F442079

General Info

Members Datasets Scaffolds Average Seq Length
430 250 860 247

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100170798|Ga0070675_1001707982
Length 278
Sequence MPTSEPNISDKLKPVTYHVQPMSLLEVTALEAGYDDAIVLRGVSLEADAHEIVAVLGPNGAGKSTLLKAVYGLVTLRAGTVTWEGGDVTRVRADRLTRRGLNFVPQTANVFPTLTVAENVHVGSLVVTKTERRAAIERVRELFPILRERAGQRAGTLSGGQRKLVALARALVAKPKLLLLDEPSAGLSPQAMELVFDKLLEINRLGVGIVMVEQNARRALALAHRGYVLDAGRNAIEGAGAELLHDPQVEQLYLGGSGMIASSSTSTSTPSGMKPETK

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
243 2831426010 Nostoc sp. 106C Isolate Unclassified
244 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
245 2849660919 Nostoc sp. T09 Isolate Unclassified
246 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
247 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
248 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
249 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
250 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 7.91
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100170798 3300005354 Bacteria 1875
2 JGI25406J46586_10004561 3300003203 Bacteria 6448
3 Ga0070658_10022885 3300005327 Bacteria 5015
4 Ga0070658_10046924 3300005327 Bacteria 3495
5 Ga0070658_10230815 3300005327 Bacteria 1567
6 Ga0070676_10052295 3300005328 Bacteria 2401
7 Ga0070676_10435857 3300005328 Bacteria 919
8 Ga0070683_100020104 3300005329 Bacteria 5938
9 Ga0070683_100074732 3300005329 Bacteria 3165
10 Ga0070683_100162827 3300005329 Bacteria 2117
11 Ga0070683_100180776 3300005329 Bacteria 2002
12 Ga0070683_100375659 3300005329 Bacteria 1354
13 Ga0070677_10086066 3300005333 Bacteria 1357
14 Ga0068869_100055643 3300005334 Bacteria 2884
15 Ga0070666_10406810 3300005335 Bacteria 979
16 Ga0070680_100408824 3300005336 Bacteria 1157
17 Ga0070682_100002932 3300005337 Bacteria 9463
18 Ga0070682_100022280 3300005337 Bacteria 3751
19 Ga0070682_100066804 3300005337 Bacteria 2289
20 Ga0070682_100352021 3300005337 Bacteria 1098
21 Ga0068868_100007892 3300005338 Bacteria 7602
22 Ga0070660_100003432 3300005339 Bacteria 10902
23 Ga0070660_100413283 3300005339 Bacteria 1116
24 Ga0070691_10020559 3300005341 Bacteria 3050
25 Ga0070691_10118296 3300005341 Bacteria 1332
26 Ga0070687_100025063 3300005343 Bacteria 2856
27 Ga0070661_100003620 3300005344 Bacteria 10633
28 Ga0070661_100004729 3300005344 Bacteria 9370
29 Ga0070661_100326443 3300005344 Bacteria 1199
30 Ga0070692_10030150 3300005345 Bacteria 2710
31 Ga0070675_100072127 3300005354 Bacteria 2866
32 Ga0070675_100251041 3300005354 Bacteria 1548
33 Ga0070675_100325448 3300005354 Bacteria 1358
34 Ga0070671_100006558 3300005355 Bacteria 9304
35 Ga0070671_100109598 3300005355 Bacteria 2319
36 Ga0070674_100021733 3300005356 Bacteria 4126
37 Ga0070674_100034609 3300005356 Bacteria 3375
38 Ga0070673_100003850 3300005364 Bacteria 9420
39 Ga0070673_100229083 3300005364 Bacteria 1611
40 Ga0070659_100028322 3300005366 Bacteria 4325
41 Ga0070659_100038063 3300005366 Bacteria 3750
42 Ga0070714_100276153 3300005435 Bacteria 1560
43 Ga0070713_100179614 3300005436 Bacteria 1901
44 Ga0070701_10007734 3300005438 Bacteria 4611
45 Ga0070705_100346334 3300005440 Bacteria 1082
46 Ga0070700_100054960 3300005441 Bacteria 2490
47 Ga0070694_100146982 3300005444 Bacteria 1718
48 Ga0070708_100016800 3300005445 Bacteria 6084
49 Ga0070708_100047690 3300005445 Bacteria 3785
50 Ga0070663_100076116 3300005455 Bacteria 2454
51 Ga0070678_100051384 3300005456 Bacteria 2988
52 Ga0070678_100062130 3300005456 Bacteria 2757
53 Ga0070681_10001459 3300005458 Bacteria 20855
54 Ga0070681_10071159 3300005458 Bacteria 3443
55 Ga0070681_10160395 3300005458 Bacteria 2173
56 Ga0068867_100124293 3300005459 Bacteria 1997
57 Ga0070685_10001010 3300005466 Bacteria 15122
58 Ga0070706_100013884 3300005467 Bacteria 7446
59 Ga0070707_100109817 3300005468 Bacteria 2675
60 Ga0070698_100391418 3300005471 Bacteria 1323
61 Ga0070679_100217605 3300005530 Bacteria 1872
62 Ga0070679_100314164 3300005530 Bacteria 1516
63 Ga0070679_100466594 3300005530 Bacteria 1207
64 Ga0070684_100003605 3300005535 Bacteria 11649
