F442403

General Info

Members Datasets Scaffolds Average Seq Length
431 216 862 88

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_12161699|Ga0307414_121616991
Length 104
Sequence VTLEEDMVAQLKRDWRSTPGLTEAEHVMLEYVEQLTRDAVKIHPGYHERLRGAGFDDRGILQITMIASWFNYINRIADALGIGRYPATTPDVLPPTDKERRGEM

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0
Rhizoplane 2.32
Rhizosphere 95.13
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_12161699 3300032004 Bacteria 520
2 Ga0065715_10010044 3300005293 Bacteria 2937
3 Ga0065715_10354639 3300005293 Bacteria 945
4 Ga0065707_10009744 3300005295 Bacteria 2784
5 Ga0070683_100478965 3300005329 Bacteria 1188
6 Ga0070683_101397961 3300005329 Bacteria 673
7 Ga0070690_100360084 3300005330 Bacteria 1058
8 Ga0070690_101652762 3300005330 Bacteria 520
9 Ga0070677_10034085 3300005333 Bacteria 1965
10 Ga0068869_100177077 3300005334 Bacteria 1670
11 Ga0068869_100203102 3300005334 Bacteria 1563
12 Ga0070680_100016281 3300005336 Bacteria 5850
13 Ga0070680_100613773 3300005336 Bacteria 934
14 Ga0070680_101486635 3300005336 Bacteria 587
15 Ga0068868_102154038 3300005338 Unclassified 531
16 Ga0070660_100744506 3300005339 Unclassified 823
17 Ga0070660_100903103 3300005339 Bacteria 745
18 Ga0070689_100024526 3300005340 Bacteria 4525
19 Ga0070689_100053155 3300005340 Bacteria 3134
20 Ga0070689_100845027 3300005340 Bacteria 807
21 Ga0070687_100008757 3300005343 Unclassified 4300
22 Ga0070661_101172234 3300005344 Bacteria 642
23 Ga0070661_101880695 3300005344 Bacteria 509
24 Ga0070692_10027118 3300005345 Bacteria 2836
25 Ga0070692_10726604 3300005345 Bacteria 671
26 Ga0070668_100000901 3300005347 Bacteria 20668
27 Ga0070668_100342438 3300005347 Bacteria 1263
28 Ga0070669_100001517 3300005353 Bacteria 16789
29 Ga0070669_100006688 3300005353 Bacteria 8302
30 Ga0070669_100037069 3300005353 Bacteria 3536
31 Ga0070675_100019377 3300005354 Bacteria 5421
32 Ga0070675_100035597 3300005354 Bacteria 4046
33 Ga0070671_101082274 3300005355 Bacteria 704
34 Ga0070674_100141697 3300005356 Bacteria 1805
35 Ga0070673_100002357 3300005364 Bacteria 11478
36 Ga0070673_100011640 3300005364 Bacteria 6010
37 Ga0070673_100136489 3300005364 Bacteria 2065
38 Ga0070673_100506269 3300005364 Bacteria 1093
39 Ga0070688_100038148 3300005365 Bacteria 2932
40 Ga0070659_100253521 3300005366 Unclassified 1459
41 Ga0070659_101937732 3300005366 Unclassified 529
42 Ga0070667_100015933 3300005367 Bacteria 6219
43 Ga0070667_100017907 3300005367 Bacteria 5872
44 Ga0070667_100097287 3300005367 Unclassified 2539
45 Ga0070667_100361231 3300005367 Bacteria 1316
46 Ga0070667_100813283 3300005367 Bacteria 868
47 Ga0070709_10007481 3300005434 Bacteria 5989
48 Ga0070709_11023382 3300005434 Bacteria 658
49 Ga0070713_100902472 3300005436 Bacteria 850
50 Ga0070701_10026312 3300005438 Bacteria 2836
51 Ga0070701_10135132 3300005438 Bacteria 1405
52 Ga0070700_100260886 3300005441 Bacteria 1248
53 Ga0070700_100315086 3300005441 Bacteria 1147
54 Ga0070700_101725241 3300005441 Bacteria 538
55 Ga0070694_100109541 3300005444 Bacteria 1966
56 Ga0070694_100822515 3300005444 Bacteria 763
57 Ga0070708_100019039 3300005445 Bacteria 5758
58 Ga0070708_100020656 3300005445 Bacteria 5558
59 Ga0070663_100293956 3300005455 Archaea 1298
60 Ga0070662_100072126 3300005457 Bacteria 2549
61 Ga0070662_100089162 3300005457 Bacteria 2313
62 Ga0070662_100134733 3300005457 Bacteria 1908
63 Ga0068867_100002077 3300005459 Bacteria 14032
64 Ga0068867_100068330 3300005459 Bacteria 2652
65 Ga0070685_10023322 3300005466 Bacteria 3388
66 Ga0070685_11209084 3300005466 Bacteria 575
67 Ga0070706_100076086 3300005467 Bacteria 3107
68 Ga0070706_102070628 3300005467 Unclassified 515
69 Ga0070707_100003322 3300005468 Bacteria 15188
70 Ga0070707_100394647 3300005468 Bacteria 1343
71 Ga0070707_101585713 3300005468 Bacteria 622
72 Ga0070698_100017740 3300005471 Bacteria 7497
73 Ga0070698_100051405 3300005471 Bacteria 4197
74 Ga0070698_100538071 3300005471 Bacteria 1107
75 Ga0070698_101848906 3300005471 Bacteria 557
76 Ga0070699_100344596 3300005518 Bacteria 1341
