F442120

General Info

Members Datasets Scaffolds Average Seq Length
430 266 860 194

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10006227|Ga0105240_1000622712
Length 236
Sequence MMQRNRQAAAVAAPAPGSSFGAATRGLVRPVIASSVLFMLVTGIAYPLLTTGVANALFPAQARGSLVQRDGTTIGSAVIGQNFTRAGYFHSRPSATVGTDPADPSKTVDQPYNAAGSGASNQGATSKKLLADIAQRVRAYRQQNALADGTLVPADAVTASASGLDPEISVANARLQAVRVAHARGIDAAKVTALVDRIAAPRQLGVLGEPRVRVLDLNLALDRAFGHAAGAQKEQE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
240 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
245 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
246 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
247 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
248 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
249 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
250 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
251 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
252 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
253 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
254 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
255 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
256 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
257 2818991452 Burkholderia cepacia 561 Isolate Unclassified
258 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
259 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
260 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
261 2928170801 Burkholderia sp. 572 Isolate Unclassified
262 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
263 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
264 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
265 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
266 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 0.23
Isolates 6.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 0.93
Rhizoplane 3.26
Rhizosphere 82.79
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10006227 3300009093 Bacteria 17549
2 JGI25159J45721_1000099 3300002987 Bacteria 41661
3 JGI25160J50197_1000078 3300003354 Bacteria 102092
4 JGI25161J50226_1000059 3300003374 Bacteria 102092
5 JGI25404J52841_10000231 3300003659 Bacteria 6939
6 Ga0055532_1000458 3300003758 Bacteria 18716
7 Ga0055541_1016830 3300003841 Bacteria 939
8 JGI25405J52794_10055821 3300003911 Bacteria 851
9 Ga0055543_1000058 3300004625 Bacteria 102130
10 Ga0065165_1000400 3300005262 Bacteria 69947
11 Ga0070669_100585449 3300005353 Bacteria 933
12 Ga0070675_100040726 3300005354 Bacteria 3794
13 Ga0070675_100289407 3300005354 Bacteria 1441
14 Ga0070659_100629249 3300005366 Bacteria 924
15 Ga0070667_100144565 3300005367 Bacteria 2085
16 Ga0070713_100736193 3300005436 Bacteria 943
17 Ga0070663_100465155 3300005455 Bacteria 1045
18 Ga0070662_101237278 3300005457 Bacteria 642
19 Ga0070706_100117581 3300005467 Bacteria 2476
20 Ga0068853_100001926 3300005539 Bacteria 15306
21 Ga0068853_100228723 3300005539 Bacteria 1700
22 Ga0068853_100325748 3300005539 Bacteria 1425
23 Ga0070693_100046653 3300005547 Bacteria 2461
24 Ga0070665_100000807 3300005548 Bacteria 40948
25 Ga0070665_100613668 3300005548 Bacteria 1101
26 Ga0068855_100038537 3300005563 Bacteria 5679
27 Ga0068855_100561500 3300005563 Bacteria 1235
28 Ga0068855_100793398 3300005563 Bacteria 1007
29 Ga0068852_100586047 3300005616 Bacteria 1118
30 Ga0068859_100584767 3300005617 Bacteria 1210
31 Ga0068864_100218712 3300005618 Bacteria 1757
32 Ga0068864_101382565 3300005618 Bacteria 705
33 Ga0068863_100072172 3300005841 Bacteria 3266
34 Ga0081455_10009294 3300005937 Bacteria 10123
35 Ga0081455_10011433 3300005937 Bacteria 8919
36 Ga0081455_10165135 3300005937 Bacteria 1692
37 Ga0081538_10003269 3300005981 Bacteria 15388
38 Ga0081540_1000001 3300005983 Bacteria 293507
39 Ga0081540_1000376 3300005983 Bacteria 44722
40 Ga0081540_1083184 3300005983 Bacteria 1433
41 Ga0075365_10030698 3300006038 Bacteria 3444
42 Ga0075363_100365185 3300006048 Bacteria 845
43 Ga0075364_10086217 3300006051 Bacteria 2080
44 Ga0075364_10219733 3300006051 Bacteria 1289
45 Ga0075362_10091934 3300006177 Bacteria 1409
46 Ga0075362_10310862 3300006177 Bacteria 783