65 Ga0070684_100037489 3300005535 Bacteria 4158
66 Ga0070684_100116172 3300005535 Bacteria 2403
67 Ga0070697_100228464 3300005536 Bacteria 1587
68 Ga0068853_100002193 3300005539 Bacteria 14566
69 Ga0068853_100048576 3300005539 Bacteria 3646
70 Ga0070672_100048647 3300005543 Bacteria 3296
71 Ga0070686_100028572 3300005544 Bacteria 3383
72 Ga0070686_100099854 3300005544 Bacteria 1958
73 Ga0070696_100004440 3300005546 Bacteria 9361
74 Ga0070696_100422799 3300005546 Bacteria 1046
75 Ga0070693_100031249 3300005547 Bacteria 2917
76 Ga0070665_100243275 3300005548 Bacteria 1800
77 Ga0070704_100267187 3300005549 Bacteria 1411
78 Ga0068855_100027960 3300005563 Bacteria 6745
79 Ga0070664_100002989 3300005564 Bacteria 13683
80 Ga0070664_100028119 3300005564 Bacteria 4676
81 Ga0070664_100070970 3300005564 Bacteria 2984
82 Ga0068857_100111898 3300005577 Bacteria 2455
83 Ga0068854_100004184 3300005578 Bacteria 9081
84 Ga0068856_100142977 3300005614 Bacteria 2400
85 Ga0068856_100198695 3300005614 Bacteria 2020
86 Ga0070702_100037440 3300005615 Bacteria 2695
87 Ga0070702_100068633 3300005615 Bacteria 2087
88 Ga0070702_100292897 3300005615 Bacteria 1122
89 Ga0068861_100060483 3300005719 Bacteria 2903
90 Ga0068851_10005615 3300005834 Bacteria 5695
91 Ga0068870_10133469 3300005840 Bacteria 1445
92 Ga0068858_100008432 3300005842 Bacteria 9908
93 Ga0068860_100043427 3300005843 Bacteria 4289
94 Ga0068862_100153632 3300005844 Bacteria 2050
95 Ga0081455_10028932 3300005937 Bacteria 5058
96 Ga0081455_10324736 3300005937 Bacteria 1095
97 Ga0081539_10002592 3300005985 Bacteria 24830
98 Ga0075365_10016710 3300006038 Bacteria 4471
99 Ga0075432_10013685 3300006058 Bacteria 2758
100 Ga0075428_100058050 3300006844 Bacteria 4237
101 Ga0075428_100284468 3300006844 Bacteria 1779
102 Ga0075434_100125996 3300006871 Bacteria 2578
103 Ga0068865_100013242 3300006881 Bacteria 5209
104 Ga0075435_100025902 3300007076 Bacteria 4570
105 Ga0099794_10117453 3300007265 Bacteria 1336
106 Ga0111539_10238894 3300009094 Bacteria 2115
107 Ga0111539_10814820 3300009094 Bacteria 1086
108 Ga0105245_10080649 3300009098 Bacteria 2973
109 Ga0105245_10347543 3300009098 Bacteria 1468
110 Ga0105247_10441706 3300009101 Bacteria 936
111 Ga0114129_10019181 3300009147 Bacteria 9743
112 Ga0105243_10003264 3300009148 Bacteria 13206
113 Ga0105243_10050282 3300009148 Bacteria 3292
114 Ga0105243_10054798 3300009148 Bacteria 3166
115 Ga0105243_10198082 3300009148 Bacteria 1759
116 Ga0105241_10086648 3300009174 Bacteria 2463
117 Ga0105242_10016578 3300009176 Bacteria 5729
118 Ga0105242_10067362 3300009176 Bacteria 2960
119 Ga0105242_10182459 3300009176 Bacteria 1852
120 Ga0105242_10290083 3300009176 Bacteria 1489
121 Ga0105248_10017376 3300009177 Bacteria 7929
122 Ga0105248_10394642 3300009177 Bacteria 1558
123 Ga0105237_10663742 3300009545 Bacteria 1049
124 Ga0105238_10034708 3300009551 Bacteria 5132
125 Ga0105249_10038281 3300009553 Bacteria 4351
126 Ga0105239_10021338 3300010375 Bacteria 7142
127 Ga0105239_10026048 3300010375 Bacteria 6438
128 Ga0105239_10226078 3300010375 Bacteria 2099
129 Ga0105239_10253128 3300010375 Bacteria 1978
130 Ga0105239_10436163 3300010375 Bacteria 1485
131 Ga0105246_10090519 3300011119 Bacteria 2203
132 Ga0105246_10153345 3300011119 Bacteria 1746
133 Ga0105246_10178180 3300011119 Bacteria 1634
134 Ga0105246_10432111 3300011119 Bacteria 1102
135 Ga0157373_10363791 3300013100 Bacteria 1033
136 Ga0157371_10006274 3300013102 Bacteria 9845
137 Ga0157371_10086613 3300013102 Bacteria 2218
138 Ga0157371_10144825 3300013102 Bacteria 1693
139 Ga0157369_10115449 3300013105 Bacteria 2851
140 Ga0157378_10017365 3300013297 Bacteria 6314
141 Ga0163162_10330171 3300013306 Bacteria 1657
142 Ga0163162_10340757 3300013306 Bacteria 1631
143 Ga0157372_10006258 3300013307 Bacteria 12661
144 Ga0157372_10011292 3300013307 Bacteria 9502
145 Ga0157372_10176632 3300013307 Bacteria 2472
146 Ga0157375_10010535 3300013308 Bacteria 8139
147 Ga0157375_10209620 3300013308 Bacteria 2106
148 Ga0157375_10387976 3300013308 Bacteria 1563
149 Ga0157375_11100368 3300013308 Bacteria 930