77 Ga0070684_100623161 3300005535 Unclassified 1003
78 Ga0070697_100000970 3300005536 Bacteria 21656
79 Ga0070697_100436095 3300005536 Bacteria 1140
80 Ga0070672_100006462 3300005543 Bacteria 7880
81 Ga0070672_100007061 3300005543 Bacteria 7595
82 Ga0070672_100027146 3300005543 Bacteria 4268
83 Ga0070696_100146175 3300005546 Bacteria 1732
84 Ga0070696_100793113 3300005546 Bacteria 779
85 Ga0070665_100000646 3300005548 Bacteria 47132
86 Ga0070665_100065440 3300005548 Bacteria 3646
87 Ga0070704_100122084 3300005549 Unclassified 2003
88 Ga0070704_100142972 3300005549 Bacteria 1871
89 Ga0070704_100895417 3300005549 Bacteria 798
90 Ga0068855_100818103 3300005563 Bacteria 989
91 Ga0070664_100105405 3300005564 Unclassified 2455
92 Ga0070664_100232268 3300005564 Bacteria 1653
93 Ga0070664_100878183 3300005564 Bacteria 840
94 Ga0070664_101597806 3300005564 Bacteria 618
95 Ga0068857_100063804 3300005577 Unclassified 3275
96 Ga0068857_100510396 3300005577 Bacteria 1129
97 Ga0068857_101037902 3300005577 Bacteria 790
98 Ga0068857_101643341 3300005577 Bacteria 627
99 Ga0068854_101426231 3300005578 Bacteria 627
100 Ga0068852_100310473 3300005616 Bacteria 1529
101 Ga0068852_101089467 3300005616 Bacteria 819
102 Ga0068859_100006963 3300005617 Bacteria 11476
103 Ga0068859_100172984 3300005617 Bacteria 2241
104 Ga0068859_100214689 3300005617 Bacteria 2011
105 Ga0068859_100242360 3300005617 Bacteria 1892
106 Ga0068859_100393962 3300005617 Bacteria 1481
107 Ga0068859_100412571 3300005617 Bacteria 1446
108 Ga0068859_100685572 3300005617 Bacteria 1116
109 Ga0068864_100121185 3300005618 Bacteria 2338
110 Ga0068864_100983469 3300005618 Bacteria 836
111 Ga0068861_100364628 3300005719 Bacteria 1272
112 Ga0068861_100512371 3300005719 Bacteria 1086
113 Ga0068861_101936516 3300005719 Bacteria 587
114 Ga0068870_10003108 3300005840 Bacteria 7004
115 Ga0068870_10006645 3300005840 Bacteria 5109
116 Ga0068863_101042040 3300005841 Bacteria 822
117 Ga0068858_100009514 3300005842 Bacteria 9272
118 Ga0068858_100127049 3300005842 Bacteria 2388
119 Ga0068858_100203027 3300005842 Bacteria 1875
120 Ga0068858_100900183 3300005842 Bacteria 865
121 Ga0068860_100080681 3300005843 Bacteria 3093
122 Ga0068860_100103253 3300005843 Bacteria 2721
123 Ga0068860_101276136 3300005843 Bacteria 755
124 Ga0068860_101867001 3300005843 Bacteria 622
125 Ga0068862_100011125 3300005844 Bacteria 7429
126 Ga0068862_100028997 3300005844 Bacteria 4662
127 Ga0070717_10654324 3300006028 Bacteria 954
128 Ga0070715_10208691 3300006163 Bacteria 997
129 Ga0070715_10415062 3300006163 Bacteria 752
130 Ga0070716_100186898 3300006173 Bacteria 1365
131 Ga0097621_102389135 3300006237 Bacteria 506
132 Ga0068871_101248947 3300006358 Unclassified 698
133 Ga0068871_101999124 3300006358 Bacteria 552
134 Ga0075428_100125276 3300006844 Bacteria 2796
135 Ga0075428_100420100 3300006844 Bacteria 1433
136 Ga0075428_100678836 3300006844 Bacteria 1098
137 Ga0075431_100122693 3300006847 Bacteria 2681
138 Ga0075431_100202446 3300006847 Bacteria 2031
139 Ga0075431_102012846 3300006847 Bacteria 533
140 Ga0075433_11487936 3300006852 Bacteria 585
141 Ga0075434_100026948 3300006871 Bacteria 5638
142 Ga0075434_100135417 3300006871 Bacteria 2483
143 Ga0075434_101903075 3300006871 Bacteria 601
144 Ga0075429_101332836 3300006880 Bacteria 626
145 Ga0068865_100023035 3300006881 Bacteria 4072
146 Ga0068865_100058276 3300006881 Bacteria 2697
147 Ga0068865_100534963 3300006881 Unclassified 982
148 Ga0068865_101096494 3300006881 Bacteria 701
149 Ga0075436_100081306 3300006914 Bacteria 2246
150 Ga0075436_100487354 3300006914 Bacteria 901
151 Ga0097620_100006963 3300006931 Bacteria 11476
152 Ga0097620_100172977 3300006931 Bacteria 2241
153 Ga0097620_100214694 3300006931 Bacteria 2011
154 Ga0097620_100242345 3300006931 Bacteria 1892
155 Ga0097620_100393953 3300006931 Bacteria 1481
156 Ga0097620_100412572 3300006931 Bacteria 1446
157 Ga0097620_100685612 3300006931 Bacteria 1116
158 Ga0097620_100713330 3300006931 Bacteria 1093
159 Ga0075435_100120870 3300007076 Bacteria 2186
