F442083

General Info

Members Datasets Scaffolds Average Seq Length
430 223 430 215

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100240988|Ga0070714_1002409881
Length 238
Sequence MAPDARFVFSDRSPDSRSSGRATLRVVADLVYRERPADGNPAGLLVLHHGRGAEEADLLGLADGLDPGRRLHVVAPRAPLELGGPGYHWYVVPRVGYPDPATFHAAYRQLAALHDGLWERLGLTPEQTVLGGFSMGTVMSYALGLGPDRPAPAGILAFSGFVPTVEGWQPQLPRPTKAFVAHGRADPIMEIGFARRARELLEASGMDVVYREGDHGHWIEPEDVAAAAAWLTAVVPSG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 13.02
Rhizosphere 82.79
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000108 3300001977 Bacteria 9564
2 Ga0070658_10095594 3300005327 Bacteria 2453
3 Ga0070683_100013998 3300005329 Bacteria 7006
4 Ga0070683_100142331 3300005329 Bacteria 2272
5 Ga0070683_100414027 3300005329 Bacteria 1286
6 Ga0070683_100714773 3300005329 Bacteria 960
7 Ga0070670_100664131 3300005331 Bacteria 936
8 Ga0070680_100280901 3300005336 Bacteria 1411
9 Ga0070682_100117716 3300005337 Bacteria 1779
10 Ga0070682_100553319 3300005337 Bacteria 901
11 Ga0070660_100149129 3300005339 Bacteria 1880
12 Ga0070687_100071132 3300005343 Bacteria 1868
13 Ga0070661_100000023 3300005344 Bacteria 123104
14 Ga0070692_10042841 3300005345 Bacteria 2326
15 Ga0070668_100393426 3300005347 Bacteria 1182
16 Ga0070688_100150199 3300005365 Bacteria 1592
17 Ga0070709_10022253 3300005434 Bacteria 3705
18 Ga0070709_10054128 3300005434 Bacteria 2529
19 Ga0070709_10280220 3300005434 Bacteria 1211
20 Ga0070714_100019819 3300005435 Bacteria 5485
21 Ga0070714_100116653 3300005435 Bacteria 2370
22 Ga0070714_100179833 3300005435 Bacteria 1924
23 Ga0070714_100240988 3300005435 Bacteria 1669
24 Ga0070714_100791190 3300005435 Bacteria 918
25 Ga0070713_100009023 3300005436 Bacteria 7109
26 Ga0070713_100037992 3300005436 Bacteria 3897
27 Ga0070713_100149474 3300005436 Bacteria 2076
28 Ga0070713_100270271 3300005436 Bacteria 1556
29 Ga0070710_10004976 3300005437 Bacteria 6291
30 Ga0070710_10225129 3300005437 Unclassified 1195
31 Ga0070710_10295267 3300005437 Bacteria 1056
32 Ga0070711_100014047 3300005439 Bacteria 5038
33 Ga0070711_100125603 3300005439 Unclassified 1904
34 Ga0070678_100016735 3300005456 Bacteria 4699
35 Ga0070679_100000312 3300005530 Bacteria 41159
36 Ga0070684_100024149 3300005535 Bacteria 5096
37 Ga0070684_100294008 3300005535 Bacteria 1490
38 Ga0070684_100476791 3300005535 Bacteria 1154
39 Ga0070684_100856532 3300005535 Bacteria 851
40 Ga0068853_100002766 3300005539 Bacteria 13247
41 Ga0068853_100277668 3300005539 Bacteria 1544
42 Ga0070686_100218959 3300005544 Bacteria 1375
43 Ga0070693_100381078 3300005547 Bacteria 973
44 Ga0070665_100018937 3300005548 Bacteria 6906
45 Ga0070664_100233938 3300005564 Bacteria 1648
46 Ga0068854_100000031 3300005578 Bacteria 107298
47 Ga0068856_100238092 3300005614 Bacteria 1836
48 Ga0068856_100606233 3300005614 Bacteria 1116
49 Ga0070702_100029123 3300005615 Bacteria 3000
50 Ga0070702_100298884 3300005615 Bacteria 1113
51 Ga0068851_10138000 3300005834 Bacteria 1324
52 Ga0068858_100001207 3300005842 Bacteria 26780
53 Ga0081455_10020961 3300005937 Bacteria 6142
54 Ga0081455_10102228 3300005937 Bacteria 2298
55 Ga0081538_10001191 3300005981 Bacteria 27404
56 Ga0081538_10001202 3300005981 Bacteria 27168
57 Ga0081538_10032109 3300005981 Bacteria 3527
58 Ga0081538_10055473 3300005981 Bacteria 2333
59 Ga0081538_10202806 3300005981 Unclassified 812
60 Ga0081539_10001929 3300005985 Bacteria 31957
61 Ga0081539_10007823 3300005985 Bacteria 9557
62 Ga0081539_10053243 3300005985 Bacteria 2267
63 Ga0070717_10011313 3300006028 Bacteria 6772
64 Ga0070717_10012749 3300006028 Bacteria 6415
65 Ga0070717_10022301 3300006028 Bacteria 5002
66 Ga0075363_100084730 3300006048 Bacteria 1738
67 Ga0070715_10003619 3300006163 Bacteria 4955
68 Ga0070716_100007060 3300006173 Bacteria 5512
69 Ga0070716_100118956 3300006173 Bacteria 1650
70 Ga0070712_100192603 3300006175 Bacteria 1596
71 Ga0075434_100377850 3300006871 Bacteria 1438
72 Ga0068865_100000104 3300006881 Bacteria 43423
73 Ga0075435_100045066 3300007076 Bacteria 3534
74 Ga0099795_10068731 3300007788 Bacteria 1332
75 Ga0105251_10154138 3300009011 Bacteria 1037
76 Ga0111539_10016568 3300009094 Bacteria 9137
77 Ga0111539_10253354 3300009094 Bacteria 2050
78 Ga0111539_10673772 3300009094 Bacteria 1204
79 Ga0111539_10680718 3300009094 Bacteria 1197
80 Ga0105245_10006569 3300009098 Bacteria 10206
81 Ga0105245_10083997 3300009098 Bacteria 2916
82 Ga0105245_10171925 3300009098 Bacteria 2064
83 Ga0105245_10187290 3300009098 Bacteria 1980
84 Ga0105245_10445098 3300009098 Bacteria 1303
85 Ga0105247_10194478 3300009101 Bacteria 1359
86 Ga0105247_10196525 3300009101 Bacteria 1353
87 Ga0105247_10285229 3300009101 Bacteria 1140
88 Ga0105243_10083894 3300009148 Bacteria 2608
89 Ga0105243_10334601 3300009148 Bacteria 1384
90 Ga0105243_10451835 3300009148 Bacteria 1206
91 Ga0105243_10927305 3300009148 Bacteria 868
92 Ga0105241_10364037 3300009174 Bacteria 1259
93 Ga0105242_10623108 3300009176 Bacteria 1045
94 Ga0105246_10046596 3300011119 Bacteria 2958
95 Ga0105246_10209426 3300011119 Bacteria 1521
96 Ga0157370_10014865 3300013104 Bacteria 7942
97 Ga0157369_10123462 3300013105 Bacteria 2747
98 Ga0157374_10208551 3300013296 Bacteria 1915
99 Ga0157378_10118892 3300013297 Bacteria 2433
100 Ga0157375_10333160 3300013308 Bacteria 1683
101 Ga0157375_11079193 3300013308 Unclassified 939
102 Ga0163163_10281181 3300014325 Unclassified 1715
103 Ga0163163_11112572 3300014325 Bacteria 853
104 Ga0157379_10410888 3300014968 Bacteria 1245
105 Ga0157379_10491823 3300014968 Bacteria 1136
106 Ga0213874_10010552 3300021377 Bacteria 2314
107 Ga0213875_10050881 3300021388 Bacteria 1941
108 Ga0213875_10145084 3300021388 Bacteria 1112
109 Ga0213875_10145579 3300021388 Bacteria 1110
110 Ga0207656_10081265 3300025321 Bacteria 1457
111 Ga0207682_10000206 3300025893 Bacteria 26843
112 Ga0207692_10119351 3300025898 Bacteria 1474
113 Ga0207710_10120517 3300025900 Bacteria 1252
114 Ga0207710_10188329 3300025900 Bacteria 1015
115 Ga0207685_10004720 3300025905 Bacteria 3504
116 Ga0207699_10115227 3300025906 Bacteria 1729
117 Ga0207699_10314445 3300025906 Bacteria 1097