47 Ga0075367_10089639 3300006178 Bacteria 1870
48 Ga0075367_10139748 3300006178 Bacteria 1500
49 Ga0075367_10258126 3300006178 Bacteria 1094
50 Ga0075366_10135459 3300006195 Bacteria 1487
51 Ga0097621_100038644 3300006237 Bacteria 3830
52 Ga0075370_10257589 3300006353 Bacteria 1034
53 Ga0068871_100071740 3300006358 Bacteria 2849
54 Ga0075430_100837102 3300006846 Bacteria 758
55 Ga0075431_100023431 3300006847 Bacteria 6316
56 Ga0075431_100298451 3300006847 Bacteria 1628
57 Ga0075433_10003857 3300006852 Bacteria 11607
58 Ga0075434_100008985 3300006871 Bacteria 9307
59 Ga0075434_100191840 3300006871 Bacteria 2064
60 Ga0075434_100582776 3300006871 Bacteria 1138
61 Ga0068865_100420559 3300006881 Bacteria 1099
62 Ga0097620_100584693 3300006931 Bacteria 1210
63 Ga0075435_100015274 3300007076 Bacteria 5769
64 Ga0075435_100080053 3300007076 Bacteria 2682
65 Ga0099795_10003287 3300007788 Bacteria 3978
66 Ga0105240_10000613 3300009093 Bacteria 66188
67 Ga0114129_10496725 3300009147 Bacteria 1594
68 Ga0114129_10615112 3300009147 Bacteria 1406
69 Ga0105248_10044400 3300009177 Bacteria 4984
70 Ga0105237_10194064 3300009545 Bacteria 2030
71 Ga0105238_10474019 3300009551 Bacteria 1250
72 Ga0105249_10013032 3300009553 Bacteria 7337
73 Ga0105249_10625381 3300009553 Bacteria 1133
74 Ga0105239_10000304 3300010375 Bacteria 72715
75 Ga0105239_10422379 3300010375 Bacteria 1510
76 Ga0105239_10724490 3300010375 Bacteria 1138
77 Ga0157369_10000067 3300013105 Bacteria 144506
78 Ga0157369_10000622 3300013105 Bacteria 46108
79 Ga0157374_10076557 3300013296 Bacteria 3164
80 Ga0157378_10203972 3300013297 Bacteria 1871
81 Ga0157378_11059997 3300013297 Bacteria 847
82 Ga0163162_10000007 3300013306 Bacteria 368084
83 Ga0163162_10365592 3300013306 Bacteria 1576
84 Ga0157375_10951442 3300013308 Bacteria 1001
85 Ga0157375_10988968 3300013308 Bacteria 981
86 Ga0163163_10645307 3300014325 Bacteria 1122
87 Ga0157380_10275485 3300014326 Bacteria 1536
88 Ga0157379_10443455 3300014968 Bacteria 1197
89 Ga0157376_10038657 3300014969 Bacteria 3884
90 Ga0182006_1048042 3300015261 Bacteria 1652
91 Ga0163161_10340796 3300017792 Bacteria 1189
92 Ga0197907_10105519 3300020069 Bacteria 793
93 Ga0213874_10070768 3300021377 Bacteria 1112
94 Ga0228598_1003426 3300024227 Bacteria 3410
95 Ga0209566_100541 3300025225 Bacteria 25574
96 Ga0209674_101088 3300025226 Bacteria 8063
97 Ga0209147_100153 3300025229 Bacteria 97432
98 Ga0209130_1000221 3300025284 Bacteria 74712
99 Ga0207426_1000083 3300025302 Bacteria 298770
100 Ga0207680_10290288 3300025903 Bacteria 1138
101 Ga0207695_10000691 3300025913 Bacteria 66171
102 Ga0207695_10005138 3300025913 Bacteria 17528
103 Ga0207695_10435591 3300025913 Bacteria 1195
104 Ga0207671_10031059 3300025914 Bacteria 3982
105 Ga0207681_10223524 3300025923 Bacteria 1458
106 Ga0207681_10461010 3300025923 Bacteria 1035
107 Ga0207659_10075541 3300025926 Bacteria 2473
108 Ga0207659_10111651 3300025926 Bacteria 2079
109 Ga0207687_10084722 3300025927 Bacteria 2298
110 Ga0207690_10335130 3300025932 Bacteria 1192
111 Ga0207706_11049256 3300025933 Bacteria 683
112 Ga0207691_10409932 3300025940 Bacteria 1155
113 Ga0207711_10049314 3300025941 Bacteria 3605
114 Ga0207667_10003299 3300025949 Bacteria 19911
115 Ga0207667_10591396 3300025949 Bacteria 1120
116 Ga0207667_10946981 3300025949 Bacteria 851
117 Ga0207712_10119555 3300025961 Bacteria 1991
118 Ga0207658_10044684 3300025986 Bacteria 3226
119 Ga0207658_10128490 3300025986 Bacteria 2032
120 Ga0207677_10175952 3300026023 Bacteria 1678
121 Ga0207639_10002603 3300026041 Bacteria 12105
122 Ga0207639_10222323 3300026041 Bacteria 1632
123 Ga0207639_10519239 3300026041 Bacteria 1090
124 Ga0207678_10367412 3300026067 Bacteria 1242
125 Ga0207702_10942573 3300026078 Bacteria 856
126 Ga0207641_10073543 3300026088 Bacteria 2946
127 Ga0207648_10234910 3300026089 Bacteria 1631
128 Ga0207674_10320541 3300026116 Bacteria 1499
129 Ga0207683_10019614 3300026121 Bacteria 5777
130 Ga0207683_10499194 3300026121 Bacteria 1124
131 Ga0209179_1005143 3300027512 Unclassified 2025
132 Ga0268266_10000013 3300028379 Bacteria 649715
133 Ga0268265_10283036 3300028380 Bacteria 1485