150 Ga0163163_10211808 3300014325 Bacteria 1987
151 Ga0157380_10290264 3300014326 Bacteria 1501
152 Ga0157380_10415214 3300014326 Bacteria 1282
153 Ga0182008_10002426 3300014497 Bacteria 11696
154 Ga0182008_10041328 3300014497 Bacteria 2300
155 Ga0157377_10009537 3300014745 Bacteria 4768
156 Ga0157377_10060343 3300014745 Bacteria 2164
157 Ga0157377_10208764 3300014745 Bacteria 1244
158 Ga0157377_10210736 3300014745 Bacteria 1239
159 Ga0157379_10054653 3300014968 Bacteria 3568
160 Ga0182007_10004050 3300015262 Bacteria 6746
161 Ga0213873_10062919 3300021358 Bacteria 1008
162 Ga0213872_10072173 3300021361 Bacteria 1555
163 Ga0213871_10007875 3300021441 Bacteria 2324
164 Ga0207682_10059103 3300025893 Bacteria 1601
165 Ga0207688_10012487 3300025901 Bacteria 4623
166 Ga0207688_10020016 3300025901 Bacteria 3651
167 Ga0207647_10070822 3300025904 Bacteria 2105
168 Ga0207645_10029446 3300025907 Bacteria 3540
169 Ga0207645_10068843 3300025907 Bacteria 2264
170 Ga0207643_10009997 3300025908 Bacteria 5100
171 Ga0207705_10016492 3300025909 Bacteria 5292
172 Ga0207705_10129398 3300025909 Bacteria 1878
173 Ga0207705_10204598 3300025909 Bacteria 1496
174 Ga0207684_10025774 3300025910 Bacteria 5011
175 Ga0207707_10025744 3300025912 Bacteria 5146
176 Ga0207707_10133301 3300025912 Bacteria 2173
177 Ga0207693_10091212 3300025915 Bacteria 2389
178 Ga0207663_10118365 3300025916 Bacteria 1809
179 Ga0207660_10156747 3300025917 Bacteria 1753
180 Ga0207660_10247383 3300025917 Bacteria 1406
181 Ga0207662_10039484 3300025918 Bacteria 2770
182 Ga0207657_10001651 3300025919 Bacteria 24065
183 Ga0207657_10028490 3300025919 Bacteria 5094
184 Ga0207657_10495912 3300025919 Bacteria 957
185 Ga0207649_10011194 3300025920 Bacteria 4940
186 Ga0207649_10011280 3300025920 Bacteria 4924
187 Ga0207649_10146836 3300025920 Bacteria 1619
188 Ga0207652_10020547 3300025921 Bacteria 5440
189 Ga0207652_10096987 3300025921 Bacteria 2598
190 Ga0207652_10855315 3300025921 Bacteria 805
191 Ga0207646_10091317 3300025922 Bacteria 2726
192 Ga0207646_10623147 3300025922 Bacteria 967
193 Ga0207681_10351995 3300025923 Bacteria 1179
194 Ga0207694_10321442 3300025924 Bacteria 1277
195 Ga0207659_10030869 3300025926 Bacteria 3664
196 Ga0207659_10227343 3300025926 Bacteria 1503
197 Ga0207659_10285947 3300025926 Bacteria 1350
198 Ga0207687_10013964 3300025927 Bacteria 5250
199 Ga0207687_10109383 3300025927 Bacteria 2048
200 Ga0207664_10119917 3300025929 Bacteria 2200
201 Ga0207690_10019661 3300025932 Bacteria 4162
202 Ga0207690_10168375 3300025932 Bacteria 1639
203 Ga0207706_10002051 3300025933 Bacteria 19764
204 Ga0207706_10023074 3300025933 Bacteria 5588
205 Ga0207686_10108389 3300025934 Bacteria 1868
206 Ga0207709_10035151 3300025935 Bacteria 2960
207 Ga0207709_10040962 3300025935 Bacteria 2777
208 Ga0207709_10200235 3300025935 Bacteria 1426
209 Ga0207669_10019547 3300025937 Bacteria 3530
210 Ga0207669_10028763 3300025937 Bacteria 3063
211 Ga0207704_10024568 3300025938 Bacteria 3271
212 Ga0207704_10488254 3300025938 Bacteria 990
213 Ga0207665_10361005 3300025939 Bacteria 1098
214 Ga0207691_10007227 3300025940 Bacteria 10712
215 Ga0207691_10009508 3300025940 Bacteria 9335
216 Ga0207689_10010283 3300025942 Bacteria 8059
217 Ga0207689_10049508 3300025942 Bacteria 3466
218 Ga0207661_10001092 3300025944 Bacteria 18016
219 Ga0207679_10076701 3300025945 Bacteria 2540
220 Ga0207679_10097291 3300025945 Bacteria 2292
221 Ga0207651_10006150 3300025960 Bacteria 6245
222 Ga0207712_10458993 3300025961 Bacteria 1082
223 Ga0207640_10003734 3300025981 Bacteria 8213
224 Ga0207677_10250092 3300026023 Bacteria 1439
225 Ga0207678_10012470 3300026067 Bacteria 7465
226 Ga0207708_10024495 3300026075 Bacteria 4565
227 Ga0207708_10222400 3300026075 Bacteria 1513
228 Ga0207702_10032699 3300026078 Bacteria 4340
229 Ga0207702_10079607 3300026078 Bacteria 2841
230 Ga0207648_10018488 3300026089 Bacteria 6308
231 Ga0207648_10038324 3300026089 Bacteria 4218
232 Ga0207648_10059366 3300026089 Bacteria 3336
233 Ga0207674_10063111 3300026116 Bacteria 3740