160 Ga0075435_100526248 3300007076 Bacteria 1023
161 Ga0075435_101395859 3300007076 Bacteria 614
162 Ga0111539_10004336 3300009094 Bacteria 18565
163 Ga0111539_12038931 3300009094 Bacteria 665
164 Ga0105247_10006122 3300009101 Bacteria 7473
165 Ga0105247_10014304 3300009101 Bacteria 4764
166 Ga0105247_10018254 3300009101 Bacteria 4209
167 Ga0105247_11114564 3300009101 Bacteria 623
168 Ga0114129_10081540 3300009147 Bacteria 4497
169 Ga0114129_10467632 3300009147 Bacteria 1652
170 Ga0114129_10469071 3300009147 Bacteria 1649
171 Ga0114129_12176557 3300009147 Bacteria 668
172 Ga0114129_12459625 3300009147 Bacteria 623
173 Ga0105243_10067546 3300009148 Bacteria 2878
174 Ga0105243_10423552 3300009148 Bacteria 1242
175 Ga0105243_11834026 3300009148 Bacteria 638
176 Ga0105243_11885678 3300009148 Bacteria 630
177 Ga0105243_12693691 3300009148 Bacteria 537
178 Ga0105241_11321663 3300009174 Bacteria 687
179 Ga0105242_10027117 3300009176 Bacteria 4546
180 Ga0105242_10145124 3300009176 Bacteria 2064
181 Ga0105242_10986845 3300009176 Unclassified 849
182 Ga0105248_10012200 3300009177 Bacteria 9479
183 Ga0105248_10401427 3300009177 Bacteria 1543
184 Ga0105248_10470132 3300009177 Bacteria 1417
185 Ga0105248_10986651 3300009177 Bacteria 951
186 Ga0105248_11081583 3300009177 Bacteria 906
187 Ga0105237_10416764 3300009545 Bacteria 1348
188 Ga0105237_10911108 3300009545 Bacteria 886
189 Ga0105237_11820714 3300009545 Bacteria 616
190 Ga0105249_10002620 3300009553 Bacteria 15579
191 Ga0105249_10461499 3300009553 Unclassified 1310
192 Ga0105249_10511859 3300009553 Bacteria 1247
193 Ga0105246_10145306 3300011119 Bacteria 1789
194 Ga0105246_10358872 3300011119 Bacteria 1197
195 Ga0105246_10702542 3300011119 Bacteria 886
196 Ga0157314_1059505 3300012500 Bacteria 509
197 Ga0157371_10340340 3300013102 Bacteria 1091
198 Ga0157371_10921473 3300013102 Bacteria 663
199 Ga0157378_10067080 3300013297 Bacteria 3214
200 Ga0157378_10930474 3300013297 Bacteria 901
201 Ga0157378_12662213 3300013297 Bacteria 553
202 Ga0163162_10053165 3300013306 Bacteria 4070
203 Ga0163162_10172599 3300013306 Bacteria 2287
204 Ga0163162_10192218 3300013306 Unclassified 2169
205 Ga0163162_10883335 3300013306 Bacteria 1008
206 Ga0163162_12809625 3300013306 Bacteria 560
207 Ga0157372_10373640 3300013307 Bacteria 1661
208 Ga0157372_11662258 3300013307 Bacteria 735
209 Ga0157375_10017620 3300013308 Bacteria 6450
210 Ga0157375_10030935 3300013308 Bacteria 5053
211 Ga0157375_10077778 3300013308 Bacteria 3349
212 Ga0157375_10108459 3300013308 Bacteria 2871
213 Ga0157375_10276443 3300013308 Bacteria 1842
214 Ga0157375_10392377 3300013308 Bacteria 1555
215 Ga0157375_10442397 3300013308 Bacteria 1465
216 Ga0163163_10067080 3300014325 Bacteria 3566
217 Ga0163163_10238884 3300014325 Bacteria 1866
218 Ga0157380_10054957 3300014326 Bacteria 3161
219 Ga0157380_11978964 3300014326 Bacteria 644
220 Ga0157379_10436334 3300014968 Bacteria 1207
221 Ga0157379_10860588 3300014968 Bacteria 858
222 Ga0157379_11020937 3300014968 Bacteria 789
223 Ga0157376_10314407 3300014969 Bacteria 1487
224 Ga0163161_10079866 3300017792 Bacteria 2406
225 Ga0163161_10183527 3300017792 Bacteria 1605
226 Ga0206354_10844215 3300020081 Bacteria 615
227 Ga0228598_1091250 3300024227 Unclassified 613
228 Ga0207697_10017836 3300025315 Bacteria 2914
229 Ga0207697_10109548 3300025315 Bacteria 1182
230 Ga0207697_10376461 3300025315 Bacteria 630
231 Ga0207682_10006591 3300025893 Bacteria 4672
232 Ga0207642_10397336 3300025899 Bacteria 824
233 Ga0207710_10218698 3300025900 Bacteria 945
234 Ga0207688_10201343 3300025901 Bacteria 1194
235 Ga0207685_10154327 3300025905 Bacteria 1042
236 Ga0207645_10051113 3300025907 Bacteria 2640
237 Ga0207645_10986479 3300025907 Bacteria 571
238 Ga0207645_11048278 3300025907 Bacteria 551
239 Ga0207643_10010205 3300025908 Bacteria 5052
240 Ga0207643_10023577 3300025908 Bacteria 3393
241 Ga0207684_10107531 3300025910 Bacteria 2386
242 Ga0207684_10716461 3300025910 Unclassified 849
243 Ga0207684_11443800 3300025910 Bacteria 562
244 Ga0207671_10962668 3300025914 Bacteria 673
