F441986

General Info

Members Datasets Scaffolds Average Seq Length
429 302 406 199

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0012163|Ga0495628_0012163_3145_3759
Length 204
Sequence MQPPAEAPAAAPLQLKVVIAGGFGAGKTTLVAAVSEITPLTTEELLTEAGSTTDPLTGVAAKTTTTVAMDFGRITFREPPPMEIYLFGTPGQERFIFTWPDLTHGAAGAVILADTRRLADSFTAIDYFERRTIPFIVALNRFDGTPHDYTVDEVRRALALPPDTPVVTCDARQADSAASVLITLISYALTRARSGPSPAQGACT

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
3 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
4 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
5 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
6 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
7 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
8 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
9 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
10 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
11 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
12 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
13 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
14 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
15 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
16 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
17 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
90 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
91 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
92 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
298 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
299 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
300 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
301 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
302 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.47
Metatranscriptomes 1.17
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.73
Nodule 0
Rhizoplane 2.1
Rhizosphere 89.04
Stem 0
Stem Tuber 0.23
Unclassified 4.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10079389 3300001989 Bacteria 1010
2 JGI24735J21928_10021689 3300002067 Bacteria 1960
3 JGI24745J21846_1003748 3300002073 Bacteria 1602
4 JGI24751J29686_10023809 3300002459 Bacteria 1270
5 JGI25406J46586_10004336 3300003203 Bacteria 6617
6 Ga0070676_10499061 3300005328 Bacteria 864
7 Ga0070683_100107361 3300005329 Bacteria 2632
8 Ga0070670_100186013 3300005331 Bacteria 1803
9 Ga0068869_100099350 3300005334 Bacteria 2199
10 Ga0070682_100053965 3300005337 Bacteria 2520
11 Ga0068868_100214281 3300005338 Bacteria 1610
12 Ga0068868_100763428 3300005338 Bacteria 870
13 Ga0070660_100075469 3300005339 Bacteria 2640
14 Ga0070689_100171935 3300005340 Bacteria 1756
15 Ga0070689_100201222 3300005340 Bacteria 1626
16 Ga0070687_100088492 3300005343 Bacteria 1707
17 Ga0070687_100152555 3300005343 Bacteria 1357
18 Ga0070692_10124706 3300005345 Bacteria 1440
19 Ga0070668_100060309 3300005347 Bacteria 2937
20 Ga0070668_101190659 3300005347 Bacteria 690
21 Ga0070688_100048816 3300005365 Bacteria 2631
22 Ga0070659_100713996 3300005366 Bacteria 867
23 Ga0070667_100216029 3300005367 Bacteria 1706
24 Ga0070709_10063805 3300005434 Bacteria 2354
25 Ga0070714_100065700 3300005435 Bacteria 3125
26 Ga0070714_100116838 3300005435 Bacteria 2368
27 Ga0070714_100459429 3300005435 Bacteria 1210
28 Ga0070713_100063879 3300005436 Bacteria 3088
29 Ga0070701_10285212 3300005438 Bacteria 1010
30 Ga0070663_100054197 3300005455 Bacteria 2866
31 Ga0070678_100359930 3300005456 Bacteria 1253
32 Ga0068867_100066548 3300005459 Bacteria 2684
33 Ga0070685_10632274 3300005466 Bacteria 773
34 Ga0070698_100551649 3300005471 Bacteria 1092
35 Ga0070699_100085102 3300005518 Bacteria 2759
36 Ga0070684_100132289 3300005535 Bacteria 2251
37 Ga0070684_100222384 3300005535 Bacteria 1722
38 Ga0068853_100241585 3300005539 Bacteria 1655
39 Ga0070696_100640437 3300005546 Bacteria 861
40 Ga0070693_100303781 3300005547 Bacteria 1077
41 Ga0070665_100289574 3300005548 Bacteria 1640
42 Ga0070665_100899760 3300005548 Bacteria 898
43 Ga0070664_100386155 3300005564 Bacteria 1279
44 Ga0068857_100193353 3300005577 Bacteria 1853
45 Ga0068854_100024814 3300005578 Bacteria 4109
46 Ga0068854_100061042 3300005578 Bacteria 2729