118 Ga0207699_10337901 3300025906 Bacteria 1060
119 Ga0207643_10259972 3300025908 Bacteria 1072
120 Ga0207705_10053434 3300025909 Bacteria 2910
121 Ga0207707_10018013 3300025912 Bacteria 6153
122 Ga0207707_10323907 3300025912 Bacteria 1330
123 Ga0207693_10016329 3300025915 Bacteria 5936
124 Ga0207693_10400704 3300025915 Bacteria 1073
125 Ga0207663_10031985 3300025916 Bacteria 3119
126 Ga0207663_10047675 3300025916 Bacteria 2647
127 Ga0207657_10233555 3300025919 Bacteria 1470
128 Ga0207649_10000063 3300025920 Bacteria 96360
129 Ga0207649_10224248 3300025920 Bacteria 1341
130 Ga0207652_10000483 3300025921 Bacteria 40881
131 Ga0207652_10623367 3300025921 Bacteria 966
132 Ga0207650_10024224 3300025925 Bacteria 4312
133 Ga0207687_10000247 3300025927 Bacteria 36785
134 Ga0207687_10004769 3300025927 Bacteria 9019
135 Ga0207687_10167898 3300025927 Bacteria 1690
136 Ga0207687_10295695 3300025927 Bacteria 1303
137 Ga0207687_10462877 3300025927 Bacteria 1053
138 Ga0207700_10053120 3300025928 Bacteria 3034
139 Ga0207700_10429389 3300025928 Bacteria 1162
140 Ga0207664_10039877 3300025929 Bacteria 3647
141 Ga0207664_10132145 3300025929 Bacteria 2102
142 Ga0207664_10522433 3300025929 Bacteria 1064
143 Ga0207690_10343008 3300025932 Bacteria 1179
144 Ga0207706_10028118 3300025933 Bacteria 5023
145 Ga0207686_10000428 3300025934 Bacteria 28669
146 Ga0207709_10007009 3300025935 Bacteria 6301
147 Ga0207709_10033570 3300025935 Bacteria 3015
148 Ga0207709_10293776 3300025935 Bacteria 1205
149 Ga0207709_10306831 3300025935 Bacteria 1182
150 Ga0207704_10000146 3300025938 Bacteria 37894
151 Ga0207665_10000375 3300025939 Bacteria 30844
152 Ga0207665_10184563 3300025939 Bacteria 1512
153 Ga0207711_10188376 3300025941 Bacteria 1879
154 Ga0207661_10008086 3300025944 Bacteria 7501
155 Ga0207661_10115154 3300025944 Bacteria 2281
156 Ga0207679_10030423 3300025945 Bacteria 3770
157 Ga0207667_10093997 3300025949 Bacteria 3096
158 Ga0207712_10261052 3300025961 Bacteria 1405
159 Ga0207668_10046966 3300025972 Bacteria 2954
160 Ga0207668_10383799 3300025972 Bacteria 1183
161 Ga0207677_10003161 3300026023 Bacteria 8691
162 Ga0207677_10478386 3300026023 Bacteria 1073
163 Ga0207703_10001815 3300026035 Bacteria 19030
164 Ga0207639_10005404 3300026041 Bacteria 8640
165 Ga0207708_10017730 3300026075 Bacteria 5359
166 Ga0207708_10125472 3300026075 Bacteria 2003
167 Ga0207702_10045314 3300026078 Bacteria 3700
168 Ga0207702_10330589 3300026078 Bacteria 1454
169 Ga0207648_10222786 3300026089 Bacteria 1677
170 Ga0207676_10000016 3300026095 Bacteria 311561
171 Ga0207683_10008689 3300026121 Bacteria 8685
172 Ga0207683_10302909 3300026121 Bacteria 1462
173 Ga0207683_10647341 3300026121 Bacteria 979
174 Ga0207683_10750886 3300026121 Bacteria 905
175 Ga0207698_10366543 3300026142 Bacteria 1366
176 Ga0207428_10044690 3300027907 Bacteria 3572
177 Ga0268266_10000020 3300028379 Bacteria 527065
178 Ga0265326_10057198 3300028558 Bacteria 1104
179 Ga0265318_10104258 3300028577 Unclassified 1043
180 Ga0265327_10014106 3300031251 Bacteria 5249
181 Ga0265327_10143904 3300031251 Bacteria 1112
182 Ga0307408_100235539 3300031548 Bacteria 1502
183 Ga0307408_100607109 3300031548 Bacteria 973
184 Ga0307408_100713184 3300031548 Bacteria 903
185 Ga0307413_10125859 3300031824 Bacteria 1745
186 Ga0307413_10127554 3300031824 Bacteria 1735
187 Ga0307410_10365872 3300031852 Bacteria 1156
188 Ga0307410_10492277 3300031852 Bacteria 1008
189 Ga0307406_10087464 3300031901 Bacteria 2089
190 Ga0307407_10121472 3300031903 Bacteria 1657
191 Ga0307407_10206958 3300031903 Bacteria 1318
192 Ga0307407_10336621 3300031903 Bacteria 1064
193 Ga0307409_100151122 3300031995 Bacteria 2016
194 Ga0307409_100359785 3300031995 Bacteria 1376
195 Ga0307416_100455771 3300032002 Bacteria 1333
196 Ga0307416_100498628 3300032002 Bacteria 1281
197 Ga0307416_100931852 3300032002 Bacteria 970
198 Ga0307414_10902029 3300032004 Bacteria 810
199 Ga0307411_10052930 3300032005 Bacteria 2657
200 Ga0307411_10171132 3300032005 Bacteria 1638
201 Ga0373954_0303805 3300035118 Unclassified 787
202 Ga0373931_0358741 3300035691 Bacteria 914
203 Ga0373935_0159244 3300035692 Unclassified 1538
204 Ga0373947_0193620 3300035725 Bacteria 1327
205 Ga0373937_0011597 3300036401 Bacteria 7740
206 Ga0373937_0052064 3300036401 Bacteria 3753
207 Ga0373937_0389527 3300036401 Bacteria 1322
208 Ga0395899_0078446 3300037312 Bacteria 2407
209 Ga0395899_0080196 3300037312 Bacteria 2376
210 Ga0395899_0113725 3300037312 Bacteria 1944
211 Ga0395899_0380628 3300037312 Bacteria 938
212 Ga0395900_0046987 3300037418 Bacteria 4445
213 Ga0395900_0061243 3300037418 Bacteria 3870
214 Ga0395900_0311892 3300037418 Bacteria 1556
215 Ga0395900_0645609 3300037418 Unclassified 995
216 Ga0395898_0019069 3300037466 Bacteria 6983
217 Ga0395898_0429603 3300037466 Bacteria 1259
218 Ga0395898_0483891 3300037466 Bacteria 1177
219 Ga0395905_0441700 3300037471 Unclassified 1198
220 Ga0436364_0133889 3300037853 Bacteria 1696
221 Ga0436364_0141559 3300037853 Bacteria 12383
222 Ga0436364_0420463 3300037853 Bacteria 6928
223 Ga0436364_0447959 3300037853 Bacteria 9334
224 Ga0436364_0677536 3300037853 Bacteria 957
225 Ga0436364_1363163 3300037853 Bacteria 2777
226 Ga0395901_0018789 3300038443 Bacteria 7063
227 Ga0395901_0083726 3300038443 Bacteria 3334
228 Ga0395901_0192414 3300038443 Bacteria 2139
229 Ga0395901_0302600 3300038443 Bacteria 1658
230 Ga0436365_1490741 3300039437 Unclassified 2613
231 Ga0436360_0546867 3300039438 Bacteria 17506
232 Ga0436363_0119607 3300039450 Bacteria 1566
233 Ga0436363_1490049 3300039450 Bacteria 2010
234 Ga0436363_1602973 3300039450 Bacteria 1675
235 Ga0439463_022604 3300042016 Unclassified 1574
236 Ga0466966_0061528 3300044684 Bacteria 2368
237 Ga0466961_0027646 3300044693 Bacteria 3649
238 Ga0466961_0095071 3300044693 Bacteria 1880
239 Ga0466963_0037352 3300044694 Bacteria 3170
240 Ga0466963_0059215 3300044694 Bacteria 2556
241 Ga0466963_0214784 3300044694 Bacteria 1346
242 Ga0466971_0007381 3300044719 Bacteria 4786
243 Ga0466971_0021943 3300044719 Bacteria 2842
244 Ga0466971_0091283 3300044719 Bacteria 1395
245 Ga0466968_0034919 3300044735 Bacteria 2101