245 Ga0207663_10622261 3300025916 Bacteria 850
246 Ga0207660_10669856 3300025917 Bacteria 846
247 Ga0207662_10004310 3300025918 Bacteria 7468
248 Ga0207662_10065909 3300025918 Bacteria 2181
249 Ga0207657_10696409 3300025919 Unclassified 789
250 Ga0207649_10273155 3300025920 Bacteria 1226
251 Ga0207646_10000842 3300025922 Bacteria 39742
252 Ga0207646_10151015 3300025922 Bacteria 2095
253 Ga0207646_10651934 3300025922 Bacteria 943
254 Ga0207646_11674838 3300025922 Bacteria 547
255 Ga0207681_10006946 3300025923 Bacteria 6943
256 Ga0207681_10506210 3300025923 Unclassified 989
257 Ga0207681_10593931 3300025923 Bacteria 914
258 Ga0207650_11760282 3300025925 Bacteria 525
259 Ga0207659_10035603 3300025926 Bacteria 3442
260 Ga0207659_10201327 3300025926 Bacteria 1590
261 Ga0207700_10018760 3300025928 Bacteria 4657
262 Ga0207644_10237480 3300025931 Bacteria 1450
263 Ga0207644_11846020 3300025931 Bacteria 505
264 Ga0207690_10488221 3300025932 Bacteria 995
265 Ga0207690_10585932 3300025932 Bacteria 909
266 Ga0207706_10006808 3300025933 Bacteria 10569
267 Ga0207706_10083589 3300025933 Bacteria 2806
268 Ga0207686_10077438 3300025934 Bacteria 2159
269 Ga0207709_10249321 3300025935 Bacteria 1296
270 Ga0207709_11088331 3300025935 Bacteria 656
271 Ga0207670_10273252 3300025936 Bacteria 1314
272 Ga0207670_10917406 3300025936 Bacteria 734
273 Ga0207669_10190667 3300025937 Bacteria 1478
274 Ga0207704_10085758 3300025938 Bacteria 2051
275 Ga0207704_10131258 3300025938 Bacteria 1735
276 Ga0207704_10431076 3300025938 Unclassified 1048
277 Ga0207704_11392619 3300025938 Bacteria 601
278 Ga0207665_10048352 3300025939 Bacteria 2855
279 Ga0207691_10014340 3300025940 Bacteria 7556
280 Ga0207691_10040503 3300025940 Bacteria 4303
281 Ga0207691_10097418 3300025940 Unclassified 2629
282 Ga0207711_10085716 3300025941 Bacteria 2760
283 Ga0207711_10666311 3300025941 Bacteria 971
284 Ga0207689_10064949 3300025942 Bacteria 3002
285 Ga0207689_10124449 3300025942 Bacteria 2121
286 Ga0207661_10054385 3300025944 Bacteria 3207
287 Ga0207679_10127542 3300025945 Bacteria 2036
288 Ga0207679_10146422 3300025945 Bacteria 1916
289 Ga0207679_11205907 3300025945 Bacteria 695
290 Ga0207651_10529602 3300025960 Bacteria 1022
291 Ga0207651_10544038 3300025960 Bacteria 1009
292 Ga0207651_11034939 3300025960 Bacteria 734
293 Ga0207712_10165116 3300025961 Bacteria 1725
294 Ga0207712_10269113 3300025961 Bacteria 1385
295 Ga0207712_10507248 3300025961 Bacteria 1032
296 Ga0207712_11188522 3300025961 Bacteria 680
297 Ga0207668_10056228 3300025972 Bacteria 2739
298 Ga0207668_10347269 3300025972 Bacteria 1239
299 Ga0207640_12039143 3300025981 Unclassified 520
300 Ga0207658_10650264 3300025986 Bacteria 950
301 Ga0207658_10700340 3300025986 Bacteria 915
302 Ga0207658_10945672 3300025986 Bacteria 785
303 Ga0207658_11393928 3300025986 Bacteria 641
304 Ga0207677_10897502 3300026023 Bacteria 799
305 Ga0207677_11293837 3300026023 Bacteria 669
306 Ga0207703_10588205 3300026035 Bacteria 1052
307 Ga0207678_10313459 3300026067 Bacteria 1349
308 Ga0207678_10698285 3300026067 Bacteria 893
309 Ga0207708_10174079 3300026075 Bacteria 1706
310 Ga0207708_10221634 3300026075 Bacteria 1515
311 Ga0207708_10386681 3300026075 Bacteria 1155
312 Ga0207708_10517985 3300026075 Bacteria 1002
313 Ga0207641_11934866 3300026088 Bacteria 591
314 Ga0207648_10008279 3300026089 Bacteria 10098
315 Ga0207648_10047708 3300026089 Bacteria 3753
316 Ga0207648_10810347 3300026089 Unclassified 872
317 Ga0207676_10179515 3300026095 Bacteria 1852
318 Ga0207676_10188508 3300026095 Bacteria 1813
319 Ga0207676_10973951 3300026095 Unclassified 835
320 Ga0207674_10081942 3300026116 Bacteria 3228
321 Ga0207674_10471323 3300026116 Bacteria 1213
322 Ga0207674_10958102 3300026116 Bacteria 824
323 Ga0207675_100188067 3300026118 Bacteria 1980
324 Ga0207675_100476503 3300026118 Bacteria 1240
325 Ga0207698_10685241 3300026142 Bacteria 1018
326 Ga0207428_10198673 3300027907 Bacteria 1509
327 Ga0268266_10000349 3300028379 Bacteria 71878
328 Ga0268266_10234013 3300028379 Bacteria 1693