47 Ga0068856_100082271 3300005614 Bacteria 3195
48 Ga0068856_100256280 3300005614 Bacteria 1764
49 Ga0068856_101350694 3300005614 Bacteria 728
50 Ga0070702_100108344 3300005615 Bacteria 1717
51 Ga0070702_100232954 3300005615 Bacteria 1238
52 Ga0068852_100450096 3300005616 Bacteria 1275
53 Ga0068859_100336548 3300005617 Bacteria 1604
54 Ga0068864_100117072 3300005618 Bacteria 2378
55 Ga0068864_100226801 3300005618 Bacteria 1726
56 Ga0068864_100275589 3300005618 Bacteria 1569
57 Ga0068861_100275522 3300005719 Bacteria 1447
58 Ga0068870_10080592 3300005840 Bacteria 1798
59 Ga0068863_100290804 3300005841 Bacteria 1584
60 Ga0068863_100303725 3300005841 Bacteria 1548
61 Ga0068863_100519524 3300005841 Bacteria 1174
62 Ga0068858_100379816 3300005842 Bacteria 1356
63 Ga0068858_100439420 3300005842 Bacteria 1256
64 Ga0068862_100323733 3300005844 Bacteria 1424
65 Ga0081455_10000037 3300005937 Bacteria 136059
66 Ga0081455_10026944 3300005937 Bacteria 5274
67 Ga0081538_10044093 3300005981 Bacteria 2787
68 Ga0081539_10000027 3300005985 Bacteria 328691
69 Ga0075363_100078715 3300006048 Bacteria 1800
70 Ga0075364_10002794 3300006051 Bacteria 9821
71 Ga0070715_10027496 3300006163 Bacteria 2272
72 Ga0070712_100190574 3300006175 Bacteria 1604
73 Ga0075369_10000381 3300006186 Bacteria 13317
74 Ga0097621_100166981 3300006237 Bacteria 1895
75 Ga0068871_100362211 3300006358 Bacteria 1285
76 Ga0075433_10530959 3300006852 Bacteria 1035
77 Ga0075429_100593144 3300006880 Bacteria 971
78 Ga0097620_100336538 3300006931 Bacteria 1604
79 Ga0075435_100624558 3300007076 Bacteria 935
80 Ga0099795_10007536 3300007788 Bacteria 3045
81 Ga0105244_10094587 3300009036 Bacteria 1467
82 Ga0105240_10155850 3300009093 Bacteria 2716
83 Ga0111539_10340512 3300009094 Bacteria 1746
84 Ga0111539_10763582 3300009094 Bacteria 1125
85 Ga0111539_11649355 3300009094 Bacteria 743
86 Ga0105245_10175682 3300009098 Bacteria 2042
87 Ga0105245_10267271 3300009098 Bacteria 1666
88 Ga0105245_10272201 3300009098 Bacteria 1652
89 Ga0105243_10095039 3300009148 Bacteria 2462
90 Ga0105241_10037689 3300009174 Bacteria 3642
91 Ga0105241_10183167 3300009174 Bacteria 1739
92 Ga0105241_10261912 3300009174 Bacteria 1470
93 Ga0105237_10092693 3300009545 Bacteria 3010
94 Ga0105237_10211856 3300009545 Bacteria 1937
95 Ga0105238_10046782 3300009551 Bacteria 4364
96 Ga0105238_10084267 3300009551 Bacteria 3168
97 Ga0105238_10176839 3300009551 Bacteria 2111
98 Ga0105249_10099246 3300009553 Bacteria 2736
99 Ga0105032_101750 3300009979 Bacteria 1966
100 Ga0105033_100791 3300009986 Bacteria 2482
101 Ga0105033_102532 3300009986 Bacteria 1511
102 Ga0105035_101095 3300009988 Bacteria 1805
103 Ga0105035_103273 3300009988 Bacteria 1237
104 Ga0105028_105678 3300009993 Bacteria 1296
105 Ga0099796_10069799 3300010159 Bacteria 1266
106 Ga0105239_10255567 3300010375 Bacteria 1968
107 Ga0105239_11459840 3300010375 Bacteria 790
108 Ga0105246_10579487 3300011119 Bacteria 966
109 Ga0157371_10098332 3300013102 Bacteria 2075
110 Ga0157371_10226975 3300013102 Bacteria 1341
111 Ga0157374_10696705 3300013296 Bacteria 1029
112 Ga0157378_11474071 3300013297 Bacteria 725
113 Ga0163162_10226250 3300013306 Bacteria 2000
114 Ga0157372_10074379 3300013307 Bacteria 3831
115 Ga0157372_10959011 3300013307 Bacteria 991
116 Ga0157375_10017195 3300013308 Bacteria 6520
117 Ga0163163_10146872 3300014325 Bacteria 2402
118 Ga0163163_10462981 3300014325 Bacteria 1328
119 Ga0163163_10646621 3300014325 Bacteria 1121
120 Ga0157380_10155284 3300014326 Bacteria 1983
121 Ga0157377_10047198 3300014745 Bacteria 2412
122 Ga0157377_10174949 3300014745 Bacteria 1345
123 Ga0157379_10046498 3300014968 Bacteria 3871
124 Ga0157379_10836540 3300014968 Bacteria 870
125 Ga0163161_10457868 3300017792 Bacteria 1032
126 Ga0206354_11504117 3300020081 Bacteria 2100
127 Ga0206353_10674483 3300020082 Bacteria 1972
128 Ga0206353_12020200 3300020082 Bacteria 1173
129 Ga0213876_10018335 3300021384 Bacteria 3696
130 Ga0207697_10260130 3300025315 Bacteria 768
131 Ga0207692_10395048 3300025898 Bacteria 861
132 Ga0207642_10028273 3300025899 Bacteria 2306
133 Ga0207688_10115647 3300025901 Bacteria 1561
134 Ga0207688_10140885 3300025901 Bacteria 1419
135 Ga0207680_10148909 3300025903 Bacteria 1559