234 Ga0207675_100009439 3300026118 Bacteria 9130
235 Ga0207675_100039979 3300026118 Bacteria 4376
236 Ga0207675_100476268 3300026118 Bacteria 1240
237 Ga0207683_10070593 3300026121 Bacteria 3086
238 Ga0207683_10094254 3300026121 Bacteria 2668
239 Ga0207698_10169711 3300026142 Bacteria 1919
240 Ga0207698_10920444 3300026142 Bacteria 882
241 Ga0207428_10126517 3300027907 Bacteria 1957
242 Ga0268266_10361905 3300028379 Bacteria 1365
243 Ga0268265_10168947 3300028380 Bacteria 1867
244 Ga0268264_10229902 3300028381 Bacteria 1712
245 Ga0307410_10109680 3300031852 Bacteria 1995
246 Ga0307416_100655816 3300032002 Bacteria 1135
247 Ga0373958_0009136 3300034819 Bacteria 1625
248 Ga0373939_0015690 3300035114 Bacteria 1987
249 Ga0373962_0005377 3300035242 Bacteria 3101
250 Ga0395899_0015530 3300037312 Bacteria 5806
251 Ga0395900_0101860 3300037418 Bacteria 2949
252 Ga0395900_0359232 3300037418 Bacteria 1428
253 Ga0395898_0116433 3300037466 Bacteria 2561
254 Ga0395905_0034676 3300037471 Bacteria 4739
255 Ga0436364_0878568 3300037853 Bacteria 7043
256 Ga0436364_1404476 3300037853 Bacteria 1107
257 Ga0395901_0009206 3300038443 Bacteria 10003
258 Ga0395901_0168087 3300038443 Bacteria 2302
259 Ga0395901_0498206 3300038443 Bacteria 1240
260 Ga0395901_0637149 3300038443 Bacteria 1071
261 Ga0237819_05088 3300038705 Bacteria 2091
262 Ga0436360_1160202 3300039438 Bacteria 10261
263 Ga0436361_0369314 3300039447 Bacteria 4670
264 Ga0436362_0189399 3300039453 Bacteria 6814
265 Ga0439438_016524 3300041405 Bacteria 2145
266 Ga0439449_0009570 3300042007 Bacteria 3669
267 Ga0453683_0040529 3300044673 Bacteria 2924
268 Ga0453683_0075734 3300044673 Bacteria 2106
269 Ga0453683_0148495 3300044673 Bacteria 1481
270 Ga0466966_0008171 3300044684 Bacteria 6936
271 Ga0466966_0057698 3300044684 Bacteria 2454
272 Ga0466963_0000258 3300044694 Bacteria 23286
273 Ga0466964_0036159 3300044706 Bacteria 1979
274 Ga0453684_0006277 3300044712 Bacteria 22751
275 Ga0453684_0255075 3300044712 Bacteria 2012
276 Ga0466968_0006100 3300044735 Bacteria 4527
277 Ga0466959_0008144 3300045049 Bacteria 7393
278 Ga0466959_0132336 3300045049 Bacteria 1767
279 Ga0451576_0014599 3300045051 Bacteria 8731
280 Ga0466958_0054570 3300045836 Bacteria 2424
281 Ga0466967_0000153 3300045976 Bacteria 27291
282 Ga0466967_0014433 3300045976 Bacteria 6154
283 Ga0466967_0047660 3300045976 Bacteria 3736
284 Ga0466967_0097998 3300045976 Bacteria 2676
285 Ga0466967_0109458 3300045976 Bacteria 2536
286 Ga0466967_0176712 3300045976 Bacteria 2011
287 Ga0466967_0363288 3300045976 Bacteria 1403
288 Ga0466967_0451246 3300045976 Bacteria 1257
289 Ga0466967_0711162 3300045976 Bacteria 995
290 Ga0466967_0727243 3300045976 Bacteria 984
291 Ga0495592_0132328 3300046454 Bacteria 1744
292 Ga0495641_0124173 3300046461 Bacteria 1152
293 Ga0495651_0025565 3300046462 Bacteria 4597
294 Ga0495651_0282824 3300046462 Bacteria 1120
295 Ga0495653_0010552 3300046463 Bacteria 7565
296 Ga0495605_0092170 3300046474 Bacteria 1403
297 Ga0495608_0111235 3300046511 Bacteria 1761
298 Ga0495628_0143173 3300046516 Bacteria 1824
299 Ga0495628_0259823 3300046516 Bacteria 1294
300 Ga0495630_0005626 3300046517 Bacteria 8854
301 Ga0495630_0119363 3300046517 Bacteria 2000
302 Ga0495652_0124087 3300046529 Bacteria 2055
303 Ga0495586_0039898 3300046535 Bacteria 2525
304 Ga0495667_0038925 3300046559 Bacteria 3166
305 Ga0495667_0145909 3300046559 Bacteria 1524
306 Ga0495635_0114074 3300046663 Bacteria 1844
307 Ga0495657_0054705 3300046675 Bacteria 2665
308 Ga0495657_0111468 3300046675 Bacteria 1733
309 Ga0495613_0031378 3300046689 Bacteria 3947
310 Ga0495604_0119683 3300047317 Bacteria 1908
311 Ga0495674_0013806 3300047319 Bacteria 7580
312 Ga0495674_0020876 3300047319 Bacteria 6064
313 Ga0495674_0071813 3300047319 Bacteria 2987
314 Ga0495672_0004502 3300047320 Bacteria 11384
315 Ga0495680_0037697 3300047322 Bacteria 3871
316 Ga0495680_0048971 3300047322 Bacteria 3314
317 Ga0495680_0196338 3300047322 Bacteria 1450
318 Ga0495684_0013625 3300047471 Bacteria 6261
319 Ga0495684_0030693 3300047471 Bacteria 4127
320 Ga0496100_0058284 3300048903 Bacteria 2534