329 Ga0268265_10061189 3300028380 Bacteria 2889
330 Ga0268265_10424593 3300028380 Unclassified 1235
331 Ga0268265_10639653 3300028380 Bacteria 1021
332 Ga0268265_10743525 3300028380 Bacteria 951
333 Ga0268265_11140175 3300028380 Bacteria 775
334 Ga0268264_10126508 3300028381 Bacteria 2259
335 Ga0268264_10172201 3300028381 Bacteria 1959
336 Ga0268264_10298941 3300028381 Bacteria 1514
337 Ga0268264_10896875 3300028381 Bacteria 890
338 Ga0265770_1002734 3300030878 Bacteria 2396
339 Ga0265316_10416475 3300031344 Unclassified 966
340 Ga0307513_10466849 3300031456 Bacteria 984
341 Ga0307408_101319749 3300031548 Bacteria 677
342 Ga0307408_102381313 3300031548 Bacteria 514
343 Ga0307413_10390795 3300031824 Bacteria 1087
344 Ga0307407_10609708 3300031903 Bacteria 814
345 Ga0307412_10248514 3300031911 Bacteria 1380
346 Ga0307416_100802481 3300032002 Bacteria 1037
347 Ga0373938_0162414 3300034957 Bacteria 601
348 Ga0373929_0091684 3300035085 Bacteria 755
349 Ga0373931_0037101 3300035691 Bacteria 2544
350 Ga0373931_0995914 3300035691 Bacteria 567
351 Ga0395900_0291367 3300037418 Bacteria 1621
352 Ga0395898_0142220 3300037466 Bacteria 2297
353 Ga0395905_0024848 3300037471 Bacteria 5654
354 Ga0395901_0886496 3300038443 Bacteria 875
355 Ga0439445_0103723 3300042004 Bacteria 808
356 Ga0450890_051850 3300042127 Bacteria 627
357 Ga0453683_0319478 3300044673 Bacteria 995
358 Ga0453683_0598765 3300044673 Bacteria 719
359 Ga0451576_0555173 3300045051 Bacteria 1207
360 Ga0451576_1304693 3300045051 Bacteria 757
361 Ga0495592_0489379 3300046454 Bacteria 765
362 Ga0495653_0291718 3300046463 Bacteria 1067
363 Ga0495664_0175486 3300046477 Bacteria 1300
364 Ga0495585_0614120 3300046492 Bacteria 511
365 Ga0495608_0445758 3300046511 Bacteria 788
366 Ga0495628_0074163 3300046516 Bacteria 2651
367 Ga0495632_0510420 3300046519 Bacteria 518
368 Ga0495652_0224175 3300046529 Bacteria 1411
369 Ga0495587_0164695 3300046536 Bacteria 1261
370 Ga0495598_0205983 3300046537 Bacteria 712
371 Ga0495621_0493354 3300046539 Bacteria 528
372 Ga0495656_0104935 3300046615 Unclassified 1313
373 Ga0495668_0454832 3300046616 Bacteria 705
374 Ga0495599_0399093 3300046678 Bacteria 819
375 Ga0495623_0045128 3300046679 Bacteria 2800
376 Ga0495669_0179287 3300046684 Bacteria 1010
377 Ga0495669_0509195 3300046684 Bacteria 585
378 Ga0495600_0769924 3300046809 Bacteria 575
379 Ga0495604_0155462 3300047317 Bacteria 1620
380 Ga0495604_0214927 3300047317 Bacteria 1327
381 Ga0495674_1398297 3300047319 Bacteria 522
382 Ga0495672_0002220 3300047320 Bacteria 18058
383 Ga0495672_0264657 3300047320 Bacteria 828
384 Ga0495675_0019548 3300047444 Bacteria 4303
385 Ga0495602_0237583 3300048088 Bacteria 1365
386 Ga0495602_0335456 3300048088 Unclassified 1095
387 Ga0496100_0145917 3300048903 Bacteria 1683
388 Ga0496100_1591316 3300048903 Bacteria 516
389 Ga0496106_0218393 3300048909 Bacteria 1520
390 Ga0496106_0340776 3300048909 Bacteria 1204
391 Ga0496107_0243942 3300048910 Bacteria 1337
392 Ga0496107_0779481 3300048910 Bacteria 701
393 Ga0496112_1422108 3300048915 Bacteria 608
394 Ga0496113_1488956 3300048916 Bacteria 523
395 Ga0496114_0530589 3300048917 Bacteria 1041
396 Ga0496115_0933249 3300048918 Bacteria 667
397 Ga0501042_0774846 3300049578 Bacteria 698
398 Ga0501067_0098283 3300049583 Bacteria 1626
399 Ga0501074_0217809 3300049590 Bacteria 1360
400 Ga0501081_0231415 3300049743 Bacteria 1346
401 nmdc:mga03n38_297957_c1 3300050490 Bacteria 865
402 nmdc:mga03n38_552060_c1 3300050490 Bacteria 652
403 nmdc:mga00v17_141512_c1 3300050491 Bacteria 1543
404 nmdc:mga0yw44_276989_c1 3300050492 Bacteria 1121
405 nmdc:mga0k408_152499_c1 3300050493 Bacteria 1376
406 nmdc:mga0k408_24542_c2 3300050493 Bacteria 3224
407 nmdc:mga06z11_3392_c1 3300050494 Bacteria 6161
408 nmdc:mga06z11_45024_c1 3300050494 Bacteria 2229
409 nmdc:mga04h51_107784_c1 3300050495 Bacteria 1023
410 nmdc:mga05p37_158810_c1 3300050507 Bacteria 2762
411 nmdc:mga05p37_508910_c1 3300050507 Bacteria 1380
412 nmdc:mga09592_118268_c1 3300050508 Bacteria 2275
413 nmdc:mga09592_1407037_c1 3300050508 Bacteria 570