136 Ga0207647_10150763 3300025904 Bacteria 1359
137 Ga0207699_10067661 3300025906 Bacteria 2172
138 Ga0207699_10069711 3300025906 Bacteria 2145
139 Ga0207699_10584557 3300025906 Bacteria 812
140 Ga0207645_10286989 3300025907 Bacteria 1094
141 Ga0207643_10009527 3300025908 Bacteria 5217
142 Ga0207643_10019829 3300025908 Bacteria 3686
143 Ga0207654_10536592 3300025911 Bacteria 830
144 Ga0207671_10360335 3300025914 Bacteria 1154
145 Ga0207693_10042951 3300025915 Bacteria 3558
146 Ga0207663_10030211 3300025916 Bacteria 3193
147 Ga0207662_10348258 3300025918 Bacteria 994
148 Ga0207657_10029810 3300025919 Bacteria 4961
149 Ga0207681_10776433 3300025923 Bacteria 800
150 Ga0207694_10110898 3300025924 Bacteria 2182
151 Ga0207694_10416676 3300025924 Bacteria 1118
152 Ga0207650_10139348 3300025925 Bacteria 1906
153 Ga0207659_10063372 3300025926 Bacteria 2672
154 Ga0207687_10049715 3300025927 Bacteria 2917
155 Ga0207687_10129733 3300025927 Bacteria 1898
156 Ga0207700_10081492 3300025928 Bacteria 2527
157 Ga0207700_10337599 3300025928 Bacteria 1309
158 Ga0207700_10516377 3300025928 Bacteria 1058
159 Ga0207664_10017331 3300025929 Bacteria 5278
160 Ga0207664_10138453 3300025929 Bacteria 2056
161 Ga0207664_10275842 3300025929 Bacteria 1474
162 Ga0207664_10628729 3300025929 Bacteria 964
163 Ga0207644_10084351 3300025931 Bacteria 2355
164 Ga0207706_10162828 3300025933 Bacteria 1961
165 Ga0207709_10070093 3300025935 Bacteria 2222
166 Ga0207669_10043120 3300025937 Bacteria 2640
167 Ga0207665_10002640 3300025939 Bacteria 12050
168 Ga0207691_10040264 3300025940 Bacteria 4319
169 Ga0207711_10129652 3300025941 Bacteria 2260
170 Ga0207711_10465293 3300025941 Bacteria 1178
171 Ga0207689_10098687 3300025942 Bacteria 2400
172 Ga0207689_10380585 3300025942 Bacteria 1175
173 Ga0207668_10125886 3300025972 Bacteria 1948
174 Ga0207668_10202521 3300025972 Bacteria 1582
175 Ga0207668_10221145 3300025972 Bacteria 1521
176 Ga0207640_10263998 3300025981 Bacteria 1343
177 Ga0207658_10028741 3300025986 Bacteria 3920
178 Ga0207677_10100172 3300026023 Bacteria 2130
179 Ga0207677_10196021 3300026023 Bacteria 1601
180 Ga0207677_10731866 3300026023 Bacteria 880
181 Ga0207703_10098895 3300026035 Bacteria 2468
182 Ga0207678_10002198 3300026067 Bacteria 17613
183 Ga0207678_10073429 3300026067 Bacteria 2931
184 Ga0207678_10301547 3300026067 Bacteria 1377
185 Ga0207708_10039283 3300026075 Bacteria 3606
186 Ga0207702_10250580 3300026078 Bacteria 1663
187 Ga0207702_10383647 3300026078 Bacteria 1352
188 Ga0207641_10471042 3300026088 Bacteria 1216
189 Ga0207648_10144231 3300026089 Bacteria 2100
190 Ga0207676_10112601 3300026095 Bacteria 2280
191 Ga0207674_10057068 3300026116 Bacteria 3959
192 Ga0207674_10291618 3300026116 Bacteria 1580
193 Ga0207683_10050798 3300026121 Bacteria 3633
194 Ga0207683_10568685 3300026121 Bacteria 1048
195 Ga0207698_10048769 3300026142 Bacteria 3218
196 Ga0209813_10045571 3300027866 Bacteria 1351
197 Ga0207428_10273434 3300027907 Bacteria 1255
198 Ga0268266_10037050 3300028379 Bacteria 4156
199 Ga0268266_10261736 3300028379 Bacteria 1603
200 Ga0268266_10603624 3300028379 Bacteria 1054
201 Ga0268264_10787818 3300028381 Bacteria 949
202 Ga0307512_10002178 3300030522 Bacteria 25592
203 Ga0307513_10013448 3300031456 Bacteria 10040
204 Ga0307513_10049250 3300031456 Bacteria 4565
205 Ga0307513_10111497 3300031456 Bacteria 2728
206 Ga0307509_10270632 3300031507 Bacteria 1467
207 Ga0307408_100278091 3300031548 Bacteria 1393
208 Ga0307508_10327373 3300031616 Bacteria 1124
209 Ga0307413_10000639 3300031824 Bacteria 11851
210 Ga0307518_10037015 3300031838 Bacteria 3548
211 Ga0307518_10294028 3300031838 Bacteria 993
212 Ga0307518_10400885 3300031838 Bacteria 765
213 Ga0307410_10286958 3300031852 Bacteria 1294
214 Ga0307409_100554341 3300031995 Bacteria 1129
215 Ga0307411_10006387 3300032005 Bacteria 5897
216 Ga0307411_10748703 3300032005 Bacteria 856
217 Ga0307415_100422772 3300032126 Bacteria 1144
218 Ga0307415_100820468 3300032126 Bacteria 851
219 Ga0373926_0000259 3300035083 Bacteria 12749
220 Ga0373934_0015237 3300035086 Bacteria 2915
221 Ga0373934_0025703 3300035086 Bacteria 2282
222 Ga0373944_0038636 3300035089 Bacteria 1466
