000096327 418
177 3300005564 Ga0070664_100002874 Ga0070664_1000028748 418
178 3300005564 Ga0070664_100004706 Ga0070664_1000047064 418
179 3300005577 Ga0068857_100005417 Ga0068857_1000054174 418
180 3300005578 Ga0068854_100019387 Ga0068854_1000193874 418
181 3300005614 Ga0068856_100000681 Ga0068856_10000068135 418
182 3300005616 Ga0068852_100000508 Ga0068852_1000005088 418
183 3300005834 Ga0068851_10023196 Ga0068851_100231962 418
184 3300009551 Ga0105238_10000239 Ga0105238_1000023952 418
185 3300013100 Ga0157373_10000948 Ga0157373_100009485 418
186 3300013102 Ga0157371_10002760 Ga0157371_100027603 418
187 3300013102 Ga0157371_10085408 Ga0157371_100854082 418
188 3300013104 Ga0157370_10002204 Ga0157370_1000220416 418
189 3300013105 Ga0157369_10030277 Ga0157369_100302772 418
190 3300013307 Ga0157372_10000712 Ga0157372_100007126 418
191 3300013307 Ga0157372_10031952 Ga0157372_100319522 418
192 3300014326 Ga0157380_10172141 Ga0157380_101721412 418
193 3300014969 Ga0157376_10192146 Ga0157376_101921461 418
194 3300025901 Ga0207688_10017622 Ga0207688_100176222 418
195 3300025907 Ga0207645_10040718 Ga0207645_100407181 418
196 3300025912 Ga0207707_10041769 Ga0207707_100417693 418
197 3300025913 Ga0207695_10012071 Ga0207695_100120712 418
198 3300025916 Ga0207663_10023847 Ga0207663_100238473 418
199 3300025919 Ga0207657_10010255 Ga0207657_100102555 418
200 3300025920 Ga0207649_10002419 Ga0207649_100024193 418
201 3300025920 Ga0207649_10006281 Ga0207649_100062813 418
202 3300025921 Ga0207652_10098861 Ga0207652_100988612 418
203 3300025924 Ga0207694_10008427 Ga0207694_100084276 418
204 3300025929 Ga0207664_10036407 Ga0207664_100364072 418
205 3300025931 Ga0207644_10006901 Ga0207644_100069014 418
206 3300025932 Ga0207690_10005354 Ga0207690_100053543 418
207 3300025932 Ga0207690_10034190 Ga0207690_100341902 418
208 3300025933 Ga0207706_10000097 Ga0207706_1000009759 418
209 3300025940 Ga0207691_10008856 Ga0207691_100088565 418
210 3300025940 Ga0207691_10027166 Ga0207691_100271663 418
211 3300025945 Ga0207679_10000958 Ga0207679_100009585 418
212 3300025945 Ga0207679_10004869 Ga0207679_100048695 418
213 3300025945 Ga0207679_10047955 Ga0207679_100479552 418
214 3300025949 Ga0207667_10004020 Ga0207667_100040201 418
215 3300025960 Ga0207651_10013946 Ga0207651_100139463 418
216 3300025981 Ga0207640_10034428 Ga0207640_100344282 418
217 3300026067 Ga0207678_10002109 Ga0207678_100021098 418
218 3300026078 Ga0207702_10001646 Ga0207702_1000164614 418
219 3300026078 Ga0207702_10010039 Ga0207702_100100396 418
220 3300026116 Ga0207674_10001678 Ga0207674_100016788 418
221 3300026118 Ga0207675_100012715 Ga0207675_1000127155 418
222 3300026142 Ga0207698_10014111 Ga0207698_100141114 418
223 3300027682 Ga0209971_1007629 Ga0209971_10076291 418
224 3300027876 Ga0209974_10003550 Ga0209974_100035503 418
225 3300031548 Ga0307408_100031007 Ga0307408_1000310073 418
226 3300031852 Ga0307410_10067317 Ga0307410_100673172 418
227 3300031901 Ga0307406_10022935 Ga0307406_100229352 418
228 3300031911 Ga0307412_10013943 Ga0307412_100139432 418
229 3300032002 Ga0307416_100034740 Ga0307416_1000347402 418
230 3300032005 Ga0307411_10061536 Ga0307411_100615361 418
231 3300048905 Ga0496102_0005493 Ga0496102_0005493_562_1830 418
232 3300048909 Ga0496106_0001117 Ga0496106_0001117_10764_12032 418
233 3300048910 Ga0496107_0009862 Ga0496107_0009862_2670_3938 418
234 3300049571 Ga0501034_0172942 Ga0501034_0172942_308_1603 418
235 3300049573 Ga0501037_0071562 Ga0501037_0071562_588_1883 418
236 3300053077 Ga0495601_0016780 Ga0495601_0016780_255_1523 418
237 3300005327 Ga0070658_10045293 Ga0070658_100452932 419
238 3300005328 Ga0070676_10072207 Ga0070676_100722071 419
239 3300005336 Ga0070680_100140940 Ga0070680_1001409402 419
240 3300005339 Ga0070660_100029777 Ga0070660_1000297774 419