134 Ga0265330_10010598 3300031235 Bacteria 4340
135 Ga0265328_10075363 3300031239 Bacteria 1241
136 Ga0265327_10045647 3300031251 Bacteria 2327
137 Ga0265316_10031064 3300031344 Bacteria 4371
138 Ga0265316_10126725 3300031344 Bacteria 1924
139 Ga0265316_10380304 3300031344 Bacteria 1019
140 Ga0307509_10245871 3300031507 Bacteria 1577
141 Ga0265314_10036124 3300031711 Bacteria 3594
142 Ga0265342_10194867 3300031712 Bacteria 1104
143 Ga0373960_0010757 3300035121 Bacteria 2241
144 Ga0373943_0495056 3300035170 Bacteria 714
145 Ga0373927_0072209 3300035695 Bacteria 2233
146 Ga0373933_0130113 3300035724 Bacteria 1582
147 Ga0373947_0123908 3300035725 Bacteria 1644
148 Ga0373947_0539223 3300035725 Bacteria 794
149 Ga0373925_0202155 3300037068 Bacteria 1580
150 Ga0395899_0000036 3300037312 Bacteria 289502
151 Ga0395899_0008226 3300037312 Bacteria 8034
152 Ga0395899_0251626 3300037312 Bacteria 1212
153 Ga0395900_0015609 3300037418 Bacteria 7741
154 Ga0395898_0000577 3300037466 Bacteria 67972
155 Ga0395898_0000626 3300037466 Bacteria 64794
156 Ga0395898_0029231 3300037466 Bacteria 5522
157 Ga0395901_0000104 3300038443 Bacteria 114939
158 Ga0395901_0000231 3300038443 Bacteria 70033
159 Ga0395901_0052198 3300038443 Bacteria 4249
160 Ga0436365_1494369 3300039437 Bacteria 1747
161 Ga0436363_1549162 3300039450 Bacteria 1988
162 Ga0466969_0103195 3300044656 Bacteria 1340
163 Ga0466980_0295861 3300044668 Bacteria 977
164 Ga0466965_0019096 3300044683 Bacteria 3290
165 Ga0466966_0110625 3300044684 Bacteria 1693
166 Ga0466966_0317359 3300044684 Bacteria 936
167 Ga0466961_0006007 3300044693 Bacteria 7698
168 Ga0466961_0020275 3300044693 Bacteria 4277
169 Ga0466964_0016241 3300044706 Bacteria 2839
170 Ga0466970_0008573 3300044765 Bacteria 5148
171 Ga0466970_0042458 3300044765 Bacteria 2418
172 Ga0466957_0027073 3300044842 Bacteria 3405
173 Ga0466959_0117661 3300045049 Bacteria 1891
174 Ga0466959_0215404 3300045049 Bacteria 1333
175 Ga0451576_0010514 3300045051 Bacteria 10608
176 Ga0466958_0002037 3300045836 Bacteria 9979
177 Ga0466958_0003808 3300045836 Bacteria 7878
178 Ga0495592_0337374 3300046454 Bacteria 970
179 Ga0495603_0014964 3300046455 Bacteria 4690
180 Ga0495590_0017653 3300046457 Bacteria 2565
181 Ga0495591_018223 3300046458 Bacteria 2385
182 Ga0495629_0000138 3300046459 Bacteria 63867
183 Ga0495629_0001915 3300046459 Bacteria 16215
184 Ga0495629_0320437 3300046459 Bacteria 1060
185 Ga0495638_0004088 3300046460 Bacteria 11175
186 Ga0495651_0306712 3300046462 Bacteria 1063
187 Ga0495653_0000446 3300046463 Bacteria 32368
188 Ga0495653_0017169 3300046463 Bacteria 5886
189 Ga0495650_0008576 3300046471 Bacteria 5938
190 Ga0495580_0000715 3300046472 Bacteria 28331
191 Ga0495580_0004415 3300046472 Bacteria 11814
192 Ga0495582_0009257 3300046473 Bacteria 5433
193 Ga0495605_0052459 3300046474 Bacteria 1981
194 Ga0495605_0095186 3300046474 Bacteria 1375
195 Ga0495664_0028676 3300046477 Bacteria 3251
196 Ga0495664_0065324 3300046477 Bacteria 2169
197 Ga0495664_0137897 3300046477 Bacteria 1478
198 Ga0495664_0232578 3300046477 Bacteria 1115
199 Ga0495596_0046953 3300046500 Bacteria 1695
200 Ga0495606_0010690 3300046507 Bacteria 7580
201 Ga0495618_0043510 3300046514 Bacteria 2833
202 Ga0495618_0255069 3300046514 Bacteria 1099
203 Ga0495618_0296001 3300046514 Bacteria 1006
204 Ga0495618_0491698 3300046514 Bacteria 741
205 Ga0495620_0009360 3300046515 Bacteria 5214
206 Ga0495628_0004238 3300046516 Bacteria 12750
207 Ga0495628_0040017 3300046516 Bacteria 3747
208 Ga0495630_0003840 3300046517 Bacteria 10483
209 Ga0495630_0246948 3300046517 Bacteria 1363
210 Ga0495632_0102003 3300046519 Bacteria 1352
211 Ga0495632_0106035 3300046519 Bacteria 1322
212 Ga0495637_0076908 3300046520 Bacteria 1337
213 Ga0495648_0003904 3300046524 Bacteria 12922
214 Ga0495666_0023332 3300046526 Bacteria 3059
215 Ga0495666_0068853 3300046526 Bacteria 1684
216 Ga0495666_0155352 3300046526 Bacteria 1063
217 Ga0495652_0288033 3300046529 Bacteria 1199
218 Ga0495665_0027502 3300046531 Bacteria 3052
219 Ga0495665_0036692 3300046531 Bacteria 2616
220 Ga0495665_0126424 3300046531 Bacteria 1339
221 Ga0495586_0120668 3300046535 Bacteria 1464