223 Ga0373923_0010555 3300035111 Bacteria 3364
224 Ga0373923_0024366 3300035111 Bacteria 2388
225 Ga0373936_0000091 3300035113 Bacteria 32642
226 Ga0373936_0050669 3300035113 Bacteria 1679
227 Ga0373945_0000207 3300035116 Bacteria 16012
228 Ga0373953_0085436 3300035117 Bacteria 1316
229 Ga0373953_0097641 3300035117 Bacteria 1234
230 Ga0373954_0026734 3300035118 Bacteria 2646
231 Ga0373954_0237830 3300035118 Bacteria 896
232 Ga0373956_0008674 3300035119 Bacteria 4116
233 Ga0373956_0140794 3300035119 Bacteria 1132
234 Ga0373957_0007918 3300035120 Bacteria 3420
235 Ga0373957_0008242 3300035120 Bacteria 3368
236 Ga0373943_0003398 3300035170 Bacteria 7244
237 Ga0373946_0000205 3300035171 Bacteria 18361
238 Ga0373955_0004385 3300035172 Bacteria 6243
239 Ga0373955_0201643 3300035172 Bacteria 1184
240 Ga0373924_0006741 3300035410 Bacteria 4124
241 Ga0373924_0014350 3300035410 Bacteria 2993
242 Ga0373931_0061534 3300035691 Bacteria 2025
243 Ga0373931_0332666 3300035691 Bacteria 946
244 Ga0373935_0000149 3300035692 Bacteria 32036
245 Ga0373935_0500086 3300035692 Bacteria 882
246 Ga0373927_0071870 3300035695 Bacteria 2239
247 Ga0373927_0166008 3300035695 Bacteria 1447
248 Ga0373927_0237529 3300035695 Bacteria 1197
249 Ga0373933_0008908 3300035724 Bacteria 5472
250 Ga0373933_0097979 3300035724 Bacteria 1816
251 Ga0373947_0024570 3300035725 Bacteria 3511
252 Ga0373937_0035845 3300036401 Bacteria 4517
253 Ga0373937_0249697 3300036401 Bacteria 1672
254 Ga0373925_0045792 3300037068 Bacteria 3250
255 Ga0436365_1325436 3300039437 Bacteria 5868
256 Ga0439449_0069774 3300042007 Bacteria 1295
257 Ga0439459_0088410 3300042438 Bacteria 742
258 Ga0466966_0054112 3300044684 Bacteria 2545
259 Ga0466964_0059992 3300044706 Bacteria 1581
260 Ga0466971_0014282 3300044719 Bacteria 3492
261 Ga0466968_0126813 3300044735 Bacteria 1159
262 Ga0466958_0051249 3300045836 Bacteria 2498
263 Ga0466967_0001642 3300045976 Bacteria 13215
264 Ga0466967_0096905 3300045976 Bacteria 2691
265 Ga0466967_0173113 3300045976 Bacteria 2032
266 Ga0466967_0202737 3300045976 Bacteria 1879
267 Ga0466967_0952517 3300045976 Bacteria 854
268 Ga0495592_0038310 3300046454 Bacteria 3607
269 Ga0495603_0287533 3300046455 Bacteria 945
270 Ga0495629_0214186 3300046459 Bacteria 1330
271 Ga0495641_0006547 3300046461 Bacteria 7520
272 Ga0495651_0009444 3300046462 Bacteria 7490
273 Ga0495651_0037545 3300046462 Bacteria 3771
274 Ga0495651_0123860 3300046462 Bacteria 1895
275 Ga0495651_0490472 3300046462 Bacteria 788
276 Ga0495653_0007296 3300046463 Bacteria 9056
277 Ga0495653_0056824 3300046463 Bacteria 2981
278 Ga0495639_0038096 3300046475 Bacteria 2158
279 Ga0495662_0024085 3300046476 Bacteria 2937
280 Ga0495664_0000362 3300046477 Bacteria 22001
281 Ga0495608_0024642 3300046511 Bacteria 4111
282 Ga0495608_0037718 3300046511 Bacteria 3249
283 Ga0495608_0051082 3300046511 Bacteria 2741
284 Ga0495618_0045933 3300046514 Bacteria 2756
285 Ga0495618_0337590 3300046514 Bacteria 930
286 Ga0495628_0012163 3300046516 Bacteria 7253
287 Ga0495628_0099736 3300046516 Bacteria 2242
288 Ga0495628_0244822 3300046516 Bacteria 1340
289 Ga0495630_0578868 3300046517 Bacteria 861
290 Ga0495630_0594296 3300046517 Bacteria 848
291 Ga0495652_0002628 3300046529 Bacteria 18339
292 Ga0495652_0062310 3300046529 Bacteria 3145
293 Ga0495652_0241784 3300046529 Bacteria 1342
294 Ga0495665_0081074 3300046531 Bacteria 1706
295 Ga0495640_0048610 3300046533 Bacteria 2930
296 Ga0495586_0053305 3300046535 Bacteria 2191
297 Ga0495587_0038597 3300046536 Bacteria 2862
298 Ga0495645_0029683 3300046543 Bacteria 3978
299 Ga0495645_0031424 3300046543 Bacteria 3869
300 Ga0495622_0096118 3300046557 Bacteria 1359
301 Ga0495667_0005835 3300046559 Bacteria 8345
302 Ga0495667_0009192 3300046559 Bacteria 6710
303 Ga0495667_0041058 3300046559 Bacteria 3069
304 Ga0495634_0022023 3300046642 Bacteria 4494
305 Ga0495634_0099143 3300046642 Bacteria 1884
306 Ga0495635_0000618 3300046663 Bacteria 22865
307 Ga0495635_0047700 3300046663 Bacteria 2953
308 Ga0495657_0198260 3300046675 Bacteria 1224
309 Ga0495599_0017314 3300046678 Bacteria 4480
310 Ga0495623_0037944 3300046679 Bacteria 3081
311 Ga0495646_0030593 3300046680 Bacteria 3361