241 3300005340 Ga0070689_100020558 Ga0070689_1000205584 419
242 3300005354 Ga0070675_100052801 Ga0070675_1000528012 419
243 3300005356 Ga0070674_100069184 Ga0070674_1000691841 419
244 3300005365 Ga0070688_100071117 Ga0070688_1000711173 419
245 3300005435 Ga0070714_100022294 Ga0070714_1000222943 419
246 3300005435 Ga0070714_100115242 Ga0070714_1001152422 419
247 3300005445 Ga0070708_100245881 Ga0070708_1002458812 419
248 3300005458 Ga0070681_10010450 Ga0070681_100104506 419
249 3300005466 Ga0070685_10014628 Ga0070685_100146283 419
250 3300005471 Ga0070698_100065155 Ga0070698_1000651551 419
251 3300005530 Ga0070679_100033654 Ga0070679_1000336543 419
252 3300005535 Ga0070684_100048493 Ga0070684_1000484931 419
253 3300005536 Ga0070697_100063455 Ga0070697_1000634552 419
254 3300005536 Ga0070697_100196711 Ga0070697_1001967112 419
255 3300005548 Ga0070665_100053968 Ga0070665_1000539682 419
256 3300005563 Ga0068855_100080839 Ga0068855_1000808392 419
257 3300005563 Ga0068855_100311951 Ga0068855_1003119512 419
258 3300005577 Ga0068857_100027710 Ga0068857_1000277102 419
259 3300005614 Ga0068856_100000623 Ga0068856_10000062331 419
260 3300005616 Ga0068852_100170143 Ga0068852_1001701432 419
261 3300005617 Ga0068859_100082505 Ga0068859_1000825054 419
262 3300005617 Ga0068859_100218059 Ga0068859_1002180592 419
263 3300005618 Ga0068864_100002897 Ga0068864_1000028973 419
264 3300005718 Ga0068866_10041806 Ga0068866_100418062 419
265 3300005719 Ga0068861_100074105 Ga0068861_1000741051 419
266 3300005841 Ga0068863_100062742 Ga0068863_1000627422 419
267 3300005842 Ga0068858_100029795 Ga0068858_1000297953 419
268 3300006358 Ga0068871_100007341 Ga0068871_1000073418 419
269 3300006871 Ga0075434_100056050 Ga0075434_1000560502 419
270 3300006931 Ga0097620_100082505 Ga0097620_1000825054 419
271 3300006931 Ga0097620_100218041 Ga0097620_1002180412 419
272 3300007076 Ga0075435_100040343 Ga0075435_1000403434 419
273 3300009093 Ga0105240_10005956 Ga0105240_1000595610 419
274 3300009093 Ga0105240_10015915 Ga0105240_100159158 419
275 3300009147 Ga0114129_10016867 Ga0114129_100168674 419
276 3300009177 Ga0105248_10230608 Ga0105248_102306082 419
277 3300009545 Ga0105237_10057273 Ga0105237_100572732 419
278 3300009553 Ga0105249_10084287 Ga0105249_100842873 419
279 3300011119 Ga0105246_10183406 Ga0105246_101834062 419
280 3300013104 Ga0157370_10004071 Ga0157370_1000407110 419
281 3300013104 Ga0157370_10071419 Ga0157370_100714193 419
282 3300013104 Ga0157370_10181283 Ga0157370_101812831 419
283 3300013105 Ga0157369_10013366 Ga0157369_100133664 419
284 3300013297 Ga0157378_10015108 Ga0157378_100151084 419
285 3300013307 Ga0157372_10006268 Ga0157372_100062683 419
286 3300013307 Ga0157372_10011635 Ga0157372_100116353 419
287 3300013307 Ga0157372_10075903 Ga0157372_100759032 419
288 3300014326 Ga0157380_10008109 Ga0157380_100081095 419
289 3300014969 Ga0157376_10035416 Ga0157376_100354163 419
290 3300025315 Ga0207697_10002253 Ga0207697_100022537 419
291 3300025893 Ga0207682_10001337 Ga0207682_100013373 419
292 3300025901 Ga0207688_10013086 Ga0207688_100130862 419
293 3300025908 Ga0207643_10000414 Ga0207643_1000041412 419
294 3300025917 Ga0207660_10240360 Ga0207660_102403601 419
295 3300025918 Ga0207662_10005282 Ga0207662_100052824 419
296 3300025919 Ga0207657_10018390 Ga0207657_100183904 419
297 3300025919 Ga0207657_10064124 Ga0207657_100641243 419
298 3300025921 Ga0207652_10044987 Ga0207652_100449874 419
299 3300025922 Ga0207646_10015337 Ga0207646_100153375 419
300 3300025925 Ga0207650_10002562 Ga0207650_100025622 419
301 3300025929 Ga0207664_10002495 Ga0207664_100024958 419
302 3300025929 Ga0207664_10011554 Ga0207664_100115543 419
303 3300025932 Ga0207690_10151201 Ga0207690_101512012 419
304 3300025933 Ga0207706_10002147 Ga0207706_1000214713 419