246 Ga0466970_0017235 3300044765 Bacteria 3731
247 Ga0466970_0077499 3300044765 Bacteria 1792
248 Ga0466957_0175181 3300044842 Bacteria 1399
249 Ga0466957_0379345 3300044842 Bacteria 964
250 Ga0466960_0325393 3300044901 Bacteria 871
251 Ga0466959_0044449 3300045049 Bacteria 3273
252 Ga0466959_0147577 3300045049 Bacteria 1659
253 Ga0466959_0192476 3300045049 Unclassified 1423
254 Ga0466959_0672795 3300045049 Bacteria 694
255 Ga0466958_0014005 3300045836 Bacteria 4574
256 Ga0466958_0030473 3300045836 Bacteria 3205
257 Ga0466958_0061614 3300045836 Bacteria 2286
258 Ga0466958_0135783 3300045836 Bacteria 1547
259 Ga0466958_0161883 3300045836 Bacteria 1414
260 Ga0466967_0000027 3300045976 Bacteria 64265
261 Ga0466967_0141803 3300045976 Bacteria 2239
262 Ga0466967_0213016 3300045976 Bacteria 1833
263 Ga0466967_0262629 3300045976 Bacteria 1652
264 Ga0466967_0651605 3300045976 Bacteria 1041
265 Ga0466967_0723657 3300045976 Unclassified 986
266 Ga0495592_0241570 3300046454 Bacteria 1198
267 Ga0495629_0030326 3300046459 Bacteria 3835
268 Ga0495629_0103943 3300046459 Bacteria 1981
269 Ga0495641_0000003 3300046461 Bacteria 242879
270 Ga0495641_0014142 3300046461 Bacteria 4333
271 Ga0495641_0030683 3300046461 Bacteria 2575
272 Ga0495653_0044743 3300046463 Bacteria 3435
273 Ga0495582_0022946 3300046473 Bacteria 3413
274 Ga0495582_0153153 3300046473 Bacteria 1309
275 Ga0495662_0034097 3300046476 Bacteria 2458
276 Ga0495662_0097739 3300046476 Bacteria 1435
277 Ga0495664_0246372 3300046477 Unclassified 1081
278 Ga0495594_0000003 3300046499 Bacteria 199267
279 Ga0495594_0412506 3300046499 Bacteria 768
280 Ga0495594_0414325 3300046499 Bacteria 766
281 Ga0495608_0000031 3300046511 Bacteria 145255
282 Ga0495608_0065843 3300046511 Bacteria 2373
283 Ga0495608_0150897 3300046511 Bacteria 1481
284 Ga0495628_0077274 3300046516 Bacteria 2590
285 Ga0495628_0343967 3300046516 Bacteria 1097
286 Ga0495628_0374656 3300046516 Bacteria 1043
287 Ga0495630_0000018 3300046517 Bacteria 186064
288 Ga0495630_0001422 3300046517 Bacteria 16564
289 Ga0495630_0233510 3300046517 Unclassified 1405
290 Ga0495630_0446954 3300046517 Bacteria 990
291 Ga0495643_0071250 3300046522 Bacteria 1825
292 Ga0495644_0131984 3300046523 Bacteria 952
293 Ga0495640_0084342 3300046533 Bacteria 2107
294 Ga0495586_0080146 3300046535 Bacteria 1793
295 Ga0495587_0301669 3300046536 Bacteria 896
296 Ga0495645_0258829 3300046543 Bacteria 1153
297 Ga0495622_0000714 3300046557 Bacteria 18760
298 Ga0495667_0000032 3300046559 Bacteria 143493
299 Ga0495634_0058968 3300046642 Bacteria 2558
300 Ga0495634_0129688 3300046642 Bacteria 1608
301 Ga0495625_0000122 3300046660 Bacteria 121146
302 Ga0495635_0025907 3300046663 Bacteria 4084
303 Ga0495635_0095935 3300046663 Bacteria 2027
304 Ga0495635_0448877 3300046663 Bacteria 853
305 Ga0495588_0000274 3300046674 Bacteria 39224
306 Ga0495657_0024567 3300046675 Bacteria 4290
307 Ga0495647_0000025 3300046681 Bacteria 65184
308 Ga0495647_0002735 3300046681 Bacteria 5594
309 Ga0495647_0012620 3300046681 Bacteria 2913
310 Ga0495658_0026207 3300046683 Bacteria 3122
311 Ga0495658_0348333 3300046683 Bacteria 941
312 Ga0495613_0000073 3300046689 Bacteria 98688
313 Ga0495613_0061076 3300046689 Bacteria 2760
314 Ga0495613_0065465 3300046689 Bacteria 2656
315 Ga0495649_0046464 3300046694 Bacteria 2364
316 Ga0495600_0015949 3300046809 Bacteria 4760
317 Ga0495600_0049434 3300046809 Bacteria 2744
318 Ga0495600_0142030 3300046809 Bacteria 1557
319 Ga0495581_0334220 3300047315 Unclassified 884
320 Ga0495674_0208989 3300047319 Bacteria 1617
321 Ga0495672_0025027 3300047320 Bacteria 3830
322 Ga0495672_0106218 3300047320 Bacteria 1514
323 Ga0495676_0029294 3300047321 Bacteria 4689
324 Ga0495676_0120837 3300047321 Bacteria 1906
325 Ga0495680_0000317 3300047322 Bacteria 53949
326 Ga0495680_0037683 3300047322 Bacteria 3872
327 Ga0495680_0405330 3300047322 Unclassified 941
328 Ga0495684_0322806 3300047471 Bacteria 1103
329 Ga0495593_0018248 3300047673 Bacteria 3945
330 Ga0495602_0000021 3300048088 Bacteria 168585
331 Ga0495614_0132739 3300048089 Bacteria 1103
332 Ga0496100_0049983 3300048903 Bacteria 2706
333 Ga0496100_0288502 3300048903 Unclassified 1225
334 Ga0496102_0020241 3300048905 Bacteria 5878
335 Ga0496102_0179676 3300048905 Bacteria 1993
336 Ga0496103_0011006 3300048906 Bacteria 5354
337 Ga0496104_0008113 3300048907 Bacteria 9317
338 Ga0496104_0012042 3300048907 Bacteria 7762
339 Ga0496104_0246141 3300048907 Bacteria 1700
340 Ga0496104_0259592 3300048907 Bacteria 1650
341 Ga0496104_0623399 3300048907 Bacteria 988
342 Ga0496105_0004890 3300048908 Bacteria 10128
343 Ga0496105_0064085 3300048908 Bacteria 3032
344 Ga0496105_0122216 3300048908 Bacteria 2146
345 Ga0496106_0000049 3300048909 Bacteria 97550
346 Ga0496106_0037841 3300048909 Bacteria 3610
347 Ga0496106_0197685 3300048909 Bacteria 1600
348 Ga0496106_0213372 3300048909 Bacteria 1538
349 Ga0496106_0798853 3300048909 Bacteria 748
350 Ga0496107_0019442 3300048910 Bacteria 4792
351 Ga0496107_0034407 3300048910 Bacteria 3629
352 Ga0496107_0110207 3300048910 Bacteria 2023
353 Ga0496107_0359933 3300048910 Bacteria 1083
354 Ga0496108_0086420 3300048911 Bacteria 2662
355 Ga0496108_0173309 3300048911 Unclassified 1867
356 Ga0496108_0189507 3300048911 Bacteria 1782
357 Ga0496108_0521875 3300048911 Bacteria 1037
358 Ga0496109_0000028 3300048912 Bacteria 168138
359 Ga0496109_0020362 3300048912 Bacteria 5858
360 Ga0496109_0023626 3300048912 Bacteria 5457
361 Ga0496109_0225761 3300048912 Bacteria 1762
362 Ga0496109_0515090 3300048912 Bacteria 1129
363 Ga0496109_0749527 3300048912 Bacteria 914
364 Ga0496110_0019873 3300048913 Bacteria 5661
365 Ga0496110_0051100 3300048913 Bacteria 3632
366 Ga0496110_1182443 3300048913 Bacteria 673
367 Ga0496111_0027548 3300048914 Bacteria 4021
368 Ga0496111_0098149 3300048914 Unclassified 2151
369 Ga0496111_0102963 3300048914 Bacteria 2099
370 Ga0496112_0086278 3300048915 Bacteria 3106
371 Ga0496112_0124681 3300048915 Bacteria 2547
372 Ga0496112_0172270 3300048915 Bacteria 2129
373 Ga0496112_0211252 3300048915 Bacteria 1898
374 Ga0496112_0237084 3300048915 Bacteria 1778
375 Ga0496112_0241058 3300048915 Bacteria 1761