222 Ga0495587_0162943 3300046536 Bacteria 1268
223 Ga0495597_0072253 3300046542 Bacteria 1484
224 Ga0495645_0041781 3300046543 Bacteria 3343
225 Ga0495645_0057981 3300046543 Bacteria 2809
226 Ga0495656_0118447 3300046615 Bacteria 1247
227 Ga0495668_0276013 3300046616 Bacteria 921
228 Ga0495634_0001741 3300046642 Bacteria 18849
229 Ga0495634_0265876 3300046642 Bacteria 1045
230 Ga0495634_0347371 3300046642 Bacteria 889
231 Ga0495634_0449379 3300046642 Bacteria 760
232 Ga0495611_0020241 3300046648 Bacteria 2863
233 Ga0495625_0033576 3300046660 Bacteria 3793
234 Ga0495635_0015227 3300046663 Bacteria 5382
235 Ga0495635_0052131 3300046663 Bacteria 2818
236 Ga0495661_0008572 3300046665 Bacteria 7067
237 Ga0495588_0281688 3300046674 Bacteria 876
238 Ga0495599_0053991 3300046678 Bacteria 2517
239 Ga0495599_0163915 3300046678 Bacteria 1373
240 Ga0495623_0115657 3300046679 Bacteria 1621
241 Ga0495646_0006019 3300046680 Bacteria 7689
242 Ga0495646_0050792 3300046680 Bacteria 2512
243 Ga0495646_0152265 3300046680 Bacteria 1285
244 Ga0495646_0309021 3300046680 Bacteria 835
245 Ga0495669_0165325 3300046684 Bacteria 1051
246 Ga0495613_0011281 3300046689 Bacteria 6637
247 Ga0495613_0059416 3300046689 Bacteria 2803
248 Ga0495624_0009382 3300046690 Bacteria 6778
249 Ga0495624_0113516 3300046690 Bacteria 1665
250 Ga0495624_0119944 3300046690 Bacteria 1615
251 Ga0495671_0029078 3300046692 Bacteria 2841
252 Ga0495589_0106374 3300046794 Bacteria 1355
253 Ga0495589_0154753 3300046794 Bacteria 1094
254 Ga0495600_0070796 3300046809 Bacteria 2279
255 Ga0495600_0276077 3300046809 Bacteria 1065
256 Ga0495581_0072284 3300047315 Bacteria 1995
257 Ga0495604_0060255 3300047317 Bacteria 2907
258 Ga0495604_0387845 3300047317 Bacteria 922
259 Ga0495674_0032145 3300047319 Bacteria 4762
260 Ga0495674_0294527 3300047319 Bacteria 1326
261 Ga0495674_0396947 3300047319 Bacteria 1114
262 Ga0495672_0289396 3300047320 Bacteria 780
263 Ga0495676_0056109 3300047321 Bacteria 3117
264 Ga0495676_0089166 3300047321 Bacteria 2311
265 Ga0495680_0013894 3300047322 Bacteria 7005
266 Ga0495680_0059496 3300047322 Bacteria 2949
267 Ga0495675_0017821 3300047444 Bacteria 4503
268 Ga0495675_0315093 3300047444 Bacteria 926
269 Ga0495679_000036 3300047446 Bacteria 161473
270 Ga0495679_004902 3300047446 Bacteria 6040
271 Ga0495684_0160917 3300047471 Bacteria 1674
272 Ga0495686_0009753 3300047472 Bacteria 6891
273 Ga0495686_0147851 3300047472 Bacteria 1381
274 Ga0495593_0060022 3300047673 Bacteria 1991
275 Ga0495593_0106327 3300047673 Bacteria 1435
276 Ga0495602_0050024 3300048088 Bacteria 3738
277 Ga0495602_0266382 3300048088 Bacteria 1268
278 Ga0495614_0007447 3300048089 Bacteria 4873
279 Ga0496103_0263311 3300048906 Bacteria 1109
280 Ga0496104_0022607 3300048907 Bacteria 5775
281 Ga0496104_0221679 3300048907 Bacteria 1803
282 Ga0496104_0397877 3300048907 Bacteria 1290
283 Ga0496105_0004791 3300048908 Bacteria 10216
284 Ga0496105_0135543 3300048908 Bacteria 2028
285 Ga0496107_0439875 3300048910 Bacteria 969
286 Ga0496108_0592482 3300048911 Bacteria 966
287 Ga0496111_0061212 3300048914 Bacteria 2729
288 Ga0496112_0366152 3300048915 Bacteria 1383
289 Ga0496117_0010841 3300048920 Bacteria 8224
290 Ga0496117_0031375 3300048920 Bacteria 4058
291 Ga0496118_0005901 3300048921 Bacteria 13706
292 Ga0496118_0111021 3300048921 Bacteria 1819
293 Ga0496119_0000248 3300048922 Bacteria 76311
294 Ga0496120_0000143 3300048923 Bacteria 120051
295 Ga0496121_0011954 3300048924 Bacteria 9551
296 Ga0501031_0000895 3300049568 Bacteria 17981
297 Ga0501033_0058967 3300049570 Bacteria 2835
298 Ga0501033_0198315 3300049570 Bacteria 1434
299 Ga0501033_0233173 3300049570 Bacteria 1307
300 Ga0501036_0000333 3300049572 Bacteria 33028
301 Ga0501036_0627365 3300049572 Bacteria 891
302 Ga0501038_0001821 3300049574 Bacteria 19748
303 Ga0501038_0097897 3300049574 Bacteria 2447
304 Ga0501038_0391856 3300049574 Bacteria 1076
305 Ga0501038_0690793 3300049574 Bacteria 765
306 Ga0501039_0000617 3300049575 Bacteria 25724
307 Ga0501039_0806634 3300049575 Bacteria 732
308 Ga0501040_0000098 3300049576 Bacteria 43927
309 Ga0501040_0169297 3300049576 Bacteria 1546
310 Ga0501041_0000145 3300049577 Bacteria 31208