305 3300025941 Ga0207711_10199206 Ga0207711_101992062 419
306 3300025942 Ga0207689_10004210 Ga0207689_100042102 419
307 3300025942 Ga0207689_10011539 Ga0207689_100115398 419
308 3300025949 Ga0207667_10213424 Ga0207667_102134242 419
309 3300025960 Ga0207651_10085759 Ga0207651_100857592 419
310 3300026023 Ga0207677_10131816 Ga0207677_101318162 419
311 3300026035 Ga0207703_10222202 Ga0207703_102222022 419
312 3300026067 Ga0207678_10004663 Ga0207678_100046637 419
313 3300026075 Ga0207708_10011178 Ga0207708_100111785 419
314 3300026078 Ga0207702_10004787 Ga0207702_100047875 419
315 3300026089 Ga0207648_10013837 Ga0207648_100138375 419
316 3300026095 Ga0207676_10195226 Ga0207676_101952262 419
317 3300026095 Ga0207676_10232300 Ga0207676_102323002 419
318 3300026116 Ga0207674_10003765 Ga0207674_1000376518 419
319 3300026142 Ga0207698_10051615 Ga0207698_100516153 419
320 3300027907 Ga0207428_10145278 Ga0207428_101452782 419
321 3300028379 Ga0268266_10149982 Ga0268266_101499822 419
322 3300028380 Ga0268265_10068014 Ga0268265_100680141 419
323 3300028380 Ga0268265_10126309 Ga0268265_101263092 419
324 3300036712 Ga0316584_0048357 Ga0316584_0048357_1108_2556 419
325 3300045976 Ga0466967_0147185 Ga0466967_0147185_398_1669 419
326 3300046459 Ga0495629_0106862 Ga0495629_0106862_355_1626 419
327 3300046472 Ga0495580_0044744 Ga0495580_0044744_1588_2859 419
328 3300046475 Ga0495639_0010452 Ga0495639_0010452_2003_3274 419
329 3300046476 Ga0495662_0056643 Ga0495662_0056643_431_1702 419
330 3300046477 Ga0495664_0038233 Ga0495664_0038233_297_1568 419
331 3300046539 Ga0495621_0027910 Ga0495621_0027910_122_1396 419
332 3300046543 Ga0495645_0028265 Ga0495645_0028265_2584_3855 419
333 3300046683 Ga0495658_0032757 Ga0495658_0032757_394_1665 419
334 3300047315 Ga0495581_0017290 Ga0495581_0017290_2495_3766 419
335 3300048905 Ga0496102_0034557 Ga0496102_0034557_54_1328 419
336 3300048908 Ga0496105_0104398 Ga0496105_0104398_537_1811 419
337 3300048911 Ga0496108_0019688 Ga0496108_0019688_4228_5502 419
338 3300048912 Ga0496109_0053974 Ga0496109_0053974_1973_3247 419
339 3300048918 Ga0496115_0123105 Ga0496115_0123105_282_1553 419
340 3300050511 nmdc:mga08y16_25291_c1 nmdc:mga08y16_25291_c1_4885_6159 419
341 3300050513 nmdc:mga0rr50_114368_c1 nmdc:mga0rr50_114368_c1_747_2018 419
342 3300050515 nmdc:mga0a205_208337_c1 nmdc:mga0a205_208337_c1_159_1430 419
343 3300005327 Ga0070658_10038602 Ga0070658_100386024 420
344 3300005339 Ga0070660_100014586 Ga0070660_1000145864 420
345 3300005455 Ga0070663_100014631 Ga0070663_1000146313 420
346 3300005535 Ga0070684_100020023 Ga0070684_1000200234 420
347 3300005539 Ga0068853_100105676 Ga0068853_1001056762 420
348 3300005564 Ga0070664_100031972 Ga0070664_1000319724 420
349 3300005578 Ga0068854_100038423 Ga0068854_1000384235 420
350 3300005614 Ga0068856_100133438 Ga0068856_1001334382 420
351 3300009174 Ga0105241_10005920 Ga0105241_100059205 420
352 3300009545 Ga0105237_10024847 Ga0105237_100248473 420
353 3300009551 Ga0105238_10147815 Ga0105238_101478152 420
354 3300013102 Ga0157371_10105424 Ga0157371_101054242 420
355 3300025321 Ga0207656_10007615 Ga0207656_100076154 420
356 3300025909 Ga0207705_10091402 Ga0207705_100914023 420
357 3300025913 Ga0207695_10056317 Ga0207695_100563174 420
358 3300025919 Ga0207657_10005578 Ga0207657_100055785 420
359 3300025924 Ga0207694_10020791 Ga0207694_100207912 420
360 3300025929 Ga0207664_10174821 Ga0207664_101748212 420
361 3300025949 Ga0207667_10168371 Ga0207667_101683712 420
362 3300026067 Ga0207678_10010866 Ga0207678_100108662 420
363 3300026116 Ga0207674_10005121 Ga0207674_100051218 420
364 3300026142 Ga0207698_10306768 Ga0207698_103067681 420
365 3300028794 Ga0307515_10000471 Ga0307515_1000047188 420
366 3300031456 Ga0307513_10024581 Ga0307513_100245815 420
367 3300031649 Ga0307514_10001153 Ga0307514_1000115327 420