321 Ga0496100_0100216 3300048903 Bacteria 1995
322 Ga0496100_0663348 3300048903 Bacteria 813
323 Ga0496101_0019250 3300048904 Bacteria 4659
324 Ga0496101_0224521 3300048904 Bacteria 1458
325 Ga0496101_0306132 3300048904 Bacteria 1245
326 Ga0496102_0054509 3300048905 Bacteria 3646
327 Ga0496102_0310970 3300048905 Bacteria 1485
328 Ga0496103_0130972 3300048906 Bacteria 1602
329 Ga0496105_0061340 3300048908 Bacteria 3103
330 Ga0496105_0242891 3300048908 Bacteria 1461
331 Ga0496106_0097573 3300048909 Bacteria 2275
332 Ga0496106_0136894 3300048909 Bacteria 1924
333 Ga0496106_0240585 3300048909 Bacteria 1446
334 Ga0496107_0195519 3300048910 Bacteria 1503
335 Ga0496108_0058810 3300048911 Bacteria 3231
336 Ga0496108_0094150 3300048911 Bacteria 2549
337 Ga0496109_0013525 3300048912 Bacteria 7083
338 Ga0496109_0115985 3300048912 Bacteria 2492
339 Ga0496109_0218069 3300048912 Bacteria 1794
340 Ga0496109_0345953 3300048912 Bacteria 1404
341 Ga0496110_0011856 3300048913 Bacteria 7158
342 Ga0496110_0032513 3300048913 Bacteria 4506
343 Ga0496110_0115081 3300048913 Bacteria 2420
344 Ga0496111_0007961 3300048914 Bacteria 6989
345 Ga0496111_0025193 3300048914 Bacteria 4196
346 Ga0496111_0064007 3300048914 Bacteria 2667
347 Ga0496111_0119079 3300048914 Bacteria 1950
348 Ga0496112_0003938 3300048915 Bacteria 12433
349 Ga0496112_0125541 3300048915 Bacteria 2537
350 Ga0496112_0263187 3300048915 Bacteria 1674
351 Ga0496112_0647934 3300048915 Bacteria 986
352 Ga0496113_0085117 3300048916 Bacteria 2428
353 Ga0496114_0128955 3300048917 Bacteria 2182
354 Ga0501031_0055042 3300049568 Bacteria 2592
355 Ga0501037_0096956 3300049573 Bacteria 2131
356 Ga0501037_0159064 3300049573 Bacteria 1611
357 Ga0501037_0185859 3300049573 Bacteria 1473
358 Ga0501038_0017274 3300049574 Bacteria 6522
359 Ga0501040_0010342 3300049576 Bacteria 6101
360 Ga0501040_0579539 3300049576 Bacteria 810
361 Ga0501041_0210178 3300049577 Bacteria 1220
362 Ga0501042_0109053 3300049578 Bacteria 1993
363 Ga0501042_0147141 3300049578 Bacteria 1698
364 Ga0501043_0034105 3300049579 Bacteria 4004
365 Ga0501046_0051241 3300049580 Bacteria 3258
366 Ga0501046_0061404 3300049580 Bacteria 2938
367 Ga0501047_0127478 3300049581 Bacteria 2425
368 Ga0501048_0008114 3300049582 Bacteria 7946
369 Ga0501048_0064516 3300049582 Bacteria 2590
370 Ga0501067_0012959 3300049583 Bacteria 4615
371 Ga0501067_0023551 3300049583 Bacteria 3413
372 Ga0501067_0072536 3300049583 Bacteria 1907
373 Ga0501068_0011138 3300049584 Bacteria 5067
374 Ga0501068_0035080 3300049584 Bacteria 2993
375 Ga0501069_0137684 3300049585 Bacteria 1400
376 Ga0501070_0039207 3300049586 Bacteria 3952
377 Ga0501070_0053205 3300049586 Bacteria 3359
378 Ga0501071_0000475 3300049587 Bacteria 20283
379 Ga0501071_0009441 3300049587 Bacteria 6497
380 Ga0501071_0020321 3300049587 Bacteria 4613
381 Ga0501071_0456644 3300049587 Bacteria 978
382 Ga0501072_0002272 3300049588 Bacteria 14360
383 Ga0501072_0038604 3300049588 Bacteria 3747
384 Ga0501072_0153181 3300049588 Bacteria 1838
385 Ga0501072_0329287 3300049588 Bacteria 1213
386 Ga0501073_0147390 3300049589 Bacteria 1631
387 Ga0501074_0011913 3300049590 Bacteria 6323
388 Ga0501074_0013879 3300049590 Bacteria 5856
389 Ga0501075_0011435 3300049591 Bacteria 6282
390 Ga0501075_0081126 3300049591 Bacteria 2455
391 Ga0501075_0151591 3300049591 Bacteria 1767
392 Ga0501075_0496989 3300049591 Bacteria 931
393 Ga0501076_0005194 3300049592 Bacteria 9321
394 Ga0501076_0007305 3300049592 Bacteria 8038
395 Ga0501077_0005013 3300049593 Bacteria 8031
396 Ga0501077_0011784 3300049593 Bacteria 5467
397 Ga0501079_0001658 3300049741 Bacteria 15848
398 Ga0501079_0034656 3300049741 Bacteria 3884
399 Ga0501079_0301129 3300049741 Bacteria 1254
400 Ga0501080_0094514 3300049742 Bacteria 2776
401 Ga0501081_0015488 3300049743 Bacteria 5032
402 Ga0501081_0204809 3300049743 Bacteria 1432
403 Ga0501035_0120150 3300049822 Bacteria 2298
404 Ga0501044_0319069 3300049823 Bacteria 1479
405 Ga0501045_0007134 3300049824 Bacteria 7752
406 Ga0501045_0013573 3300049824 Bacteria 5755