414 nmdc:mga0qj67_123628_c1 3300050509 Bacteria 2093
415 nmdc:mga0qj67_1294756_c1 3300050509 Bacteria 565
416 nmdc:mga0qj67_352729_c1 3300050509 Bacteria 1189
417 nmdc:mga0qj67_975712_c1 3300050509 Bacteria 665
418 nmdc:mga06r32_33321_c1 3300050510 Bacteria 4852
419 nmdc:mga06r32_37859_c1 3300050510 Bacteria 4564
420 nmdc:mga06r32_413474_c1 3300050510 Bacteria 1330
421 nmdc:mga08y16_190306_c1 3300050511 Bacteria 2128
422 nmdc:mga08y16_411200_c1 3300050511 Bacteria 1384
423 nmdc:mga0n895_135426_c1 3300050512 Bacteria 2490
424 nmdc:mga0n895_2169936_c1 3300050512 Bacteria 511
425 nmdc:mga0n895_54912_c1 3300050512 Bacteria 3919
426 nmdc:mga0rr50_324256_c1 3300050513 Bacteria 1292
427 nmdc:mga08x19_36381_c1 3300050514 Bacteria 2206
428 nmdc:mga0a205_78428_c1 3300050515 Bacteria 3191
429 Ga0495655_0196560 3300053083 Unclassified 657
430 Ga0495619_0025087 3300053085 Bacteria 3826
431 Ga0500568_0001735 3300053139 Bacteria 13517
432 Ga0307414_12161699
433 Ga0065715_10010044
434 Ga0065715_10354639
435 Ga0065707_10009744
436 Ga0070683_100478965
437 Ga0070683_101397961
438 Ga0070690_100360084
439 Ga0070690_101652762
440 Ga0070677_10034085
441 Ga0068869_100177077
442 Ga0068869_100203102
443 Ga0070680_100016281
444 Ga0070680_100613773
445 Ga0070680_101486635
446 Ga0068868_102154038
447 Ga0070660_100744506
448 Ga0070660_100903103
449 Ga0070689_100024526
450 Ga0070689_100053155
451 Ga0070689_100845027
452 Ga0070687_100008757
453 Ga0070661_101172234
454 Ga0070661_101880695
455 Ga0070692_10027118
456 Ga0070692_10726604
457 Ga0070668_100000901
458 Ga0070668_100342438
459 Ga0070669_100001517
460 Ga0070669_100006688
461 Ga0070669_100037069
462 Ga0070675_100019377
463 Ga0070675_100035597
464 Ga0070671_101082274
465 Ga0070674_100141697
466 Ga0070673_100002357
467 Ga0070673_100011640
468 Ga0070673_100136489
469 Ga0070673_100506269
470 Ga0070688_100038148
471 Ga0070659_100253521
472 Ga0070659_101937732
473 Ga0070667_100015933
474 Ga0070667_100017907
475 Ga0070667_100097287
476 Ga0070667_100361231
477 Ga0070667_100813283
478 Ga0070709_10007481
479 Ga0070709_11023382
480 Ga0070713_100902472
481 Ga0070701_10026312
482 Ga0070701_10135132
483 Ga0070700_100260886
484 Ga0070700_100315086
485 Ga0070700_101725241
486 Ga0070694_100109541
487 Ga0070694_100822515
488 Ga0070708_100019039
489 Ga0070708_100020656
490 Ga0070663_100293956
491 Ga0070662_100072126
492 Ga0070662_100089162
493 Ga0070662_100134733
494 Ga0068867_100002077
495 Ga0068867_100068330
496 Ga0070685_10023322
497 Ga0070685_11209084
498 Ga0070706_100076086
499 Ga0070706_102070628
500 Ga0070707_100003322
501 Ga0070707_100394647
502 Ga0070707_101585713
503 Ga0070698_100017740
504 Ga0070698_100051405
505 Ga0070698_100538071
506 Ga0070698_101848906
507 Ga0070699_100344596
508 Ga0070684_100623161
509 Ga0070697_100000970
510 Ga0070697_100436095
511 Ga0070672_100006462
512 Ga0070672_100007061
513 Ga0070672_100027146
514 Ga0070696_100146175
515 Ga0070696_100793113
516 Ga0070665_100000646
517 Ga0070665_100065440
518 Ga0070704_100122084
519 Ga0070704_100142972
520 Ga0070704_100895417
521 Ga0068855_100818103
522 Ga0070664_100105405
523 Ga0070664_100232268
524 Ga0070664_100878183
525 Ga0070664_101597806
526 Ga0068857_100063804
527 Ga0068857_100510396
528 Ga0068857_101037902
529 Ga0068857_101643341
530 Ga0068854_101426231
531 Ga0068852_100310473
532 Ga0068852_101089467
533 Ga0068859_100006963
534 Ga0068859_100172984
535 Ga0068859_100214689
536 Ga0068859_100242360
537 Ga0068859_100393962
538 Ga0068859_100412571
539 Ga0068859_100685572
540 Ga0068864_100121185
541 Ga0068864_100983469
542 Ga0068861_100364628
543 Ga0068861_100512371
544 Ga0068861_101936516
545 Ga0068870_10003108
546 Ga0068870_10006645
547 Ga0068863_101042040
548 Ga0068858_100009514
549 Ga0068858_100127049
550 Ga0068858_100203027
551 Ga0068858_100900183
552 Ga0068860_100080681
553 Ga0068860_100103253
554 Ga0068860_101276136
555 Ga0068860_101867001
556 Ga0068862_100011125
557 Ga0068862_100028997
558 Ga0070717_10654324
559 Ga0070715_10208691
560 Ga0070715_10415062
561 Ga0070716_100186898