368 3300053177 Ga0500636_0020142 Ga0500636_0020142_893_2188 420
369 iso_pu_bacteria 2511231003 2511248753 420
370 3300002704 JGI25155J39150_1000492 JGI25155J39150_10004925 424
371 3300002738 JGI25154J39366_1000074 JGI25154J39366_10000745 424
372 3300009147 Ga0114129_10333568 Ga0114129_103335681 424
373 3300025206 Ga0209435_100734 Ga0209435_1007342 424
374 3300025246 Ga0209646_1000081 Ga0209646_1000081161 424
375 3300025250 Ga0209026_1001479 Ga0209026_10014794 424
376 3300025256 Ga0209759_1000613 Ga0209759_100061318 424
377 3300053161 Ga0500634_0005589 Ga0500634_0005589_2372_3649 424
378 3300041512 Ga0451853_1058914 Ga0451853_1058914_69_1349 425
379 3300035695 Ga0373927_0024182 Ga0373927_0024182_1038_2438 426
380 3300035725 Ga0373947_0007587 Ga0373947_0007587_3005_4405 426
381 3300037068 Ga0373925_0005419 Ga0373925_0005419_3699_5099 426
382 3300035695 Ga0373927_0128772 Ga0373927_0128772_193_1635 427
383 3300046559 Ga0495667_0026209 Ga0495667_0026209_1099_2424 427
384 3300046809 Ga0495600_0068076 Ga0495600_0068076_828_2153 427
385 3300053093 Ga0500651_0002029 Ga0500651_0002029_3023_4384 427
386 3300002704 JGI25155J39150_1000035 JGI25155J39150_100003566 428
387 3300002705 JGI25156J39149_1000012 JGI25156J39149_100001219 428
388 3300002738 JGI25154J39366_1000029 JGI25154J39366_1000029152 428
389 3300002741 JGI25157J39369_1000014 JGI25157J39369_100001419 428
390 3300003773 Ga0055537_1000092 Ga0055537_100009219 428
391 3300003775 Ga0055524_1000306 Ga0055524_10003068 428
392 3300003784 Ga0055534_1008446 Ga0055534_10084464 428
393 3300003790 Ga0055528_1004400 Ga0055528_10044003 428
394 3300003791 Ga0055530_10003518 Ga0055530_100035183 428
395 3300003792 Ga0055540_1000030 Ga0055540_10000309 428
396 3300004625 Ga0055543_1003139 Ga0055543_10031395 428
397 3300006051 Ga0075364_10055247 Ga0075364_100552471 428
398 3300012513 Ga0157326_1000794 Ga0157326_10007942 428
399 3300025206 Ga0209435_100002 Ga0209435_100002421 428
400 3300025245 Ga0207425_1012580 Ga0207425_10125801 428
401 3300025246 Ga0209646_1000001 Ga0209646_10000012564 428
402 3300025250 Ga0209026_1000040 Ga0209026_1000040211 428
403 3300025256 Ga0209759_1000001 Ga0209759_10000012195 428
404 3300025263 Ga0209565_1000026 Ga0209565_1000026240 428
405 3300025263 Ga0209565_1001969 Ga0209565_10019696 428
406 3300025273 Ga0209673_1000009 Ga0209673_1000009247 428
407 3300025273 Ga0209673_1000012 Ga0209673_1000012148 428
408 3300025284 Ga0209130_1000123 Ga0209130_1000123114 428
409 3300025284 Ga0209130_1000516 Ga0209130_100051632 428
410 3300025291 Ga0209675_1000360 Ga0209675_100036033 428
411 3300025291 Ga0209675_1012142 Ga0209675_10121423 428
412 3300025292 Ga0209676_1000051 Ga0209676_10000518 428
413 3300025292 Ga0209676_1012181 Ga0209676_10121813 428
414 3300025294 Ga0209025_1006160 Ga0209025_10061602 428
415 3300025294 Ga0209025_1009471 Ga0209025_10094712 428
416 3300025295 Ga0209564_1001571 Ga0209564_100157110 428
417 3300025295 Ga0209564_1001782 Ga0209564_10017829 428
418 3300025298 Ga0209050_1000044 Ga0209050_1000044338 428
419 3300025298 Ga0209050_1030865 Ga0209050_10308651 428
420 3300025299 Ga0209256_1000003 Ga0209256_1000003402 428
421 3300025302 Ga0207426_1000062 Ga0207426_1000062134 428
422 3300025303 Ga0209051_1000031 Ga0209051_1000031338 428
423 3300025304 Ga0209257_1000058 Ga0209257_1000058332 428
424 3300031548 Ga0307408_100001250 Ga0307408_1000012504 428
425 3300031616 Ga0307508_10001991 Ga0307508_1000199116 428
426 3300031649 Ga0307514_10010135 Ga0307514_100101355 428
427 3300031730 Ga0307516_10000535 Ga0307516_1000053539 428
428 3300033179 Ga0307507_10129906 Ga0307507_101299062 428
429 3300053088 Ga0500644_0051359 Ga0500644_0051359_28_1317 428
430 3300053117 Ga0500593_000199 Ga0500593_000199_32_1321 428
431 3300053730 Ga0500645_000278 Ga0500645_000278_8855_10144 428