311 Ga0501041_0234064 3300049577 Bacteria 1154
312 Ga0501041_0277214 3300049577 Bacteria 1055
313 Ga0501042_0000144 3300049578 Bacteria 31606
314 Ga0501042_0247277 3300049578 Bacteria 1287
315 Ga0501043_0003867 3300049579 Bacteria 12304
316 Ga0501043_0013637 3300049579 Bacteria 6359
317 Ga0501043_0132165 3300049579 Bacteria 1956
318 Ga0501043_0562425 3300049579 Bacteria 846
319 Ga0501046_0000886 3300049580 Bacteria 29142
320 Ga0501046_0090846 3300049580 Bacteria 2349
321 Ga0501046_0156481 3300049580 Bacteria 1716
322 Ga0501047_0367431 3300049581 Bacteria 1274
323 Ga0501047_0449538 3300049581 Bacteria 1118
324 Ga0501048_0001053 3300049582 Bacteria 20668
325 Ga0501048_0224740 3300049582 Bacteria 1332
326 Ga0501069_0100718 3300049585 Bacteria 1640
327 Ga0501070_0053722 3300049586 Bacteria 3341
328 Ga0501070_0068978 3300049586 Bacteria 2927
329 Ga0501071_0000340 3300049587 Bacteria 22663
330 Ga0501071_0096037 3300049587 Bacteria 2181
331 Ga0501071_0523110 3300049587 Bacteria 910
332 Ga0501072_0000179 3300049588 Bacteria 45653
333 Ga0501072_0014909 3300049588 Bacteria 5958
334 Ga0501073_0410054 3300049589 Bacteria 936
335 Ga0501073_0439744 3300049589 Bacteria 901
336 Ga0501074_0013824 3300049590 Bacteria 5870
337 Ga0501074_0144029 3300049590 Bacteria 1704
338 Ga0501074_0477898 3300049590 Bacteria 883
339 Ga0501075_0000243 3300049591 Bacteria 29207
340 Ga0501076_0000238 3300049592 Bacteria 33689
341 Ga0501076_0112279 3300049592 Bacteria 2204
342 Ga0501077_0000460 3300049593 Bacteria 24731
343 Ga0501077_0247238 3300049593 Bacteria 1134
344 Ga0501077_0484461 3300049593 Bacteria 793
345 Ga0501079_0000103 3300049741 Bacteria 43079
346 Ga0501079_0105832 3300049741 Bacteria 2183
347 Ga0501079_0114815 3300049741 Bacteria 2093
348 Ga0501079_0161032 3300049741 Bacteria 1750
349 Ga0501079_0278522 3300049741 Bacteria 1308
350 Ga0501079_0481012 3300049741 Bacteria 976
351 Ga0501080_0013692 3300049742 Bacteria 7469
352 Ga0501081_0000438 3300049743 Bacteria 23048
353 Ga0501081_0085185 3300049743 Bacteria 2217
354 Ga0501081_0101048 3300049743 Bacteria 2039
355 Ga0501081_0408983 3300049743 Bacteria 1005
356 Ga0501081_0541034 3300049743 Bacteria 870
357 Ga0501083_0014641 3300049744 Bacteria 5483
358 Ga0501083_0340224 3300049744 Bacteria 976
359 Ga0501044_0026395 3300049823 Bacteria 6147
360 Ga0501044_0184498 3300049823 Bacteria 2052
361 Ga0501044_0769059 3300049823 Bacteria 844
362 Ga0501045_0000109 3300049824 Bacteria 41385
363 Ga0501045_0071060 3300049824 Bacteria 2561
364 Ga0501045_0428937 3300049824 Bacteria 983
365 nmdc:mga03n38_221302_c1 3300050490 Bacteria 988
366 nmdc:mga00v17_104384_c1 3300050491 Bacteria 1792
367 nmdc:mga0yw44_21615_c1 3300050492 Bacteria 3593
368 nmdc:mga0k408_383169_c1 3300050493 Bacteria 837
369 nmdc:mga06z11_109532_c1 3300050494 Bacteria 1528
370 nmdc:mga06z11_119988_c1 3300050494 Bacteria 1466
371 nmdc:mga07m45_91726_c1 3300050496 Bacteria 1741
372 nmdc:mga09592_212204_c1 3300050508 Bacteria 1677
373 nmdc:mga0qj67_43128_c1 3300050509 Bacteria 3552
374 nmdc:mga06r32_350719_c1 3300050510 Bacteria 1460
375 nmdc:mga06r32_404670_c1 3300050510 Bacteria 1347
376 nmdc:mga08y16_116573_c1 3300050511 Bacteria 2780
377 nmdc:mga0n895_50897_c1 3300050512 Bacteria 4063
378 nmdc:mga0n895_599563_c1 3300050512 Bacteria 1104
379 nmdc:mga0n895_60111_c1 3300050512 Bacteria 3749
380 nmdc:mga0n895_617726_c1 3300050512 Bacteria 1085
381 nmdc:mga0rr50_85279_c1 3300050513 Bacteria 2447
382 Ga0495601_0006270 3300053077 Bacteria 6946
383 Ga0495601_0047751 3300053077 Bacteria 2696
384 Ga0495612_0397006 3300053078 Bacteria 626
385 Ga0495619_0132116 3300053085 Bacteria 1716
386 Ga0495619_0165179 3300053085 Bacteria 1530
387 Ga0495619_0251233 3300053085 Bacteria 1225
388 Ga0500620_007567 3300053155 Bacteria 2693
389 Ga0500637_0081440 3300053178 Bacteria 1870
390 Ga0501084_0000383 3300054114 Bacteria 33962
391 Ga0501084_0018139 3300054114 Bacteria 5862
392 Ga0501084_0069824 3300054114 Bacteria 2942
393 Ga0501084_0119716 3300054114 Bacteria 2213
394 Ga0501084_0828243 3300054114 Bacteria 779
395 Ga0501082_0000047 3300060353 Bacteria 86072
396 Ga0501082_0129698 3300060353 Bacteria 2187