376 Ga0496112_0241630 3300048915 Bacteria 1758
377 Ga0496112_0854443 3300048915 Unclassified 833
378 Ga0496113_0000029 3300048916 Bacteria 61873
379 Ga0496113_0006564 3300048916 Bacteria 7388
380 Ga0496113_0740568 3300048916 Unclassified 783
381 Ga0496114_0008003 3300048917 Bacteria 8364
382 Ga0496114_0015889 3300048917 Bacteria 6058
383 Ga0496114_0078009 3300048917 Bacteria 2794
384 Ga0496114_0212722 3300048917 Bacteria 1696
385 Ga0496114_0543299 3300048917 Bacteria 1027
386 Ga0496115_0000035 3300048918 Bacteria 134475
387 Ga0496115_0118299 3300048918 Bacteria 2180
388 Ga0496124_0337286 3300048927 Bacteria 1072
389 Ga0496126_0041755 3300048929 Bacteria 4242
390 Ga0501305_015227 3300049161 Bacteria 1084
391 Ga0501031_0061238 3300049568 Bacteria 2453
392 Ga0501036_0111116 3300049572 Bacteria 2316
393 Ga0501040_0049097 3300049576 Bacteria 2885
394 Ga0501040_0749599 3300049576 Bacteria 706
395 Ga0501041_0242213 3300049577 Bacteria 1133
396 Ga0501046_0254038 3300049580 Bacteria 1293
397 Ga0501048_0049547 3300049582 Bacteria 2993
398 Ga0501067_0018877 3300049583 Bacteria 3815
399 Ga0501069_0218411 3300049585 Bacteria 1107
400 Ga0501070_0200633 3300049586 Bacteria 1638
401 Ga0501073_0317133 3300049589 Bacteria 1076
402 Ga0501075_0016585 3300049591 Bacteria 5309
403 Ga0501076_0039402 3300049592 Bacteria 3709
404 Ga0501079_0263159 3300049741 Bacteria 1348
405 Ga0501081_0034569 3300049743 Bacteria 3439
406 Ga0501035_0584879 3300049822 Bacteria 911
407 nmdc:mga0yw44_67698_c1 3300050492 Bacteria 2207
408 nmdc:mga08y16_139351_c1 3300050511 Bacteria 2522
409 nmdc:mga0n895_316892_c1 3300050512 Bacteria 1580
410 nmdc:mga0n895_718565_c1 3300050512 Bacteria 994
411 nmdc:mga0rr50_48591_c1 3300050513 Bacteria 3137
412 nmdc:mga0rr50_5626_c1 3300050513 Bacteria 7504
413 nmdc:mga0a205_238558_c1 3300050515 Bacteria 1699
414 Ga0495601_0000375 3300053077 Bacteria 23634
415 Ga0495601_0609402 3300053077 Unclassified 700
416 Ga0495612_0000068 3300053078 Bacteria 47169
417 Ga0495612_0001555 3300053078 Bacteria 9456
418 Ga0495612_0126894 3300053078 Bacteria 1100
419 Ga0495655_0001262 3300053083 Bacteria 3908
420 Ga0495595_0011424 3300053084 Bacteria 3712
421 Ga0495619_0003046 3300053085 Bacteria 10884
422 Ga0495619_0138743 3300053085 Bacteria 1673
423 Ga0495619_0283787 3300053085 Bacteria 1147
424 Ga0501084_0137769 3300054114 Bacteria 2054
425 Ga0501082_0117843 3300060353 Bacteria 2300
426 Ga0501082_0484312 3300060353 Unclassified 1081
427 Ga0466962_0054611 3300061719 Bacteria 1908
428 Ga0466962_0147080 3300061719 Bacteria 1142
429 Ga0530510_0070882 3300061734 Bacteria 2529
430 Ga0530510_0641826 3300061734 Bacteria 808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10333160 Ga0157375_103331602 190
2 3300005435 Ga0070714_100019819 Ga0070714_1000198195 192
3 3300005436 Ga0070713_100270271 Ga0070713_1002702712 192
4 3300006028 Ga0070717_10011313 Ga0070717_100113133 192
5 3300025929 Ga0207664_10039877 Ga0207664_100398773 192
6 3300014325 Ga0163163_10281181 Ga0163163_102811812 193
7 3300048913 Ga0496110_1182443 Ga0496110_1182443_33_614 193
8 3300048914 Ga0496111_0098149 Ga0496111_0098149_926_1507 193
9 3300005530 Ga0070679_100000312 Ga0070679_10000031218 194
10 3300005535 Ga0070684_100024149 Ga0070684_1000241494 194
11 3300005842 Ga0068858_100001207 Ga0068858_10000120720 194
12 3300009098 Ga0105245_10083997 Ga0105245_100839972 194
13 3300025912 Ga0207707_10018013 Ga0207707_100180133 194
14 3300025921 Ga0207652_10000483 Ga0207652_1000048318 194
15 3300025927 Ga0207687_10000247 Ga0207687_1000024725 194
16 3300025944 Ga0207661_10008086 Ga0207661_100080866 194
17 3300025949 Ga0207667_10093997 Ga0207667_100939972 194
18 3300026035 Ga0207703_10001815 Ga0207703_100018159 194
19 3300028379 Ga0268266_10000020 Ga0268266_1000002043 194
20 3300046694 Ga0495649_0046464 Ga0495649_0046464_1242_1835 194
21 3300047322 Ga0495680_0000317 Ga0495680_0000317_47692_48285 194
22 3300053078 Ga0495612_0001555 Ga0495612_0001555_4828_5421 194
23 3300046681 Ga0495647_0000025 Ga0495647_0000025_48632_49219 195
24 3300045049 Ga0466959_0147577 Ga0466959_0147577_330_980 199
25 3300046473 Ga0495582_0022946 Ga0495582_0022946_1928_2563 199
26 3300046499 Ga0495594_0412506 Ga0495594_0412506_34_747 199
27 3300048089 Ga0495614_0132739 Ga0495614_0132739_223_858 199
28 3300005539 Ga0068853_100002766 Ga0068853_10000276612 201
29 3300026041 Ga0207639_10005404 Ga0207639_1000540410 201
30 3300045976 Ga0466967_0723657 Ga0466967_0723657_274_906 202
31 3300031548 Ga0307408_100607109 Ga0307408_1006071092 206
32 3300045976 Ga0466967_0213016 Ga0466967_0213016_14_658 206
33 3300049583 Ga0501067_0018877 Ga0501067_0018877_1697_2317 206
34 3300048915 Ga0496112_0237084 Ga0496112_0237084_924_1547 207
35 3300048916 Ga0496113_0740568 Ga0496113_0740568_91_714 207
36 3300005329 Ga0070683_100714773 Ga0070683_1007147732 208
37 3300005337 Ga0070682_100117716 Ga0070682_1001177162 208
38 3300005535 Ga0070684_100476791 Ga0070684_1004767912 208
39 3300009176 Ga0105242_10623108 Ga0105242_106231082 208
40 3300014325 Ga0163163_11112572 Ga0163163_111125722 208
41 3300025921 Ga0207652_10623367 Ga0207652_106233672 208
42 3300037418 Ga0395900_0061243 Ga0395900_0061243_2390_3016 208
43 3300044694 Ga0466963_0214784 Ga0466963_0214784_164_793 208
44 3300045976 Ga0466967_0651605 Ga0466967_0651605_136_765 208
45 3300048912 Ga0496109_0515090 Ga0496109_0515090_110_736 208
46 3300048915 Ga0496112_0241058 Ga0496112_0241058_1119_1745 208
47 3300049161 Ga0501305_015227 Ga0501305_015227_402_1049 208
48 3300005329 Ga0070683_100414027 Ga0070683_1004140272 209
49 3300005937 Ga0081455_10102228 Ga0081455_101022283 209
50 3300025906 Ga0207699_10314445 Ga0207699_103144452 209
51 3300036401 Ga0373937_0011597 Ga0373937_0011597_4615_5250 209
52 3300037312 Ga0395899_0113725 Ga0395899_0113725_211_852 209
53 3300037418 Ga0395900_0046987 Ga0395900_0046987_1406_2047 209
54 3300037466 Ga0395898_0019069 Ga0395898_0019069_4147_4788 209
55 3300038443 Ga0395901_0083726 Ga0395901_0083726_2597_3238 209
56 3300045976 Ga0466967_0262629 Ga0466967_0262629_543_1172 209
57 3300046809 Ga0495600_0015949 Ga0495600_0015949_2447_3082 209