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

79

370

0.82

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

87

403

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1peb-assembly1.cif.gz_A ligand-free high-affinity maltose-binding protein 0.8394 31 419
6vls-assembly1.cif.gz_A structure of c-terminal fragment of vip3a toxin 0.8333 31 419
6vls-assembly4.cif.gz_D structure of c-terminal fragment of vip3a toxin 0.8297 31 419
7cy6-assembly1.cif.gz_A crystal structure of cmd1 in complex with 5mc-dna 0.8267 31 427
7bvt-assembly1.cif.gz_A crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis 0.8227 31 425
ID Description Score Start End Superfamily
2gh9A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8327 32 349 3.40.190.10
5ysdB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8265 32 343 3.40.190.10
4r9gB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8203 31 343 3.40.190.10
af_Q58586_37_116_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8112 30 89 3.40.190.10
6nioA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8072 31 92 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2N0DGZ6-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.97 47 428 GO:0042597
AF-A0A2N0DGZ6-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9651 47 428 GO:0042597
AF-A0A520PCI8-F1-model_v4 Carbohydrate ABC transporter substrate-binding protein 0.9545 136 427
AF-W8X1K4-F1-model_v4 ABC transporter, substrate binding protein 0.9514 65 428
AF-W8X1K4-F1-model_v4 ABC transporter, substrate binding protein 0.9464 65 428

Feature Viewer

pLDDT pTM Quality
91.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map