397 Ga0501082_0166331 3300060353 Bacteria 1916
398 Ga0501082_0414208 3300060353 Bacteria 1176
399 Ga0501082_0432033 3300060353 Bacteria 1150
400 Ga0501082_0940056 3300060353 Bacteria 756
401 Ga0530510_0000144 3300061734 Bacteria 41986
402 Ga0530510_0001500 3300061734 Bacteria 15682
403 Ga0530510_0021316 3300061734 Bacteria 4610
404 Ga0530510_0380999 3300061734 Bacteria 1062
405 2514053618 2513237166 Bacteria 10373764
406 2515691533 2515154123 Bacteria 6387382
407 2563064178 2562617112 Bacteria 10918404
408 2599735619 2599185239 Bacteria 8686614
409 2599745610 2599185240 Bacteria 7968121
410 2600207518 2599185355 Bacteria 7968906
411 2676746577 2675903129 Bacteria 7964495
412 2713472452 2711768613 Bacteria 11048459
413 2746091412 2744054900 Bacteria 8399525
414 2746097306 2744054901 Bacteria 8397047
415 2753035270 2751185725 Bacteria 5740550
416 2753323787 2751185792 Bacteria 5739090
417 2792834197 2791355137 Bacteria 9654227
418 2819630352 2818991452 Bacteria 8442785
419 2870074764 2870068957 Bacteria 8925310
420 2870076017 2870068957 Bacteria 8925310
421 2870076878 2870068957 Bacteria 8925310
422 2870077075 2870068957 Bacteria 8925310
423 2885278887 2885270888 Bacteria 9831543
424 2921649278 2921643360 Bacteria 11448031
425 2928177800 2928170801 Bacteria 8785406
426 3005416317 3005409236 Bacteria 7188837
427 8018853187 8018845410 Bacteria 8933938
428 8020949806 8020945358 Bacteria 8467355
429 8021121110 8021120328 Bacteria 8782274
430 8057577240 8057575449 Bacteria 7367519
431 Ga0105240_10006227
432 JGI25159J45721_1000099
433 JGI25160J50197_1000078
434 JGI25161J50226_1000059
435 JGI25404J52841_10000231
436 Ga0055532_1000458
437 Ga0055541_1016830
438 JGI25405J52794_10055821
439 Ga0055543_1000058
440 Ga0065165_1000400
441 Ga0070669_100585449
442 Ga0070675_100040726
443 Ga0070675_100289407
444 Ga0070659_100629249
445 Ga0070667_100144565
446 Ga0070713_100736193
447 Ga0070663_100465155
448 Ga0070662_101237278
449 Ga0070706_100117581
450 Ga0068853_100001926
451 Ga0068853_100228723
452 Ga0068853_100325748
453 Ga0070693_100046653
454 Ga0070665_100000807
455 Ga0070665_100613668
456 Ga0068855_100038537
457 Ga0068855_100561500
458 Ga0068855_100793398
459 Ga0068852_100586047
460 Ga0068859_100584767
461 Ga0068864_100218712
462 Ga0068864_101382565
463 Ga0068863_100072172
464 Ga0081455_10009294
465 Ga0081455_10011433
466 Ga0081455_10165135
467 Ga0081538_10003269
468 Ga0081540_1000001
469 Ga0081540_1000376
470 Ga0081540_1083184
471 Ga0075365_10030698
472 Ga0075363_100365185
473 Ga0075364_10086217
474 Ga0075364_10219733
475 Ga0075362_10091934
476 Ga0075362_10310862
477 Ga0075367_10089639
478 Ga0075367_10139748
479 Ga0075367_10258126
480 Ga0075366_10135459
481 Ga0097621_100038644
482 Ga0075370_10257589
483 Ga0068871_100071740
484 Ga0075430_100837102
485 Ga0075431_100023431
486 Ga0075431_100298451
487 Ga0075433_10003857
488 Ga0075434_100008985
489 Ga0075434_100191840
490 Ga0075434_100582776
491 Ga0068865_100420559
492 Ga0097620_100584693
493 Ga0075435_100015274
494 Ga0075435_100080053
495 Ga0099795_10003287
496 Ga0105240_10000613
497 Ga0114129_10496725
498 Ga0114129_10615112
499 Ga0105248_10044400
500 Ga0105237_10194064
501 Ga0105238_10474019
502 Ga0105249_10013032
503 Ga0105249_10625381
504 Ga0105239_10000304
505 Ga0105239_10422379
506 Ga0105239_10724490
507 Ga0157369_10000067
508 Ga0157369_10000622
509 Ga0157374_10076557
510 Ga0157378_10203972
511 Ga0157378_11059997
512 Ga0163162_10000007
513 Ga0163162_10365592
514 Ga0157375_10951442
515 Ga0157375_10988968
516 Ga0163163_10645307
517 Ga0157380_10275485
518 Ga0157379_10443455
519 Ga0157376_10038657
520 Ga0182006_1048042
521 Ga0163161_10340796
522 Ga0197907_10105519
523 Ga0213874_10070768
524 Ga0228598_1003426
525 Ga0209566_100541
526 Ga0209674_101088
527 Ga0209147_100153
528 Ga0209130_1000221
529 Ga0207426_1000083
530 Ga0207680_10290288
531 Ga0207695_10000691
532 Ga0207695_10005138
533 Ga0207695_10435591
534 Ga0207671_10031059
535 Ga0207681_10223524
536 Ga0207681_10461010
537 Ga0207659_10075541
538 Ga0207659_10111651
539 Ga0207687_10084722
540 Ga0207690_10335130
541 Ga0207706_11049256
542 Ga0207691_10409932
543 Ga0207711_10049314
544 Ga0207667_10003299