407 Ga0501045_0066498 3300049824 Bacteria 2646
408 nmdc:mga0yw44_3250_c1 3300050492 Bacteria 7162
409 nmdc:mga05p37_32974_c1 3300050507 Bacteria 6341
410 nmdc:mga08y16_94264_c1 3300050511 Bacteria 3119
411 nmdc:mga0n895_123305_c1 3300050512 Bacteria 2613
412 nmdc:mga0rr50_12020_c1 3300050513 Bacteria 5573
413 nmdc:mga0a205_546203_c1 3300050515 Bacteria 1014
414 Ga0495601_0084986 3300053077 Bacteria 2033
415 Ga0495619_0211452 3300053085 Bacteria 1343
416 Ga0501084_0008813 3300054114 Bacteria 8348
417 Ga0501082_0012748 3300060353 Bacteria 7225
418 Ga0501082_0019116 3300060353 Bacteria 5903
419 Ga0530510_0000599 3300061734 Bacteria 23190
420 Ga0530510_0019482 3300061734 Bacteria 4816
421 Ga0530510_0028670 3300061734 Bacteria 3992
422 2617911887 2617270889 Bacteria 9064343
423 2831427195 2831426010 Bacteria 8662725
424 2848696720 2848694841 Bacteria 9205737
425 2849666100 2849660919 Bacteria 8251853
426 2886628325 2886627955 Bacteria 7618130
427 2913847441 2913844669 Bacteria 8381711
428 2913918550 2913912277 Bacteria 9037797
429 2913944559 2913939268 Bacteria 8559644
430 642600442 642555144 Bacteria 9059191
431 Ga0070675_100170798
432 JGI25406J46586_10004561
433 Ga0070658_10022885
434 Ga0070658_10046924
435 Ga0070658_10230815
436 Ga0070676_10052295
437 Ga0070676_10435857
438 Ga0070683_100020104
439 Ga0070683_100074732
440 Ga0070683_100162827
441 Ga0070683_100180776
442 Ga0070683_100375659
443 Ga0070677_10086066
444 Ga0068869_100055643
445 Ga0070666_10406810
446 Ga0070680_100408824
447 Ga0070682_100002932
448 Ga0070682_100022280
449 Ga0070682_100066804
450 Ga0070682_100352021
451 Ga0068868_100007892
452 Ga0070660_100003432
453 Ga0070660_100413283
454 Ga0070691_10020559
455 Ga0070691_10118296
456 Ga0070687_100025063
457 Ga0070661_100003620
458 Ga0070661_100004729
459 Ga0070661_100326443
460 Ga0070692_10030150
461 Ga0070675_100072127
462 Ga0070675_100251041
463 Ga0070675_100325448
464 Ga0070671_100006558
465 Ga0070671_100109598
466 Ga0070674_100021733
467 Ga0070674_100034609
468 Ga0070673_100003850
469 Ga0070673_100229083
470 Ga0070659_100028322
471 Ga0070659_100038063
472 Ga0070714_100276153
473 Ga0070713_100179614
474 Ga0070701_10007734
475 Ga0070705_100346334
476 Ga0070700_100054960
477 Ga0070694_100146982
478 Ga0070708_100016800
479 Ga0070708_100047690
480 Ga0070663_100076116
481 Ga0070678_100051384
482 Ga0070678_100062130
483 Ga0070681_10001459
484 Ga0070681_10071159
485 Ga0070681_10160395
486 Ga0068867_100124293
487 Ga0070685_10001010
488 Ga0070706_100013884
489 Ga0070707_100109817
490 Ga0070698_100391418
491 Ga0070679_100217605
492 Ga0070679_100314164
493 Ga0070679_100466594
494 Ga0070684_100003605
495 Ga0070684_100037489
496 Ga0070684_100116172
497 Ga0070697_100228464
498 Ga0068853_100002193
499 Ga0068853_100048576
500 Ga0070672_100048647
501 Ga0070686_100028572
502 Ga0070686_100099854
503 Ga0070696_100004440
504 Ga0070696_100422799
505 Ga0070693_100031249
506 Ga0070665_100243275
507 Ga0070704_100267187
508 Ga0068855_100027960
509 Ga0070664_100002989
510 Ga0070664_100028119
511 Ga0070664_100070970
512 Ga0068857_100111898
513 Ga0068854_100004184
514 Ga0068856_100142977
515 Ga0068856_100198695
516 Ga0070702_100037440
517 Ga0070702_100068633
518 Ga0070702_100292897
519 Ga0068861_100060483
520 Ga0068851_10005615
521 Ga0068870_10133469
522 Ga0068858_100008432
523 Ga0068860_100043427
524 Ga0068862_100153632
525 Ga0081455_10028932
526 Ga0081455_10324736
527 Ga0081539_10002592
528 Ga0075365_10016710
529 Ga0075432_10013685
530 Ga0075428_100058050
531 Ga0075428_100284468
532 Ga0075434_100125996
533 Ga0068865_100013242
534 Ga0075435_100025902
535 Ga0099794_10117453
536 Ga0111539_10238894
537 Ga0111539_10814820
538 Ga0105245_10080649
539 Ga0105245_10347543
540 Ga0105247_10441706
541 Ga0114129_10019181
542 Ga0105243_10003264
543 Ga0105243_10050282
544 Ga0105243_10054798
545 Ga0105243_10198082
546 Ga0105241_10086648
547 Ga0105242_10016578
548 Ga0105242_10067362
549 Ga0105242_10182459
550 Ga0105242_10290083
551 Ga0105248_10017376
552 Ga0105248_10394642
553 Ga0105237_10663742
554 Ga0105238_10034708
555 Ga0105249_10038281