58 3300050513 nmdc:mga0rr50_48591_c1 nmdc:mga0rr50_48591_c1_2299_2955 209
59 3300053085 Ga0495619_0003046 Ga0495619_0003046_9655_10290 209
60 3300005435 Ga0070714_100240988 Ga0070714_1002409881 210
61 3300005439 Ga0070711_100125603 Ga0070711_1001256031 210
62 3300005564 Ga0070664_100233938 Ga0070664_1002339382 210
63 3300007076 Ga0075435_100045066 Ga0075435_1000450662 210
64 3300009098 Ga0105245_10445098 Ga0105245_104450983 210
65 3300009148 Ga0105243_10451835 Ga0105243_104518352 210
66 3300025919 Ga0207657_10233555 Ga0207657_102335552 210
67 3300025920 Ga0207649_10224248 Ga0207649_102242483 210
68 3300025927 Ga0207687_10462877 Ga0207687_104628771 210
69 3300025928 Ga0207700_10053120 Ga0207700_100531203 210
70 3300025932 Ga0207690_10343008 Ga0207690_103430082 210
71 3300025933 Ga0207706_10028118 Ga0207706_100281183 210
72 3300025935 Ga0207709_10306831 Ga0207709_103068312 210
73 3300026023 Ga0207677_10478386 Ga0207677_104783861 210
74 3300026121 Ga0207683_10647341 Ga0207683_106473412 210
75 3300026142 Ga0207698_10366543 Ga0207698_103665432 210
76 3300035725 Ga0373947_0193620 Ga0373947_0193620_578_1213 210
77 3300037853 Ga0436364_0677536 Ga0436364_0677536_234_866 210
78 3300039438 Ga0436360_0546867 Ga0436360_0546867_14233_14898 210
79 3300044735 Ga0466968_0034919 Ga0466968_0034919_512_1156 210
80 3300045836 Ga0466958_0161883 Ga0466958_0161883_649_1287 210
81 3300046459 Ga0495629_0103943 Ga0495629_0103943_641_1276 210
82 3300046499 Ga0495594_0414325 Ga0495594_0414325_120_755 210
83 3300046523 Ga0495644_0131984 Ga0495644_0131984_221_865 210
84 3300046642 Ga0495634_0058968 Ga0495634_0058968_1890_2525 210
85 3300046683 Ga0495658_0348333 Ga0495658_0348333_224_859 210
86 3300046689 Ga0495613_0065465 Ga0495613_0065465_291_926 210
87 3300047322 Ga0495680_0405330 Ga0495680_0405330_177_830 210
88 3300050492 nmdc:mga0yw44_67698_c1 nmdc:mga0yw44_67698_c1_1334_1966 210
89 3300050512 nmdc:mga0n895_718565_c1 nmdc:mga0n895_718565_c1_60_692 210
90 3300050513 nmdc:mga0rr50_5626_c1 nmdc:mga0rr50_5626_c1_4102_4734 210
91 3300005343 Ga0070687_100071132 Ga0070687_1000711322 211
92 3300005434 Ga0070709_10022253 Ga0070709_100222535 211
93 3300005434 Ga0070709_10054128 Ga0070709_100541283 211
94 3300005435 Ga0070714_100116653 Ga0070714_1001166532 211
95 3300005436 Ga0070713_100009023 Ga0070713_1000090238 211
96 3300005436 Ga0070713_100149474 Ga0070713_1001494743 211
97 3300005437 Ga0070710_10004976 Ga0070710_100049767 211
98 3300005437 Ga0070710_10295267 Ga0070710_102952671 211
99 3300005439 Ga0070711_100014047 Ga0070711_1000140474 211
100 3300005535 Ga0070684_100294008 Ga0070684_1002940082 211
101 3300005535 Ga0070684_100856532 Ga0070684_1008565321 211
102 3300005539 Ga0068853_100277668 Ga0068853_1002776682 211
103 3300005544 Ga0070686_100218959 Ga0070686_1002189592 211
104 3300005547 Ga0070693_100381078 Ga0070693_1003810781 211
105 3300005614 Ga0068856_100238092 Ga0068856_1002380922 211
106 3300005615 Ga0070702_100029123 Ga0070702_1000291233 211
107 3300006028 Ga0070717_10012749 Ga0070717_100127496 211
108 3300006028 Ga0070717_10022301 Ga0070717_100223016 211
109 3300006163 Ga0070715_10003619 Ga0070715_100036195 211
110 3300006173 Ga0070716_100007060 Ga0070716_1000070603 211
111 3300006173 Ga0070716_100118956 Ga0070716_1001189563 211
112 3300006175 Ga0070712_100192603 Ga0070712_1001926032 211
113 3300007788 Ga0099795_10068731 Ga0099795_100687312 211
114 3300009094 Ga0111539_10673772 Ga0111539_106737722 211
115 3300009094 Ga0111539_10680718 Ga0111539_106807182 211
116 3300009098 Ga0105245_10171925 Ga0105245_101719252 211
117 3300009101 Ga0105247_10194478 Ga0105247_101944782 211
118 3300009101 Ga0105247_10285229 Ga0105247_102852291 211
119 3300009148 Ga0105243_10083894 Ga0105243_100838942 211
120 3300009174 Ga0105241_10364037 Ga0105241_103640372 211
121 3300011119 Ga0105246_10046596 Ga0105246_100465962 211
122 3300013105 Ga0157369_10123462 Ga0157369_101234626 211
123 3300013296 Ga0157374_10208551 Ga0157374_102085513 211
124 3300021388 Ga0213875_10145579 Ga0213875_101455792 211
125 3300025898 Ga0207692_10119351 Ga0207692_101193512 211
126 3300025900 Ga0207710_10188329 Ga0207710_101883292 211
127 3300025905 Ga0207685_10004720 Ga0207685_100047204 211
128 3300025906 Ga0207699_10115227 Ga0207699_101152272 211
129 3300025915 Ga0207693_10016329 Ga0207693_100163291 211
130 3300025915 Ga0207693_10400704 Ga0207693_104007043 211
131 3300025916 Ga0207663_10031985 Ga0207663_100319852 211
132 3300025927 Ga0207687_10167898 Ga0207687_101678982 211
133 3300025929 Ga0207664_10132145 Ga0207664_101321451 211
134 3300025935 Ga0207709_10033570 Ga0207709_100335704 211
135 3300025939 Ga0207665_10000375 Ga0207665_1000037531 211
136 3300025939 Ga0207665_10184563 Ga0207665_101845632 211
137 3300026075 Ga0207708_10125472 Ga0207708_101254722 211
138 3300026078 Ga0207702_10330589 Ga0207702_103305894 211
139 3300026089 Ga0207648_10222786 Ga0207648_102227862 211
140 3300026121 Ga0207683_10302909 Ga0207683_103029092 211
141 3300031251 Ga0265327_10143904 Ga0265327_101439042 211
142 3300035118 Ga0373954_0303805 Ga0373954_0303805_81_716 211
143 3300035691 Ga0373931_0358741 Ga0373931_0358741_14_664 211
144 3300035692 Ga0373935_0159244 Ga0373935_0159244_581_1228 211
145 3300036401 Ga0373937_0052064 Ga0373937_0052064_2292_2927 211
146 3300037312 Ga0395899_0078446 Ga0395899_0078446_1018_1653 211
147 3300037312 Ga0395899_0080196 Ga0395899_0080196_284_922 211
148 3300037418 Ga0395900_0311892 Ga0395900_0311892_536_1171 211
149 3300037418 Ga0395900_0645609 Ga0395900_0645609_146_784 211
150 3300037466 Ga0395898_0483891 Ga0395898_0483891_213_851 211
151 3300037471 Ga0395905_0441700 Ga0395905_0441700_539_1177 211
152 3300037853 Ga0436364_0141559 Ga0436364_0141559_2966_3631 211
153 3300037853 Ga0436364_0420463 Ga0436364_0420463_2845_3480 211
154 3300038443 Ga0395901_0018789 Ga0395901_0018789_310_945 211
155 3300039450 Ga0436363_0119607 Ga0436363_0119607_454_1098 211
156 3300039450 Ga0436363_1602973 Ga0436363_1602973_690_1337 211
157 3300044694 Ga0466963_0037352 Ga0466963_0037352_1509_2147 211
158 3300044719 Ga0466971_0021943 Ga0466971_0021943_55_690 211
159 3300044842 Ga0466957_0379345 Ga0466957_0379345_55_693 211