545 Ga0207667_10591396
546 Ga0207667_10946981
547 Ga0207712_10119555
548 Ga0207658_10044684
549 Ga0207658_10128490
550 Ga0207677_10175952
551 Ga0207639_10002603
552 Ga0207639_10222323
553 Ga0207639_10519239
554 Ga0207678_10367412
555 Ga0207702_10942573
556 Ga0207641_10073543
557 Ga0207648_10234910
558 Ga0207674_10320541
559 Ga0207683_10019614
560 Ga0207683_10499194
561 Ga0209179_1005143
562 Ga0268266_10000013
563 Ga0268265_10283036
564 Ga0265330_10010598
565 Ga0265328_10075363
566 Ga0265327_10045647
567 Ga0265316_10031064
568 Ga0265316_10126725
569 Ga0265316_10380304
570 Ga0307509_10245871
571 Ga0265314_10036124
572 Ga0265342_10194867
573 Ga0373960_0010757
574 Ga0373943_0495056
575 Ga0373927_0072209
576 Ga0373933_0130113
577 Ga0373947_0123908
578 Ga0373947_0539223
579 Ga0373925_0202155
580 Ga0395899_0000036
581 Ga0395899_0008226
582 Ga0395899_0251626
583 Ga0395900_0015609
584 Ga0395898_0000577
585 Ga0395898_0000626
586 Ga0395898_0029231
587 Ga0395901_0000104
588 Ga0395901_0000231
589 Ga0395901_0052198
590 Ga0436365_1494369
591 Ga0436363_1549162
592 Ga0466969_0103195
593 Ga0466980_0295861
594 Ga0466965_0019096
595 Ga0466966_0110625
596 Ga0466966_0317359
597 Ga0466961_0006007
598 Ga0466961_0020275
599 Ga0466964_0016241
600 Ga0466970_0008573
601 Ga0466970_0042458
602 Ga0466957_0027073
603 Ga0466959_0117661
604 Ga0466959_0215404
605 Ga0451576_0010514
606 Ga0466958_0002037
607 Ga0466958_0003808
608 Ga0495592_0337374
609 Ga0495603_0014964
610 Ga0495590_0017653
611 Ga0495591_018223
612 Ga0495629_0000138
613 Ga0495629_0001915
614 Ga0495629_0320437
615 Ga0495638_0004088
616 Ga0495651_0306712
617 Ga0495653_0000446
618 Ga0495653_0017169
619 Ga0495650_0008576
620 Ga0495580_0000715
621 Ga0495580_0004415
622 Ga0495582_0009257
623 Ga0495605_0052459
624 Ga0495605_0095186
625 Ga0495664_0028676
626 Ga0495664_0065324
627 Ga0495664_0137897
628 Ga0495664_0232578
629 Ga0495596_0046953
630 Ga0495606_0010690
631 Ga0495618_0043510
632 Ga0495618_0255069
633 Ga0495618_0296001
634 Ga0495618_0491698
635 Ga0495620_0009360
636 Ga0495628_0004238
637 Ga0495628_0040017
638 Ga0495630_0003840
639 Ga0495630_0246948
640 Ga0495632_0102003
641 Ga0495632_0106035
642 Ga0495637_0076908
643 Ga0495648_0003904
644 Ga0495666_0023332
645 Ga0495666_0068853
646 Ga0495666_0155352
647 Ga0495652_0288033
648 Ga0495665_0027502
649 Ga0495665_0036692
650 Ga0495665_0126424
651 Ga0495586_0120668
652 Ga0495587_0162943
653 Ga0495597_0072253
654 Ga0495645_0041781
655 Ga0495645_0057981
656 Ga0495656_0118447
657 Ga0495668_0276013
658 Ga0495634_0001741
659 Ga0495634_0265876
660 Ga0495634_0347371
661 Ga0495634_0449379
662 Ga0495611_0020241
663 Ga0495625_0033576
664 Ga0495635_0015227
665 Ga0495635_0052131
666 Ga0495661_0008572
667 Ga0495588_0281688
668 Ga0495599_0053991
669 Ga0495599_0163915
670 Ga0495623_0115657
671 Ga0495646_0006019
672 Ga0495646_0050792
673 Ga0495646_0152265
674 Ga0495646_0309021
675 Ga0495669_0165325
676 Ga0495613_0011281
677 Ga0495613_0059416
678 Ga0495624_0009382
679 Ga0495624_0113516
680 Ga0495624_0119944
681 Ga0495671_0029078
682 Ga0495589_0106374
683 Ga0495589_0154753
684 Ga0495600_0070796
685 Ga0495600_0276077
686 Ga0495581_0072284
687 Ga0495604_0060255
688 Ga0495604_0387845
689 Ga0495674_0032145
690 Ga0495674_0294527
691 Ga0495674_0396947
692 Ga0495672_0289396
693 Ga0495676_0056109
694 Ga0495676_0089166
695 Ga0495680_0013894
696 Ga0495680_0059496
697 Ga0495675_0017821
698 Ga0495675_0315093
699 Ga0495679_000036
700 Ga0495679_004902
701 Ga0495684_0160917
702 Ga0495686_0009753
703 Ga0495686_0147851
704 Ga0495593_0060022
705 Ga0495593_0106327
706 Ga0495602_0050024
707 Ga0495602_0266382
708 Ga0495614_0007447
709 Ga0496103_0263311
710 Ga0496104_0022607
711 Ga0496104_0221679
712 Ga0496104_0397877
713 Ga0496105_0004791
714 Ga0496105_0135543
715 Ga0496107_0439875
716 Ga0496108_0592482
717 Ga0496111_0061212
718 Ga0496112_0366152
719 Ga0496117_0010841
720 Ga0496117_0031375
721 Ga0496118_0005901
722 Ga0496118_0111021
723 Ga0496119_0000248
724 Ga0496120_0000143
725 Ga0496121_0011954
726 Ga0501031_0000895
727 Ga0501033_0058967
728 Ga0501033_0198315
729 Ga0501033_0233173
730 Ga0501036_0000333
731 Ga0501036_0627365
732 Ga0501038_0001821