312 Ga0495646_0456746 3300046680 Bacteria 659
313 Ga0495647_0276746 3300046681 Bacteria 752
314 Ga0495613_0114861 3300046689 Bacteria 1938
315 Ga0495624_0042857 3300046690 Bacteria 2890
316 Ga0495600_0027656 3300046809 Bacteria 3665
317 Ga0495600_0029788 3300046809 Bacteria 3535
318 Ga0495581_0017782 3300047315 Bacteria 4131
319 Ga0495604_0039282 3300047317 Bacteria 3720
320 Ga0495674_0001390 3300047319 Bacteria 23628
321 Ga0495674_0715894 3300047319 Bacteria 784
322 Ga0495672_0250834 3300047320 Bacteria 859
323 Ga0495676_0007410 3300047321 Bacteria 10069
324 Ga0495680_0001291 3300047322 Bacteria 27318
325 Ga0495680_0004675 3300047322 Bacteria 13045
326 Ga0495680_0043755 3300047322 Bacteria 3543
327 Ga0495675_0093522 3300047444 Bacteria 1886
328 Ga0495684_0001180 3300047471 Bacteria 21064
329 Ga0495684_0027043 3300047471 Bacteria 4406
330 Ga0495593_0262857 3300047673 Bacteria 864
331 Ga0495602_0096364 3300048088 Bacteria 2440
332 Ga0495602_0290881 3300048088 Bacteria 1199
333 Ga0496102_0171277 3300048905 Bacteria 2044
334 Ga0496104_0114575 3300048907 Bacteria 2586
335 Ga0496106_0134586 3300048909 Bacteria 1940
336 Ga0496108_0603608 3300048911 Bacteria 956
337 Ga0496108_0624937 3300048911 Bacteria 937
338 Ga0496109_0665717 3300048912 Bacteria 978
339 Ga0496109_0882474 3300048912 Bacteria 832
340 Ga0496112_0138581 3300048915 Bacteria 2403
341 Ga0496112_0157478 3300048915 Bacteria 2238
342 Ga0501031_0047325 3300049568 Bacteria 2804
343 Ga0501033_0090079 3300049570 Bacteria 2244
344 Ga0501036_0186726 3300049572 Bacteria 1744
345 Ga0501036_0450335 3300049572 Bacteria 1072
346 Ga0501037_0228333 3300049573 Bacteria 1307
347 Ga0501037_0581594 3300049573 Bacteria 753
348 Ga0501038_0082593 3300049574 Bacteria 2705
349 Ga0501038_0180825 3300049574 Bacteria 1701
350 Ga0501039_0075538 3300049575 Bacteria 2619
351 Ga0501039_0701866 3300049575 Bacteria 791
352 Ga0501040_0074325 3300049576 Bacteria 2348
353 Ga0501041_0057989 3300049577 Bacteria 2368
354 Ga0501042_0004726 3300049578 Bacteria 8690
355 Ga0501042_0013548 3300049578 Bacteria 5552
356 Ga0501043_0004695 3300049579 Bacteria 11075
357 Ga0501046_0014535 3300049580 Bacteria 6638
358 Ga0501047_0028583 3300049581 Bacteria 5377
359 Ga0501048_0000555 3300049582 Bacteria 26420
360 Ga0501048_0121757 3300049582 Bacteria 1843
361 Ga0501068_0047340 3300049584 Bacteria 2594
362 Ga0501071_0060199 3300049587 Bacteria 2748
363 Ga0501071_0176771 3300049587 Bacteria 1599
364 Ga0501072_0032542 3300049588 Bacteria 4084
365 Ga0501074_0084347 3300049590 Bacteria 2277
366 Ga0501075_0073968 3300049591 Bacteria 2577
367 Ga0501076_0051782 3300049592 Bacteria 3251
368 Ga0501077_0002270 3300049593 Bacteria 11588
369 Ga0501080_0108275 3300049742 Bacteria 2576
370 Ga0501080_0136394 3300049742 Bacteria 2271
371 Ga0501080_0803252 3300049742 Bacteria 825
372 Ga0501081_0049442 3300049743 Bacteria 2895
373 Ga0501044_0450802 3300049823 Bacteria 1193
374 Ga0501045_0053545 3300049824 Bacteria 2949
375 nmdc:mga03683_21027_c1 3300050489 Bacteria 2510
376 nmdc:mga03n38_144454_c1 3300050490 Bacteria 1191
377 nmdc:mga00v17_614_c1 3300050491 Bacteria 19754
378 nmdc:mga06z11_70379_c1 3300050494 Bacteria 1849
379 nmdc:mga04h51_138844_c1 3300050495 Bacteria 920
380 nmdc:mga09592_142078_c1 3300050508 Bacteria 2069
381 nmdc:mga06r32_155627_c1 3300050510 Bacteria 2267
382 nmdc:mga06r32_335759_c1 3300050510 Bacteria 1496
383 nmdc:mga0n895_424059_c1 3300050512 Bacteria 1344
384 nmdc:mga0rr50_702981_c1 3300050513 Bacteria 863
385 nmdc:mga08x19_214258_c1 3300050514 Bacteria 1322
386 nmdc:mga0a205_444174_c1 3300050515 Bacteria 1157
387 nmdc:mga0sz30_2790_c1 3300050516 Bacteria 6233
388 Ga0495601_0052115 3300053077 Bacteria 2583
389 Ga0495601_0085352 3300053077 Bacteria 2028
390 Ga0495612_0002267 3300053078 Bacteria 7918
391 Ga0495612_0004725 3300053078 Bacteria 5639
392 Ga0500635_0002961 3300053080 Bacteria 4232
393 Ga0495595_0218968 3300053084 Bacteria 950
394 Ga0495619_0018766 3300053085 Bacteria 4391
395 Ga0495619_0085403 3300053085 Bacteria 2131
396 Ga0500644_0008045 3300053088 Bacteria 2770
397 Ga0500646_0159194 3300053090 Bacteria 753
398 Ga0500568_0112744 3300053139 Bacteria 1016
399 Ga0500577_0003707 3300053142 Bacteria 3980