556 Ga0105239_10021338
557 Ga0105239_10026048
558 Ga0105239_10226078
559 Ga0105239_10253128
560 Ga0105239_10436163
561 Ga0105246_10090519
562 Ga0105246_10153345
563 Ga0105246_10178180
564 Ga0105246_10432111
565 Ga0157373_10363791
566 Ga0157371_10006274
567 Ga0157371_10086613
568 Ga0157371_10144825
569 Ga0157369_10115449
570 Ga0157378_10017365
571 Ga0163162_10330171
572 Ga0163162_10340757
573 Ga0157372_10006258
574 Ga0157372_10011292
575 Ga0157372_10176632
576 Ga0157375_10010535
577 Ga0157375_10209620
578 Ga0157375_10387976
579 Ga0157375_11100368
580 Ga0163163_10211808
581 Ga0157380_10290264
582 Ga0157380_10415214
583 Ga0182008_10002426
584 Ga0182008_10041328
585 Ga0157377_10009537
586 Ga0157377_10060343
587 Ga0157377_10208764
588 Ga0157377_10210736
589 Ga0157379_10054653
590 Ga0182007_10004050
591 Ga0213873_10062919
592 Ga0213872_10072173
593 Ga0213871_10007875
594 Ga0207682_10059103
595 Ga0207688_10012487
596 Ga0207688_10020016
597 Ga0207647_10070822
598 Ga0207645_10029446
599 Ga0207645_10068843
600 Ga0207643_10009997
601 Ga0207705_10016492
602 Ga0207705_10129398
603 Ga0207705_10204598
604 Ga0207684_10025774
605 Ga0207707_10025744
606 Ga0207707_10133301
607 Ga0207693_10091212
608 Ga0207663_10118365
609 Ga0207660_10156747
610 Ga0207660_10247383
611 Ga0207662_10039484
612 Ga0207657_10001651
613 Ga0207657_10028490
614 Ga0207657_10495912
615 Ga0207649_10011194
616 Ga0207649_10011280
617 Ga0207649_10146836
618 Ga0207652_10020547
619 Ga0207652_10096987
620 Ga0207652_10855315
621 Ga0207646_10091317
622 Ga0207646_10623147
623 Ga0207681_10351995
624 Ga0207694_10321442
625 Ga0207659_10030869
626 Ga0207659_10227343
627 Ga0207659_10285947
628 Ga0207687_10013964
629 Ga0207687_10109383
630 Ga0207664_10119917
631 Ga0207690_10019661
632 Ga0207690_10168375
633 Ga0207706_10002051
634 Ga0207706_10023074
635 Ga0207686_10108389
636 Ga0207709_10035151
637 Ga0207709_10040962
638 Ga0207709_10200235
639 Ga0207669_10019547
640 Ga0207669_10028763
641 Ga0207704_10024568
642 Ga0207704_10488254
643 Ga0207665_10361005
644 Ga0207691_10007227
645 Ga0207691_10009508
646 Ga0207689_10010283
647 Ga0207689_10049508
648 Ga0207661_10001092
649 Ga0207679_10076701
650 Ga0207679_10097291
651 Ga0207651_10006150
652 Ga0207712_10458993
653 Ga0207640_10003734
654 Ga0207677_10250092
655 Ga0207678_10012470
656 Ga0207708_10024495
657 Ga0207708_10222400
658 Ga0207702_10032699
659 Ga0207702_10079607
660 Ga0207648_10018488
661 Ga0207648_10038324
662 Ga0207648_10059366
663 Ga0207674_10063111
664 Ga0207675_100009439
665 Ga0207675_100039979
666 Ga0207675_100476268
667 Ga0207683_10070593
668 Ga0207683_10094254
669 Ga0207698_10169711
670 Ga0207698_10920444
671 Ga0207428_10126517
672 Ga0268266_10361905
673 Ga0268265_10168947
674 Ga0268264_10229902
675 Ga0307410_10109680
676 Ga0307416_100655816
677 Ga0373958_0009136
678 Ga0373939_0015690
679 Ga0373962_0005377
680 Ga0395899_0015530
681 Ga0395900_0101860
682 Ga0395900_0359232
683 Ga0395898_0116433
684 Ga0395905_0034676
685 Ga0436364_0878568
686 Ga0436364_1404476
687 Ga0395901_0009206
688 Ga0395901_0168087
689 Ga0395901_0498206
690 Ga0395901_0637149
691 Ga0237819_05088
692 Ga0436360_1160202
693 Ga0436361_0369314
694 Ga0436362_0189399
695 Ga0439438_016524
696 Ga0439449_0009570
697 Ga0453683_0040529
698 Ga0453683_0075734
699 Ga0453683_0148495
700 Ga0466966_0008171
701 Ga0466966_0057698
702 Ga0466963_0000258
703 Ga0466964_0036159
704 Ga0453684_0006277
705 Ga0453684_0255075
706 Ga0466968_0006100
707 Ga0466959_0008144
708 Ga0466959_0132336
709 Ga0451576_0014599
710 Ga0466958_0054570
711 Ga0466967_0000153
712 Ga0466967_0014433
713 Ga0466967_0047660
714 Ga0466967_0097998
715 Ga0466967_0109458
716 Ga0466967_0176712
717 Ga0466967_0363288
718 Ga0466967_0451246
719 Ga0466967_0711162
720 Ga0466967_0727243
721 Ga0495592_0132328
722 Ga0495641_0124173
723 Ga0495651_0025565
724 Ga0495651_0282824
725 Ga0495653_0010552
726 Ga0495605_0092170
727 Ga0495608_0111235
728 Ga0495628_0143173
729 Ga0495628_0259823
730 Ga0495630_0005626
731 Ga0495630_0119363
732 Ga0495652_0124087
733 Ga0495586_0039898
734 Ga0495667_0038925
735 Ga0495667_0145909