160 3300045836 Ga0466958_0014005 Ga0466958_0014005_1311_1946 211
161 3300046459 Ga0495629_0030326 Ga0495629_0030326_1301_1936 211
162 3300046461 Ga0495641_0014142 Ga0495641_0014142_1645_2280 211
163 3300046463 Ga0495653_0044743 Ga0495653_0044743_1542_2177 211
164 3300046473 Ga0495582_0153153 Ga0495582_0153153_536_1171 211
165 3300046476 Ga0495662_0097739 Ga0495662_0097739_507_1142 211
166 3300046511 Ga0495608_0065843 Ga0495608_0065843_1363_1998 211
167 3300046517 Ga0495630_0001422 Ga0495630_0001422_1876_2511 211
168 3300046533 Ga0495640_0084342 Ga0495640_0084342_823_1458 211
169 3300046535 Ga0495586_0080146 Ga0495586_0080146_607_1242 211
170 3300046642 Ga0495634_0129688 Ga0495634_0129688_464_1099 211
171 3300046663 Ga0495635_0095935 Ga0495635_0095935_928_1581 211
172 3300046681 Ga0495647_0012620 Ga0495647_0012620_2064_2699 211
173 3300046689 Ga0495613_0061076 Ga0495613_0061076_534_1169 211
174 3300047315 Ga0495581_0334220 Ga0495581_0334220_186_821 211
175 3300047319 Ga0495674_0208989 Ga0495674_0208989_438_1073 211
176 3300047322 Ga0495680_0037683 Ga0495680_0037683_807_1442 211
177 3300047471 Ga0495684_0322806 Ga0495684_0322806_84_722 211
178 3300048903 Ga0496100_0049983 Ga0496100_0049983_1841_2491 211
179 3300048903 Ga0496100_0288502 Ga0496100_0288502_319_954 211
180 3300048905 Ga0496102_0020241 Ga0496102_0020241_4956_5606 211
181 3300048906 Ga0496103_0011006 Ga0496103_0011006_2709_3359 211
182 3300048907 Ga0496104_0008113 Ga0496104_0008113_5217_5852 211
183 3300048907 Ga0496104_0012042 Ga0496104_0012042_4313_4966 211
184 3300048907 Ga0496104_0246141 Ga0496104_0246141_762_1412 211
185 3300048908 Ga0496105_0004890 Ga0496105_0004890_2063_2698 211
186 3300048908 Ga0496105_0122216 Ga0496105_0122216_36_686 211
187 3300048909 Ga0496106_0213372 Ga0496106_0213372_644_1354 211
188 3300048909 Ga0496106_0798853 Ga0496106_0798853_35_685 211
189 3300048910 Ga0496107_0019442 Ga0496107_0019442_1297_1947 211
190 3300048910 Ga0496107_0110207 Ga0496107_0110207_366_1076 211
191 3300048911 Ga0496108_0173309 Ga0496108_0173309_418_1053 211
192 3300048912 Ga0496109_0023626 Ga0496109_0023626_526_1161 211
193 3300048912 Ga0496109_0225761 Ga0496109_0225761_763_1398 211
194 3300048912 Ga0496109_0749527 Ga0496109_0749527_40_693 211
195 3300048913 Ga0496110_0019873 Ga0496110_0019873_72_722 211
196 3300048914 Ga0496111_0027548 Ga0496111_0027548_716_1366 211
197 3300048915 Ga0496112_0124681 Ga0496112_0124681_917_1552 211
198 3300048915 Ga0496112_0172270 Ga0496112_0172270_713_1363 211
199 3300048915 Ga0496112_0211252 Ga0496112_0211252_1176_1811 211
200 3300048916 Ga0496113_0000029 Ga0496113_0000029_41971_42606 211
201 3300048917 Ga0496114_0008003 Ga0496114_0008003_2104_2739 211
202 3300048917 Ga0496114_0015889 Ga0496114_0015889_2376_3026 211
203 3300049576 Ga0501040_0049097 Ga0501040_0049097_325_960 211
204 3300049589 Ga0501073_0317133 Ga0501073_0317133_293_928 211
205 3300053085 Ga0495619_0138743 Ga0495619_0138743_308_943 211
206 3300061719 Ga0466962_0147080 Ga0466962_0147080_39_674 211
207 3300005548 Ga0070665_100018937 Ga0070665_1000189378 212
208 3300005578 Ga0068854_100000031 Ga0068854_10000003188 212
209 3300005614 Ga0068856_100606233 Ga0068856_1006062331 212
210 3300005985 Ga0081539_10007823 Ga0081539_100078235 212
211 3300005985 Ga0081539_10053243 Ga0081539_100532432 212
212 3300006048 Ga0075363_100084730 Ga0075363_1000847302 212
213 3300006871 Ga0075434_100377850 Ga0075434_1003778503 212
214 3300009098 Ga0105245_10006569 Ga0105245_100065695 212
215 3300021377 Ga0213874_10010552 Ga0213874_100105522 212
216 3300021388 Ga0213875_10050881 Ga0213875_100508813 212
217 3300021388 Ga0213875_10145084 Ga0213875_101450842 212
218 3300025927 Ga0207687_10004769 Ga0207687_100047695 212
219 3300025928 Ga0207700_10429389 Ga0207700_104293891 212
220 3300026121 Ga0207683_10750886 Ga0207683_107508862 212
221 3300031548 Ga0307408_100235539 Ga0307408_1002355392 212
222 3300031901 Ga0307406_10087464 Ga0307406_100874642 212
223 3300031903 Ga0307407_10206958 Ga0307407_102069582 212
224 3300031995 Ga0307409_100151122 Ga0307409_1001511222 212
225 3300032002 Ga0307416_100498628 Ga0307416_1004986282 212
226 3300032004 Ga0307414_10902029 Ga0307414_109020292 212
227 3300032005 Ga0307411_10052930 Ga0307411_100529302 212
228 3300037853 Ga0436364_0133889 Ga0436364_0133889_479_1123 212
229 3300037853 Ga0436364_1363163 Ga0436364_1363163_1535_2179 212
230 3300039450 Ga0436363_1490049 Ga0436363_1490049_18_692 212
231 3300042016 Ga0439463_022604 Ga0439463_022604_487_1158 212
232 3300044842 Ga0466957_0175181 Ga0466957_0175181_484_1122 212
233 3300045836 Ga0466958_0061614 Ga0466958_0061614_734_1390 212
234 3300046454 Ga0495592_0241570 Ga0495592_0241570_328_972 212
235 3300046477 Ga0495664_0246372 Ga0495664_0246372_427_1071 212
236 3300046511 Ga0495608_0150897 Ga0495608_0150897_589_1233 212
237 3300046516 Ga0495628_0343967 Ga0495628_0343967_145_789 212
238 3300046517 Ga0495630_0446954 Ga0495630_0446954_149_793 212
239 3300046536 Ga0495587_0301669 Ga0495587_0301669_67_711 212
240 3300046543 Ga0495645_0258829 Ga0495645_0258829_269_913 212
241 3300046559 Ga0495667_0000032 Ga0495667_0000032_80660_81301 212
242 3300046663 Ga0495635_0025907 Ga0495635_0025907_1461_2105 212
243 3300046675 Ga0495657_0024567 Ga0495657_0024567_2547_3191 212
244 3300048907 Ga0496104_0623399 Ga0496104_0623399_263_916 212
245 3300048908 Ga0496105_0064085 Ga0496105_0064085_2143_2790 212
246 3300048910 Ga0496107_0359933 Ga0496107_0359933_25_666 212
247 3300048911 Ga0496108_0521875 Ga0496108_0521875_247_903 212
248 3300048913 Ga0496110_0051100 Ga0496110_0051100_2484_3137 212
249 3300048915 Ga0496112_0086278 Ga0496112_0086278_1853_2506 212
250 3300048915 Ga0496112_0854443 Ga0496112_0854443_152_790 212
251 3300048917 Ga0496114_0212722 Ga0496114_0212722_631_1272 212
252 3300050512 nmdc:mga0n895_316892_c1 nmdc:mga0n895_316892_c1_292_930 212
253 3300053084 Ga0495595_0011424 Ga0495595_0011424_1723_2367 212
254 3300005327 Ga0070658_10095594 Ga0070658_100955944 213
255 3300005329 Ga0070683_100013998 Ga0070683_1000139987 213
256 3300005329 Ga0070683_100142331 Ga0070683_1001423312 213