400 Ga0500589_147118 3300053147 Bacteria 963
401 Ga0501084_0013039 3300054114 Bacteria 6879
402 Ga0587080_022773 3300059503 Bacteria 1040
403 Ga0587068_035076 3300059641 Bacteria 887
404 Ga0466962_0033665 3300061719 Bacteria 2452
405 Ga0466962_0304595 3300061719 Bacteria 789
406 Ga0530510_0071604 3300061734 Bacteria 2516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2862705112 2862710619 175
2 3300009988 Ga0105035_103273 Ga0105035_1032732 178
3 3300030522 Ga0307512_10002178 Ga0307512_1000217813 178
4 3300049572 Ga0501036_0450335 Ga0501036_0450335_481_1017 178
5 3300053085 Ga0495619_0085403 Ga0495619_0085403_999_1535 178
6 3300053088 Ga0500644_0008045 Ga0500644_0008045_260_796 178
7 3300053142 Ga0500577_0003707 Ga0500577_0003707_2600_3136 178
8 3300053147 Ga0500589_147118 Ga0500589_147118_16_552 178
9 3300020082 Ga0206353_10674483 Ga0206353_106744833 180
10 3300026078 Ga0207702_10250580 Ga0207702_102505802 180
11 3300025929 Ga0207664_10628729 Ga0207664_106287291 181
12 3300035111 Ga0373923_0024366 Ga0373923_0024366_405_953 182
13 3300035118 Ga0373954_0237830 Ga0373954_0237830_180_728 182
14 3300035172 Ga0373955_0004385 Ga0373955_0004385_3563_4111 182
15 3300035695 Ga0373927_0166008 Ga0373927_0166008_727_1275 182
16 3300036401 Ga0373937_0035845 Ga0373937_0035845_363_911 182
17 3300045976 Ga0466967_0202737 Ga0466967_0202737_1203_1751 182
18 3300046511 Ga0495608_0024642 Ga0495608_0024642_151_699 182
19 3300046516 Ga0495628_0244822 Ga0495628_0244822_758_1306 182
20 3300046531 Ga0495665_0081074 Ga0495665_0081074_78_626 182
21 3300046559 Ga0495667_0009192 Ga0495667_0009192_4819_5367 182
22 3300047319 Ga0495674_0715894 Ga0495674_0715894_26_574 182
23 3300047322 Ga0495680_0004675 Ga0495680_0004675_8421_8969 182
24 3300005455 Ga0070663_100054197 Ga0070663_1000541972 183
25 3300009093 Ga0105240_10155850 Ga0105240_101558502 183
26 3300009174 Ga0105241_10037689 Ga0105241_100376894 183
27 3300009545 Ga0105237_10092693 Ga0105237_100926933 183
28 3300009551 Ga0105238_10046782 Ga0105238_100467824 183
29 3300010375 Ga0105239_10255567 Ga0105239_102555672 183
30 3300046557 Ga0495622_0096118 Ga0495622_0096118_756_1316 183
31 3300050512 nmdc:mga0n895_424059_c1 nmdc:mga0n895_424059_c1_468_1019 183
32 3300005981 Ga0081538_10044093 Ga0081538_100440933 184
33 3300009094 Ga0111539_10763582 Ga0111539_107635822 184
34 3300009148 Ga0105243_10095039 Ga0105243_100950392 184
35 3300044735 Ga0466968_0126813 Ga0466968_0126813_501_1061 184
36 3300049568 Ga0501031_0047325 Ga0501031_0047325_1139_1696 184
37 3300049570 Ga0501033_0090079 Ga0501033_0090079_271_828 184
38 3300049572 Ga0501036_0186726 Ga0501036_0186726_767_1324 184
39 3300049573 Ga0501037_0228333 Ga0501037_0228333_386_943 184
40 3300049573 Ga0501037_0581594 Ga0501037_0581594_110_670 184
41 3300049574 Ga0501038_0082593 Ga0501038_0082593_999_1556 184
42 3300049574 Ga0501038_0180825 Ga0501038_0180825_65_625 184
43 3300049575 Ga0501039_0075538 Ga0501039_0075538_763_1320 184
44 3300049575 Ga0501039_0701866 Ga0501039_0701866_58_618 184
45 3300049576 Ga0501040_0074325 Ga0501040_0074325_577_1134 184
46 3300049577 Ga0501041_0057989 Ga0501041_0057989_1195_1752 184
47 3300049578 Ga0501042_0004726 Ga0501042_0004726_4390_4947 184
48 3300049578 Ga0501042_0013548 Ga0501042_0013548_1696_2256 184
49 3300049579 Ga0501043_0004695 Ga0501043_0004695_5530_6090 184
50 3300049580 Ga0501046_0014535 Ga0501046_0014535_3775_4332 184
51 3300049581 Ga0501047_0028583 Ga0501047_0028583_3289_3849 184
52 3300049582 Ga0501048_0000555 Ga0501048_0000555_19607_20167 184
53 3300049582 Ga0501048_0121757 Ga0501048_0121757_1073_1630 184
54 3300049584 Ga0501068_0047340 Ga0501068_0047340_763_1320 184
55 3300049587 Ga0501071_0060199 Ga0501071_0060199_763_1320 184
56 3300049588 Ga0501072_0032542 Ga0501072_0032542_1273_1830 184
57 3300049590 Ga0501074_0084347 Ga0501074_0084347_1653_2213 184
58 3300049591 Ga0501075_0073968 Ga0501075_0073968_645_1202 184
59 3300049592 Ga0501076_0051782 Ga0501076_0051782_1573_2130 184
60 3300049593 Ga0501077_0002270 Ga0501077_0002270_9004_9561 184
61 3300049742 Ga0501080_0108275 Ga0501080_0108275_673_1233 184
62 3300049742 Ga0501080_0136394 Ga0501080_0136394_534_1091 184