562 Ga0097621_102389135
563 Ga0068871_101248947
564 Ga0068871_101999124
565 Ga0075428_100125276
566 Ga0075428_100420100
567 Ga0075428_100678836
568 Ga0075431_100122693
569 Ga0075431_100202446
570 Ga0075431_102012846
571 Ga0075433_11487936
572 Ga0075434_100026948
573 Ga0075434_100135417
574 Ga0075434_101903075
575 Ga0075429_101332836
576 Ga0068865_100023035
577 Ga0068865_100058276
578 Ga0068865_100534963
579 Ga0068865_101096494
580 Ga0075436_100081306
581 Ga0075436_100487354
582 Ga0097620_100006963
583 Ga0097620_100172977
584 Ga0097620_100214694
585 Ga0097620_100242345
586 Ga0097620_100393953
587 Ga0097620_100412572
588 Ga0097620_100685612
589 Ga0097620_100713330
590 Ga0075435_100120870
591 Ga0075435_100526248
592 Ga0075435_101395859
593 Ga0111539_10004336
594 Ga0111539_12038931
595 Ga0105247_10006122
596 Ga0105247_10014304
597 Ga0105247_10018254
598 Ga0105247_11114564
599 Ga0114129_10081540
600 Ga0114129_10467632
601 Ga0114129_10469071
602 Ga0114129_12176557
603 Ga0114129_12459625
604 Ga0105243_10067546
605 Ga0105243_10423552
606 Ga0105243_11834026
607 Ga0105243_11885678
608 Ga0105243_12693691
609 Ga0105241_11321663
610 Ga0105242_10027117
611 Ga0105242_10145124
612 Ga0105242_10986845
613 Ga0105248_10012200
614 Ga0105248_10401427
615 Ga0105248_10470132
616 Ga0105248_10986651
617 Ga0105248_11081583
618 Ga0105237_10416764
619 Ga0105237_10911108
620 Ga0105237_11820714
621 Ga0105249_10002620
622 Ga0105249_10461499
623 Ga0105249_10511859
624 Ga0105246_10145306
625 Ga0105246_10358872
626 Ga0105246_10702542
627 Ga0157314_1059505
628 Ga0157371_10340340
629 Ga0157371_10921473
630 Ga0157378_10067080
631 Ga0157378_10930474
632 Ga0157378_12662213
633 Ga0163162_10053165
634 Ga0163162_10172599
635 Ga0163162_10192218
636 Ga0163162_10883335
637 Ga0163162_12809625
638 Ga0157372_10373640
639 Ga0157372_11662258
640 Ga0157375_10017620
641 Ga0157375_10030935
642 Ga0157375_10077778
643 Ga0157375_10108459
644 Ga0157375_10276443
645 Ga0157375_10392377
646 Ga0157375_10442397
647 Ga0163163_10067080
648 Ga0163163_10238884
649 Ga0157380_10054957
650 Ga0157380_11978964
651 Ga0157379_10436334
652 Ga0157379_10860588
653 Ga0157379_11020937
654 Ga0157376_10314407
655 Ga0163161_10079866
656 Ga0163161_10183527
657 Ga0206354_10844215
658 Ga0228598_1091250
659 Ga0207697_10017836
660 Ga0207697_10109548
661 Ga0207697_10376461
662 Ga0207682_10006591
663 Ga0207642_10397336
664 Ga0207710_10218698
665 Ga0207688_10201343
666 Ga0207685_10154327
667 Ga0207645_10051113
668 Ga0207645_10986479
669 Ga0207645_11048278
670 Ga0207643_10010205
671 Ga0207643_10023577
672 Ga0207684_10107531
673 Ga0207684_10716461
674 Ga0207684_11443800
675 Ga0207671_10962668
676 Ga0207663_10622261
677 Ga0207660_10669856
678 Ga0207662_10004310
679 Ga0207662_10065909
680 Ga0207657_10696409
681 Ga0207649_10273155
682 Ga0207646_10000842
683 Ga0207646_10151015
684 Ga0207646_10651934
685 Ga0207646_11674838
686 Ga0207681_10006946
687 Ga0207681_10506210
688 Ga0207681_10593931
689 Ga0207650_11760282
690 Ga0207659_10035603
691 Ga0207659_10201327
692 Ga0207700_10018760
693 Ga0207644_10237480
694 Ga0207644_11846020
695 Ga0207690_10488221
696 Ga0207690_10585932
697 Ga0207706_10006808
698 Ga0207706_10083589
699 Ga0207686_10077438
700 Ga0207709_10249321
701 Ga0207709_11088331
702 Ga0207670_10273252
703 Ga0207670_10917406
704 Ga0207669_10190667
705 Ga0207704_10085758
706 Ga0207704_10131258
707 Ga0207704_10431076
708 Ga0207704_11392619
709 Ga0207665_10048352
710 Ga0207691_10014340
711 Ga0207691_10040503
712 Ga0207691_10097418
713 Ga0207711_10085716
714 Ga0207711_10666311
715 Ga0207689_10064949
716 Ga0207689_10124449
717 Ga0207661_10054385
718 Ga0207679_10127542
719 Ga0207679_10146422
720 Ga0207679_11205907
721 Ga0207651_10529602
722 Ga0207651_10544038
723 Ga0207651_11034939
724 Ga0207712_10165116
725 Ga0207712_10269113
726 Ga0207712_10507248
727 Ga0207712_11188522
728 Ga0207668_10056228
729 Ga0207668_10347269
730 Ga0207640_12039143
731 Ga0207658_10650264
732 Ga0207658_10700340
733 Ga0207658_10945672
734 Ga0207658_11393928
735 Ga0207677_10897502
736 Ga0207677_11293837