733 Ga0501038_0097897
734 Ga0501038_0391856
735 Ga0501038_0690793
736 Ga0501039_0000617
737 Ga0501039_0806634
738 Ga0501040_0000098
739 Ga0501040_0169297
740 Ga0501041_0000145
741 Ga0501041_0234064
742 Ga0501041_0277214
743 Ga0501042_0000144
744 Ga0501042_0247277
745 Ga0501043_0003867
746 Ga0501043_0013637
747 Ga0501043_0132165
748 Ga0501043_0562425
749 Ga0501046_0000886
750 Ga0501046_0090846
751 Ga0501046_0156481
752 Ga0501047_0367431
753 Ga0501047_0449538
754 Ga0501048_0001053
755 Ga0501048_0224740
756 Ga0501069_0100718
757 Ga0501070_0053722
758 Ga0501070_0068978
759 Ga0501071_0000340
760 Ga0501071_0096037
761 Ga0501071_0523110
762 Ga0501072_0000179
763 Ga0501072_0014909
764 Ga0501073_0410054
765 Ga0501073_0439744
766 Ga0501074_0013824
767 Ga0501074_0144029
768 Ga0501074_0477898
769 Ga0501075_0000243
770 Ga0501076_0000238
771 Ga0501076_0112279
772 Ga0501077_0000460
773 Ga0501077_0247238
774 Ga0501077_0484461
775 Ga0501079_0000103
776 Ga0501079_0105832
777 Ga0501079_0114815
778 Ga0501079_0161032
779 Ga0501079_0278522
780 Ga0501079_0481012
781 Ga0501080_0013692
782 Ga0501081_0000438
783 Ga0501081_0085185
784 Ga0501081_0101048
785 Ga0501081_0408983
786 Ga0501081_0541034
787 Ga0501083_0014641
788 Ga0501083_0340224
789 Ga0501044_0026395
790 Ga0501044_0184498
791 Ga0501044_0769059
792 Ga0501045_0000109
793 Ga0501045_0071060
794 Ga0501045_0428937
795 nmdc:mga03n38_221302_c1
796 nmdc:mga00v17_104384_c1
797 nmdc:mga0yw44_21615_c1
798 nmdc:mga0k408_383169_c1
799 nmdc:mga06z11_109532_c1
800 nmdc:mga06z11_119988_c1
801 nmdc:mga07m45_91726_c1
802 nmdc:mga09592_212204_c1
803 nmdc:mga0qj67_43128_c1
804 nmdc:mga06r32_350719_c1
805 nmdc:mga06r32_404670_c1
806 nmdc:mga08y16_116573_c1
807 nmdc:mga0n895_50897_c1
808 nmdc:mga0n895_599563_c1
809 nmdc:mga0n895_60111_c1
810 nmdc:mga0n895_617726_c1
811 nmdc:mga0rr50_85279_c1
812 Ga0495601_0006270
813 Ga0495601_0047751
814 Ga0495612_0397006
815 Ga0495619_0132116
816 Ga0495619_0165179
817 Ga0495619_0251233
818 Ga0500620_007567
819 Ga0500637_0081440
820 Ga0501084_0000383
821 Ga0501084_0018139
822 Ga0501084_0069824
823 Ga0501084_0119716
824 Ga0501084_0828243
825 Ga0501082_0000047
826 Ga0501082_0129698
827 Ga0501082_0166331
828 Ga0501082_0414208
829 Ga0501082_0432033
830 Ga0501082_0940056
831 Ga0530510_0000144
832 Ga0530510_0001500
833 Ga0530510_0021316
834 Ga0530510_0380999
835 2514053618
836 2515691533
837 2563064178
838 2599735619
839 2599745610
840 2600207518
841 2676746577
842 2713472452
843 2746091412
844 2746097306
845 2753035270
846 2753323787
847 2792834197
848 2819630352
849 2870074764
850 2870076017
851 2870076878
852 2870077075
853 2885278887
854 2921649278
855 2928177800
856 3005416317
857 8018853187
858 8020949806
859 8021121110
860 8057577240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

28

223

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.9035 18 215
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.9008 20 216
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8874 20 216
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8813 18 215
5i44-assembly1.cif.gz_D structure of raca-dna complex; p21 form 0.5484 168 221
ID Description Score Start End Superfamily
af_A0A2R8QLZ8_1_106_3.30.30.170 Alpha Beta;2-Layer Sandwich;Defensin A-like; 0.5508 168 215 3.30.30.170
5i44I00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5226 168 221 1.10.1660.10
af_O94424_188_254_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5203 168 204 1.10.10.10
af_A0A1D6FSW5_203_270_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5095 157 204 1.10.10.10
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5086 168 221 1.10.1660.10
ID Description Score Start End GO Terms
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9544 143 215 GO:0005524
GO:0005886
GO:0008556
AF-A0A4Q3NCE3-F1-model_v4 Potassium-transporting ATPase subunit C 0.9526 155 215 GO:0005524
GO:0005886
GO:0008556
AF-A0A4U0S0W4-F1-model_v4 Potassium-transporting ATPase subunit C 0.9525 137 215 GO:0005524
GO:0005886
GO:0008556
AF-A0A7U8TG48-F1-model_v4 deleted 0.9524 35 214
AF-D5RTV0-F1-model_v4 Potassium-transporting ATPase subunit C 0.9508 170 214 GO:0005524
GO:0005886
GO:0008556

Map