63 3300049743 Ga0501081_0049442 Ga0501081_0049442_1045_1602 184
64 3300049823 Ga0501044_0450802 Ga0501044_0450802_43_603 184
65 3300049824 Ga0501045_0053545 Ga0501045_0053545_1104_1661 184
66 3300054114 Ga0501084_0013039 Ga0501084_0013039_4182_4739 184
67 iso_pu_bacteria 2795385472 2795793644 185
68 3300014325 Ga0163163_10146872 Ga0163163_101468722 187
69 3300025906 Ga0207699_10069711 Ga0207699_100697113 187
70 3300031616 Ga0307508_10327373 Ga0307508_103273732 187
71 3300031838 Ga0307518_10037015 Ga0307518_100370154 187
72 3300053077 Ga0495601_0052115 Ga0495601_0052115_328_921 187
73 3300053078 Ga0495612_0004725 Ga0495612_0004725_4233_4826 187
74 3300005564 Ga0070664_100386155 Ga0070664_1003861552 188
75 3300005614 Ga0068856_100256280 Ga0068856_1002562802 188
76 3300005618 Ga0068864_100226801 Ga0068864_1002268012 188
77 3300005841 Ga0068863_100290804 Ga0068863_1002908043 188
78 3300006163 Ga0070715_10027496 Ga0070715_100274962 188
79 3300006175 Ga0070712_100190574 Ga0070712_1001905742 188
80 3300006237 Ga0097621_100166981 Ga0097621_1001669814 188
81 3300007076 Ga0075435_100624558 Ga0075435_1006245582 188
82 3300009174 Ga0105241_10261912 Ga0105241_102619122 188
83 3300014325 Ga0163163_10646621 Ga0163163_106466212 188
84 3300025906 Ga0207699_10067661 Ga0207699_100676612 188
85 3300025915 Ga0207693_10042951 Ga0207693_100429514 188
86 3300025916 Ga0207663_10030211 Ga0207663_100302112 188
87 3300025928 Ga0207700_10337599 Ga0207700_103375993 188
88 3300025929 Ga0207664_10275842 Ga0207664_102758422 188
89 3300025939 Ga0207665_10002640 Ga0207665_100026409 188
90 3300026078 Ga0207702_10383647 Ga0207702_103836472 188
91 3300031824 Ga0307413_10000639 Ga0307413_100006394 188
92 3300035083 Ga0373926_0000259 Ga0373926_0000259_8257_8823 188
93 3300035089 Ga0373944_0038636 Ga0373944_0038636_348_914 188
94 3300035113 Ga0373936_0000091 Ga0373936_0000091_14495_15061 188
95 3300035116 Ga0373945_0000207 Ga0373945_0000207_4313_4879 188
96 3300035117 Ga0373953_0097641 Ga0373953_0097641_40_606 188
97 3300035170 Ga0373943_0003398 Ga0373943_0003398_2564_3130 188
98 3300035171 Ga0373946_0000205 Ga0373946_0000205_15799_16365 188
99 3300035410 Ga0373924_0006741 Ga0373924_0006741_1852_2418 188
100 3300035692 Ga0373935_0000149 Ga0373935_0000149_27956_28522 188
101 3300035695 Ga0373927_0071870 Ga0373927_0071870_1460_2026 188
102 3300035725 Ga0373947_0024570 Ga0373947_0024570_86_652 188
103 3300037068 Ga0373925_0045792 Ga0373925_0045792_579_1145 188
104 3300044706 Ga0466964_0059992 Ga0466964_0059992_555_1121 188
105 3300045976 Ga0466967_0096905 Ga0466967_0096905_680_1246 188
106 3300046455 Ga0495603_0287533 Ga0495603_0287533_178_744 188
107 3300046459 Ga0495629_0214186 Ga0495629_0214186_703_1269 188
108 3300046461 Ga0495641_0006547 Ga0495641_0006547_5896_6462 188
109 3300046462 Ga0495651_0009444 Ga0495651_0009444_595_1161 188
110 3300046463 Ga0495653_0007296 Ga0495653_0007296_7414_7980 188
111 3300046475 Ga0495639_0038096 Ga0495639_0038096_477_1043 188
112 3300046476 Ga0495662_0024085 Ga0495662_0024085_961_1527 188
113 3300046477 Ga0495664_0000362 Ga0495664_0000362_13955_14521 188
114 3300046511 Ga0495608_0051082 Ga0495608_0051082_1308_1874 188
115 3300046514 Ga0495618_0045933 Ga0495618_0045933_91_657 188
116 3300046517 Ga0495630_0594296 Ga0495630_0594296_69_635 188
117 3300046529 Ga0495652_0002628 Ga0495652_0002628_10233_10799 188
118 3300046543 Ga0495645_0029683 Ga0495645_0029683_1037_1603 188
119 3300046559 Ga0495667_0005835 Ga0495667_0005835_7073_7639 188
120 3300046642 Ga0495634_0099143 Ga0495634_0099143_1000_1566 188
121 3300046663 Ga0495635_0000618 Ga0495635_0000618_962_1528 188
122 3300046675 Ga0495657_0198260 Ga0495657_0198260_293_859 188
123 3300046678 Ga0495599_0017314 Ga0495599_0017314_2927_3493 188
124 3300046681 Ga0495647_0276746 Ga0495647_0276746_29_595 188
125 3300046690 Ga0495624_0042857 Ga0495624_0042857_959_1525 188
126 3300047315 Ga0495581_0017782 Ga0495581_0017782_2168_2734 188
127 3300047319 Ga0495674_0001390 Ga0495674_0001390_22715_23281 188
128 3300047321 Ga0495676_0007410 Ga0495676_0007410_1198_1764 188
129 3300047322 Ga0495680_0001291 Ga0495680_0001291_5010_5576 188
130 3300047471 Ga0495684_0001180 Ga0495684_0001180_1009_1575 188