736 Ga0495635_0114074
737 Ga0495657_0054705
738 Ga0495657_0111468
739 Ga0495613_0031378
740 Ga0495604_0119683
741 Ga0495674_0013806
742 Ga0495674_0020876
743 Ga0495674_0071813
744 Ga0495672_0004502
745 Ga0495680_0037697
746 Ga0495680_0048971
747 Ga0495680_0196338
748 Ga0495684_0013625
749 Ga0495684_0030693
750 Ga0496100_0058284
751 Ga0496100_0100216
752 Ga0496100_0663348
753 Ga0496101_0019250
754 Ga0496101_0224521
755 Ga0496101_0306132
756 Ga0496102_0054509
757 Ga0496102_0310970
758 Ga0496103_0130972
759 Ga0496105_0061340
760 Ga0496105_0242891
761 Ga0496106_0097573
762 Ga0496106_0136894
763 Ga0496106_0240585
764 Ga0496107_0195519
765 Ga0496108_0058810
766 Ga0496108_0094150
767 Ga0496109_0013525
768 Ga0496109_0115985
769 Ga0496109_0218069
770 Ga0496109_0345953
771 Ga0496110_0011856
772 Ga0496110_0032513
773 Ga0496110_0115081
774 Ga0496111_0007961
775 Ga0496111_0025193
776 Ga0496111_0064007
777 Ga0496111_0119079
778 Ga0496112_0003938
779 Ga0496112_0125541
780 Ga0496112_0263187
781 Ga0496112_0647934
782 Ga0496113_0085117
783 Ga0496114_0128955
784 Ga0501031_0055042
785 Ga0501037_0096956
786 Ga0501037_0159064
787 Ga0501037_0185859
788 Ga0501038_0017274
789 Ga0501040_0010342
790 Ga0501040_0579539
791 Ga0501041_0210178
792 Ga0501042_0109053
793 Ga0501042_0147141
794 Ga0501043_0034105
795 Ga0501046_0051241
796 Ga0501046_0061404
797 Ga0501047_0127478
798 Ga0501048_0008114
799 Ga0501048_0064516
800 Ga0501067_0012959
801 Ga0501067_0023551
802 Ga0501067_0072536
803 Ga0501068_0011138
804 Ga0501068_0035080
805 Ga0501069_0137684
806 Ga0501070_0039207
807 Ga0501070_0053205
808 Ga0501071_0000475
809 Ga0501071_0009441
810 Ga0501071_0020321
811 Ga0501071_0456644
812 Ga0501072_0002272
813 Ga0501072_0038604
814 Ga0501072_0153181
815 Ga0501072_0329287
816 Ga0501073_0147390
817 Ga0501074_0011913
818 Ga0501074_0013879
819 Ga0501075_0011435
820 Ga0501075_0081126
821 Ga0501075_0151591
822 Ga0501075_0496989
823 Ga0501076_0005194
824 Ga0501076_0007305
825 Ga0501077_0005013
826 Ga0501077_0011784
827 Ga0501079_0001658
828 Ga0501079_0034656
829 Ga0501079_0301129
830 Ga0501080_0094514
831 Ga0501081_0015488
832 Ga0501081_0204809
833 Ga0501035_0120150
834 Ga0501044_0319069
835 Ga0501045_0007134
836 Ga0501045_0013573
837 Ga0501045_0066498
838 nmdc:mga0yw44_3250_c1
839 nmdc:mga05p37_32974_c1
840 nmdc:mga08y16_94264_c1
841 nmdc:mga0n895_123305_c1
842 nmdc:mga0rr50_12020_c1
843 nmdc:mga0a205_546203_c1
844 Ga0495601_0084986
845 Ga0495619_0211452
846 Ga0501084_0008813
847 Ga0501082_0012748
848 Ga0501082_0019116
849 Ga0530510_0000599
850 Ga0530510_0019482
851 Ga0530510_0028670
852 2617911887
853 2831427195
854 2848696720
855 2849666100
856 2886628325
857 2913847441
858 2913918550
859 2913944559
860 642600442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

185

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9428 1 239
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9352 1 239
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9343 7 237
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.924 5 222
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.919 7 237
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9705 4 239 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9616 7 238 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 4 239 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9456 7 238 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9371 4 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A552Q3W6-F1-model_v4 ABC transporter ATP-binding protein 0.9897 4 240 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A538JJF0-F1-model_v4 ABC transporter ATP-binding protein 0.9862 6 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A0Q6UDX6-F1-model_v4 ABC transporter ATP-binding protein 0.9849 5 214 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A2R6JDS6-F1-model_v4 ABC transporter ATP-binding protein 0.9837 51 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A660U776-F1-model_v4 ABC transporter ATP-binding protein 0.9834 7 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map