737 Ga0207703_10588205
738 Ga0207678_10313459
739 Ga0207678_10698285
740 Ga0207708_10174079
741 Ga0207708_10221634
742 Ga0207708_10386681
743 Ga0207708_10517985
744 Ga0207641_11934866
745 Ga0207648_10008279
746 Ga0207648_10047708
747 Ga0207648_10810347
748 Ga0207676_10179515
749 Ga0207676_10188508
750 Ga0207676_10973951
751 Ga0207674_10081942
752 Ga0207674_10471323
753 Ga0207674_10958102
754 Ga0207675_100188067
755 Ga0207675_100476503
756 Ga0207698_10685241
757 Ga0207428_10198673
758 Ga0268266_10000349
759 Ga0268266_10234013
760 Ga0268265_10061189
761 Ga0268265_10424593
762 Ga0268265_10639653
763 Ga0268265_10743525
764 Ga0268265_11140175
765 Ga0268264_10126508
766 Ga0268264_10172201
767 Ga0268264_10298941
768 Ga0268264_10896875
769 Ga0265770_1002734
770 Ga0265316_10416475
771 Ga0307513_10466849
772 Ga0307408_101319749
773 Ga0307408_102381313
774 Ga0307413_10390795
775 Ga0307407_10609708
776 Ga0307412_10248514
777 Ga0307416_100802481
778 Ga0373938_0162414
779 Ga0373929_0091684
780 Ga0373931_0037101
781 Ga0373931_0995914
782 Ga0395900_0291367
783 Ga0395898_0142220
784 Ga0395905_0024848
785 Ga0395901_0886496
786 Ga0439445_0103723
787 Ga0450890_051850
788 Ga0453683_0319478
789 Ga0453683_0598765
790 Ga0451576_0555173
791 Ga0451576_1304693
792 Ga0495592_0489379
793 Ga0495653_0291718
794 Ga0495664_0175486
795 Ga0495585_0614120
796 Ga0495608_0445758
797 Ga0495628_0074163
798 Ga0495632_0510420
799 Ga0495652_0224175
800 Ga0495587_0164695
801 Ga0495598_0205983
802 Ga0495621_0493354
803 Ga0495656_0104935
804 Ga0495668_0454832
805 Ga0495599_0399093
806 Ga0495623_0045128
807 Ga0495669_0179287
808 Ga0495669_0509195
809 Ga0495600_0769924
810 Ga0495604_0155462
811 Ga0495604_0214927
812 Ga0495674_1398297
813 Ga0495672_0002220
814 Ga0495672_0264657
815 Ga0495675_0019548
816 Ga0495602_0237583
817 Ga0495602_0335456
818 Ga0496100_0145917
819 Ga0496100_1591316
820 Ga0496106_0218393
821 Ga0496106_0340776
822 Ga0496107_0243942
823 Ga0496107_0779481
824 Ga0496112_1422108
825 Ga0496113_1488956
826 Ga0496114_0530589
827 Ga0496115_0933249
828 Ga0501042_0774846
829 Ga0501067_0098283
830 Ga0501074_0217809
831 Ga0501081_0231415
832 nmdc:mga03n38_297957_c1
833 nmdc:mga03n38_552060_c1
834 nmdc:mga00v17_141512_c1
835 nmdc:mga0yw44_276989_c1
836 nmdc:mga0k408_152499_c1
837 nmdc:mga0k408_24542_c2
838 nmdc:mga06z11_3392_c1
839 nmdc:mga06z11_45024_c1
840 nmdc:mga04h51_107784_c1
841 nmdc:mga05p37_158810_c1
842 nmdc:mga05p37_508910_c1
843 nmdc:mga09592_118268_c1
844 nmdc:mga09592_1407037_c1
845 nmdc:mga0qj67_123628_c1
846 nmdc:mga0qj67_1294756_c1
847 nmdc:mga0qj67_352729_c1
848 nmdc:mga0qj67_975712_c1
849 nmdc:mga06r32_33321_c1
850 nmdc:mga06r32_37859_c1
851 nmdc:mga06r32_413474_c1
852 nmdc:mga08y16_190306_c1
853 nmdc:mga08y16_411200_c1
854 nmdc:mga0n895_135426_c1
855 nmdc:mga0n895_2169936_c1
856 nmdc:mga0n895_54912_c1
857 nmdc:mga0rr50_324256_c1
858 nmdc:mga08x19_36381_c1
859 nmdc:mga0a205_78428_c1
860 Ga0495655_0196560
861 Ga0495619_0025087
862 Ga0500568_0001735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8592 14 78
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.828 6 78
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.801 4 78
2pfx-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution 0.7844 4 81
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.7637 4 78
ID Description Score Start End Superfamily
2prrB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8558 14 80 1.20.1290.10
af_P47148_92_275_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8073 17 75 1.20.1290.10
3c1lB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8065 4 79 1.20.1290.10
3c1lA02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7997 4 79 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7548 4 80 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7Y2JRC2-F1-model_v4 Peroxidase 0.9921 23 81 GO:0004601
AF-A0A317HBX9-F1-model_v4 Peroxidase 0.9886 20 82
AF-A0A3E0NWF6-F1-model_v4 Peroxidase 0.9859 27 82
AF-A0A536PHN8-F1-model_v4 Peroxidase 0.9772 28 80 GO:0004601
AF-A0A524MHH9-F1-model_v4 Peroxidase 0.9678 25 83

Map