257 3300005331 Ga0070670_100664131 Ga0070670_1006641311 213
258 3300005336 Ga0070680_100280901 Ga0070680_1002809012 213
259 3300005337 Ga0070682_100553319 Ga0070682_1005533192 213
260 3300005339 Ga0070660_100149129 Ga0070660_1001491292 213
261 3300005344 Ga0070661_100000023 Ga0070661_100000023137 213
262 3300005345 Ga0070692_10042841 Ga0070692_100428414 213
263 3300005347 Ga0070668_100393426 Ga0070668_1003934262 213
264 3300005365 Ga0070688_100150199 Ga0070688_1001501992 213
265 3300005434 Ga0070709_10280220 Ga0070709_102802202 213
266 3300005435 Ga0070714_100179833 Ga0070714_1001798333 213
267 3300005436 Ga0070713_100037992 Ga0070713_1000379925 213
268 3300005456 Ga0070678_100016735 Ga0070678_1000167355 213
269 3300005615 Ga0070702_100298884 Ga0070702_1002988842 213
270 3300005834 Ga0068851_10138000 Ga0068851_101380002 213
271 3300005937 Ga0081455_10020961 Ga0081455_100209617 213
272 3300005981 Ga0081538_10001191 Ga0081538_1000119125 213
273 3300005981 Ga0081538_10001202 Ga0081538_1000120225 213
274 3300005981 Ga0081538_10032109 Ga0081538_100321094 213
275 3300005981 Ga0081538_10055473 Ga0081538_100554732 213
276 3300005981 Ga0081538_10202806 Ga0081538_102028061 213
277 3300005985 Ga0081539_10001929 Ga0081539_100019294 213
278 3300006881 Ga0068865_100000104 Ga0068865_10000010448 213
279 3300009011 Ga0105251_10154138 Ga0105251_101541382 213
280 3300009094 Ga0111539_10016568 Ga0111539_100165689 213
281 3300009094 Ga0111539_10253354 Ga0111539_102533543 213
282 3300009098 Ga0105245_10187290 Ga0105245_101872901 213
283 3300009101 Ga0105247_10196525 Ga0105247_101965252 213
284 3300009148 Ga0105243_10334601 Ga0105243_103346012 213
285 3300009148 Ga0105243_10927305 Ga0105243_109273052 213
286 3300011119 Ga0105246_10209426 Ga0105246_102094262 213
287 3300013104 Ga0157370_10014865 Ga0157370_100148655 213
288 3300013297 Ga0157378_10118892 Ga0157378_101188925 213
289 3300013308 Ga0157375_11079193 Ga0157375_110791931 213
290 3300014968 Ga0157379_10410888 Ga0157379_104108881 213
291 3300014968 Ga0157379_10491823 Ga0157379_104918232 213
292 3300025321 Ga0207656_10081265 Ga0207656_100812652 213
293 3300025893 Ga0207682_10000206 Ga0207682_1000020611 213
294 3300025900 Ga0207710_10120517 Ga0207710_101205172 213
295 3300025906 Ga0207699_10337901 Ga0207699_103379011 213
296 3300025908 Ga0207643_10259972 Ga0207643_102599722 213
297 3300025909 Ga0207705_10053434 Ga0207705_100534342 213
298 3300025912 Ga0207707_10323907 Ga0207707_103239072 213
299 3300025916 Ga0207663_10047675 Ga0207663_100476754 213
300 3300025920 Ga0207649_10000063 Ga0207649_10000063111 213
301 3300025925 Ga0207650_10024224 Ga0207650_100242245 213
302 3300025927 Ga0207687_10295695 Ga0207687_102956952 213
303 3300025929 Ga0207664_10522433 Ga0207664_105224332 213
304 3300025934 Ga0207686_10000428 Ga0207686_1000042824 213
305 3300025935 Ga0207709_10007009 Ga0207709_100070094 213
306 3300025935 Ga0207709_10293776 Ga0207709_102937762 213
307 3300025938 Ga0207704_10000146 Ga0207704_1000014635 213
308 3300025941 Ga0207711_10188376 Ga0207711_101883762 213
309 3300025944 Ga0207661_10115154 Ga0207661_101151543 213
310 3300025945 Ga0207679_10030423 Ga0207679_100304232 213
311 3300025961 Ga0207712_10261052 Ga0207712_102610522 213
312 3300025972 Ga0207668_10046966 Ga0207668_100469664 213
313 3300025972 Ga0207668_10383799 Ga0207668_103837992 213
314 3300026023 Ga0207677_10003161 Ga0207677_100031615 213
315 3300026075 Ga0207708_10017730 Ga0207708_100177306 213
316 3300026078 Ga0207702_10045314 Ga0207702_100453143 213
317 3300026095 Ga0207676_10000016 Ga0207676_10000016120 213
318 3300026121 Ga0207683_10008689 Ga0207683_100086896 213
319 3300027907 Ga0207428_10044690 Ga0207428_100446905 213
320 3300028558 Ga0265326_10057198 Ga0265326_100571982 213
321 3300028577 Ga0265318_10104258 Ga0265318_101042582 213
322 3300031251 Ga0265327_10014106 Ga0265327_100141062 213
323 3300031548 Ga0307408_100713184 Ga0307408_1007131841 213
324 3300031824 Ga0307413_10125859 Ga0307413_101258592 213
325 3300031824 Ga0307413_10127554 Ga0307413_101275542 213
326 3300031852 Ga0307410_10365872 Ga0307410_103658722 213
327 3300031852 Ga0307410_10492277 Ga0307410_104922772 213
328 3300031903 Ga0307407_10121472 Ga0307407_101214721 213
329 3300031903 Ga0307407_10336621 Ga0307407_103366212 213
330 3300031995 Ga0307409_100359785 Ga0307409_1003597851 213
331 3300032002 Ga0307416_100455771 Ga0307416_1004557711 213
332 3300032002 Ga0307416_100931852 Ga0307416_1009318522 213
333 3300032005 Ga0307411_10171132 Ga0307411_101711322 213
334 3300037312 Ga0395899_0380628 Ga0395899_0380628_134_775 213
335 3300038443 Ga0395901_0192414 Ga0395901_0192414_1265_1912 213
336 3300038443 Ga0395901_0302600 Ga0395901_0302600_943_1584 213
337 3300044684 Ga0466966_0061528 Ga0466966_0061528_902_1552 213
338 3300044693 Ga0466961_0027646 Ga0466961_0027646_1664_2314 213
339 3300044693 Ga0466961_0095071 Ga0466961_0095071_315_968 213
340 3300044694 Ga0466963_0059215 Ga0466963_0059215_986_1636 213
341 3300044719 Ga0466971_0007381 Ga0466971_0007381_2607_3257 213
342 3300044719 Ga0466971_0091283 Ga0466971_0091283_15_668 213
343 3300044765 Ga0466970_0017235 Ga0466970_0017235_215_868 213
344 3300044765 Ga0466970_0077499 Ga0466970_0077499_1077_1742 213
345 3300044901 Ga0466960_0325393 Ga0466960_0325393_19_684 213
346 3300045049 Ga0466959_0044449 Ga0466959_0044449_1018_1668 213
347 3300045049 Ga0466959_0192476 Ga0466959_0192476_633_1289 213
348 3300045049 Ga0466959_0672795 Ga0466959_0672795_23_679 213
349 3300045836 Ga0466958_0030473 Ga0466958_0030473_1604_2254 213
350 3300045836 Ga0466958_0135783 Ga0466958_0135783_663_1316 213
351 3300045976 Ga0466967_0000027 Ga0466967_0000027_23388_24047 213
352 3300045976 Ga0466967_0141803 Ga0466967_0141803_1068_1724 213
353 3300046461 Ga0495641_0000003 Ga0495641_0000003_222536_223186 213
354 3300046476 Ga0495662_0034097 Ga0495662_0034097_620_1264 213
355 3300046499 Ga0495594_0000003 Ga0495594_0000003_72989_73630 213
356 3300046511 Ga0495608_0000031 Ga0495608_0000031_139367_140020 213
357 3300046516 Ga0495628_0077274 Ga0495628_0077274_223_870 213
358 3300046517 Ga0495630_0000018 Ga0495630_0000018_134937_135578 213
359 3300046517 Ga0495630_0233510 Ga0495630_0233510_214_864 213
360 3300046522 Ga0495643_0071250 Ga0495643_0071250_429_1070 213
361 3300046557 Ga0495622_0000714 Ga0495622_0000714_12825_13466 213
362 3300046660 Ga0495625_0000122 Ga0495625_0000122_10080_10721 213
363 3300046663 Ga0495635_0448877 Ga0495635_0448877_175_822 213
364 3300046674 Ga0495588_0000274 Ga0495588_0000274_32038_32679 213
365 3300046681 Ga0495647_0002735 Ga0495647_0002735_278_919 213
366 3300046683 Ga0495658_0026207 Ga0495658_0026207_2450_3094 213
367 3300046689 Ga0495613_0000073 Ga0495613_0000073_9079_9732 213
368 3300046809 Ga0495600_0049434 Ga0495600_0049434_1112_1759 213
369 3300046809 Ga0495600_0142030 Ga0495600_0142030_294_947 213
370 3300047320 Ga0495672_0025027 Ga0495672_0025027_2337_3011 213
371 3300047320 Ga0495672_0106218 Ga0495672_0106218_49_690 213
372 3300047321 Ga0495676_0029294 Ga0495676_0029294_502_1146 213
373 3300047321 Ga0495676_0120837 Ga0495676_0120837_477_1118 213
374 3300047673 Ga0495593_0018248 Ga0495593_0018248_2651_3295 213
375 3300048088 Ga0495602_0000021 Ga0495602_0000021_116806_117459 213
376 3300048905 Ga0496102_0179676 Ga0496102_0179676_845_1507 213
377 3300048907 Ga0496104_0259592 Ga0496104_0259592_975_1637 213
378 3300048909 Ga0496106_0000049 Ga0496106_0000049_10380_11024 213
379 3300048909 Ga0496106_0037841 Ga0496106_0037841_941_1603 213
380 3300048909 Ga0496106_0197685 Ga0496106_0197685_75_740 213
381 3300048910 Ga0496107_0034407 Ga0496107_0034407_821_1465 213
382 3300048911 Ga0496108_0086420 Ga0496108_0086420_1531_2193 213
383 3300048911 Ga0496108_0189507 Ga0496108_0189507_361_1002 213
384 3300048912 Ga0496109_0000028 Ga0496109_0000028_31766_32407 213
385 3300048912 Ga0496109_0020362 Ga0496109_0020362_3841_4503 213
386 3300048914 Ga0496111_0102963 Ga0496111_0102963_73_735 213
387 3300048915 Ga0496112_0241630 Ga0496112_0241630_144_806 213
388 3300048916 Ga0496113_0006564 Ga0496113_0006564_3854_4516 213
389 3300048917 Ga0496114_0078009 Ga0496114_0078009_2064_2726 213
390 3300048917 Ga0496114_0543299 Ga0496114_0543299_243_905 213
391 3300048918 Ga0496115_0000035 Ga0496115_0000035_44645_45286 213
392 3300048918 Ga0496115_0118299 Ga0496115_0118299_1003_1659 213
393 3300048927 Ga0496124_0337286 Ga0496124_0337286_309_974 213
394 3300048929 Ga0496126_0041755 Ga0496126_0041755_3046_3702 213
395 3300049568 Ga0501031_0061238 Ga0501031_0061238_385_1059 213
396 3300049572 Ga0501036_0111116 Ga0501036_0111116_38_712 213
397 3300049576 Ga0501040_0749599 Ga0501040_0749599_16_690 213
398 3300049577 Ga0501041_0242213 Ga0501041_0242213_439_1113 213
399 3300049580 Ga0501046_0254038 Ga0501046_0254038_40_714 213
400 3300049582 Ga0501048_0049547 Ga0501048_0049547_834_1508 213
401 3300049585 Ga0501069_0218411 Ga0501069_0218411_324_998 213
402 3300049586 Ga0501070_0200633 Ga0501070_0200633_225_884 213
403 3300049591 Ga0501075_0016585 Ga0501075_0016585_3054_3728 213
404 3300049592 Ga0501076_0039402 Ga0501076_0039402_1415_2089 213
405 3300049741 Ga0501079_0263159 Ga0501079_0263159_360_1034 213
406 3300049743 Ga0501081_0034569 Ga0501081_0034569_1608_2282 213
407 3300049822 Ga0501035_0584879 Ga0501035_0584879_98_772 213
408 3300050511 nmdc:mga08y16_139351_c1 nmdc:mga08y16_139351_c1_1290_1940 213
409 3300050515 nmdc:mga0a205_238558_c1 nmdc:mga0a205_238558_c1_216_860 213
410 3300053077 Ga0495601_0000375 Ga0495601_0000375_22015_22665 213
411 3300053077 Ga0495601_0609402 Ga0495601_0609402_21_665 213
412 3300053078 Ga0495612_0000068 Ga0495612_0000068_7745_8392 213
413 3300053078 Ga0495612_0126894 Ga0495612_0126894_303_947 213
414 3300053083 Ga0495655_0001262 Ga0495655_0001262_1460_2113 213
415 3300053085 Ga0495619_0283787 Ga0495619_0283787_205_852 213
416 3300054114 Ga0501084_0137769 Ga0501084_0137769_61_735 213
417 3300060353 Ga0501082_0117843 Ga0501082_0117843_934_1608 213
418 3300060353 Ga0501082_0484312 Ga0501082_0484312_294_947 213
419 3300061719 Ga0466962_0054611 Ga0466962_0054611_1059_1709 213
420 3300061734 Ga0530510_0070882 Ga0530510_0070882_1038_1712 213
421 3300061734 Ga0530510_0641826 Ga0530510_0641826_112_777 213
422 3300001977 JGI24746J21847_1000108 JGI24746J21847_10001082 214
423 3300005435 Ga0070714_100791190 Ga0070714_1007911901 214
424 3300005437 Ga0070710_10225129 Ga0070710_102251292 214
425 3300036401 Ga0373937_0389527 Ga0373937_0389527_238_882 214
426 3300037466 Ga0395898_0429603 Ga0395898_0429603_423_1091 214
427 3300037853 Ga0436364_0447959 Ga0436364_0447959_2520_3179 214
428 3300039437 Ga0436365_1490741 Ga0436365_1490741_1072_1719 214
429 3300046461 Ga0495641_0030683 Ga0495641_0030683_1555_2199 214
430 3300046516 Ga0495628_0374656 Ga0495628_0374656_309_962 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

35

235

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9016 4 211
3b5e-assembly1.cif.gz_A crystal structure of carboxylesterase (np_108484.1) from mesorhizobium loti at 1.75 a resolution 0.8951 3 214
3cn7-assembly3.cif.gz_C crystal structure analysis of the carboxylesterase pa3859 from pseudomonas aeruginosa pao1- monoclinic crystal form 0.8929 6 211
1aur-assembly1.cif.gz_B pmsf-inhibited carboxylesterase from pseudomonas fluorescens 0.8879 6 213
5syn-assembly3.cif.gz_C cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349 0.8825 4 214
ID Description Score Start End Superfamily
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.903 6 211 3.40.50.1820
af_Q54T49_3_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8932 6 214 3.40.50.1820
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8858 6 211 3.40.50.1820
af_Q2FVA9_1_197_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8797 4 209 3.40.50.1820
3cn7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8786 6 211 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5B8U315-F1-model_v4 Phospholipase 0.9951 1 214 GO:0016787
AF-A0A7W0ZGU6-F1-model_v4 Phospholipase 0.9919 1 211 GO:0016787
AF-A0A7W0YUG2-F1-model_v4 Phospholipase 0.9907 1 143 GO:0016787
AF-A0A537XGH6-F1-model_v4 Phospholipase 0.9869 2 213 GO:0016787
AF-A0A7W0YUG2-F1-model_v4 Phospholipase 0.9838 1 143 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.58 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map