131 3300048907 Ga0496104_0114575 Ga0496104_0114575_1292_1858 188
132 3300048911 Ga0496108_0603608 Ga0496108_0603608_68_634 188
133 3300048912 Ga0496109_0665717 Ga0496109_0665717_321_887 188
134 3300048915 Ga0496112_0138581 Ga0496112_0138581_619_1185 188
135 3300050513 nmdc:mga0rr50_702981_c1 nmdc:mga0rr50_702981_c1_41_607 188
136 3300050514 nmdc:mga08x19_214258_c1 nmdc:mga08x19_214258_c1_223_789 188
137 iso_pu_bacteria 2866552031 2866552847 188
138 iso_pu_bacteria 8001781756 8001789251 188
139 3300005367 Ga0070667_100216029 Ga0070667_1002160292 189
140 3300028379 Ga0268266_10261736 Ga0268266_102617361 189
141 3300035086 Ga0373934_0025703 Ga0373934_0025703_1473_2042 189
142 3300035113 Ga0373936_0050669 Ga0373936_0050669_76_645 189
143 3300035119 Ga0373956_0140794 Ga0373956_0140794_384_953 189
144 3300035120 Ga0373957_0008242 Ga0373957_0008242_1153_1722 189
145 3300035724 Ga0373933_0097979 Ga0373933_0097979_171_740 189
146 3300045976 Ga0466967_0173113 Ga0466967_0173113_176_745 189
147 3300046462 Ga0495651_0123860 Ga0495651_0123860_100_669 189
148 3300046463 Ga0495653_0056824 Ga0495653_0056824_1503_2072 189
149 3300046680 Ga0495646_0456746 Ga0495646_0456746_26_595 189
150 3300046809 Ga0495600_0027656 Ga0495600_0027656_2886_3455 189
151 3300048088 Ga0495602_0096364 Ga0495602_0096364_1692_2261 189
152 3300053084 Ga0495595_0218968 Ga0495595_0218968_261_830 189
153 3300061719 Ga0466962_0304595 Ga0466962_0304595_202_771 189
154 iso_pu_bacteria 2863067949 2863069255 189
155 iso_pu_bacteria 2899370129 2899370454 189
156 iso_pu_bacteria 2990044586 2990046587 189
157 iso_pu_bacteria 8008485437 8008488433 189
158 iso_pu_bacteria 8025524527 8025527310 189
159 3300005347 Ga0070668_101190659 Ga0070668_1011906591 190
160 3300005435 Ga0070714_100065700 Ga0070714_1000657002 190
161 3300005615 Ga0070702_100108344 Ga0070702_1001083443 190
162 3300009098 Ga0105245_10272201 Ga0105245_102722012 190
163 3300025929 Ga0207664_10017331 Ga0207664_100173314 190
164 3300026023 Ga0207677_10196021 Ga0207677_101960212 190
165 3300035695 Ga0373927_0237529 Ga0373927_0237529_434_1048 190
166 3300048912 Ga0496109_0882474 Ga0496109_0882474_136_708 190
167 3300050490 nmdc:mga03n38_144454_c1 nmdc:mga03n38_144454_c1_434_1006 190
168 iso_pu_bacteria 2751185734 2753074918 190
169 iso_pu_bacteria 2870721527 2870726111 190
170 3300005548 Ga0070665_100289574 Ga0070665_1002895742 191
171 3300046516 Ga0495628_0012163 Ga0495628_0012163_3145_3759 191
172 3300006048 Ga0075363_100078715 Ga0075363_1000787152 192
173 3300006051 Ga0075364_10002794 Ga0075364_100027948 192
174 3300006186 Ga0075369_10000381 Ga0075369_1000038112 192
175 3300007788 Ga0099795_10007536 Ga0099795_100075363 192
176 3300010159 Ga0099796_10069799 Ga0099796_100697993 192
177 3300031507 Ga0307509_10270632 Ga0307509_102706323 192
178 3300042007 Ga0439449_0069774 Ga0439449_0069774_358_954 192
179 3300045976 Ga0466967_0952517 Ga0466967_0952517_32_619 192
180 3300047673 Ga0495593_0262857 Ga0495593_0262857_26_613 192
181 3300050489 nmdc:mga03683_21027_c1 nmdc:mga03683_21027_c1_1901_2482 192
182 3300050491 nmdc:mga00v17_614_c1 nmdc:mga00v17_614_c1_2274_2855 192
183 3300050516 nmdc:mga0sz30_2790_c1 nmdc:mga0sz30_2790_c1_3500_4081 192
184 3300053139 Ga0500568_0112744 Ga0500568_0112744_13_600 192
185 iso_pu_bacteria 2990088156 2990093607 192
186 iso_pu_bacteria 2997451912 2997453763 192
187 3300031838 Ga0307518_10294028 Ga0307518_102940282 193
188 3300031838 Ga0307518_10400885 Ga0307518_104008851 193
189 3300049587 Ga0501071_0176771 Ga0501071_0176771_745_1329 193
190 3300049742 Ga0501080_0803252 Ga0501080_0803252_30_614 193
191 3300050510 nmdc:mga06r32_155627_c1 nmdc:mga06r32_155627_c1_1545_2135 193
192 iso_pu_bacteria 2870782633 2870787374 193
193 iso_pu_bacteria 2891326441 2891331110 193
194 iso_pu_bacteria 8054160619 8054162020 193
195 3300005937 Ga0081455_10026944 Ga0081455_100269442 194
196 3300032005 Ga0307411_10006387 Ga0307411_100063872 194
197 3300045976 Ga0466967_0001642 Ga0466967_0001642_11013_11615 194
198 iso_pu_bacteria 2791354901 2791911669 194
199 iso_pu_bacteria 2795385470 2795780236 194
200 3300005518 Ga0070699_100085102 Ga0070699_1000851022 195
201 3300050510 nmdc:mga06r32_335759_c1 nmdc:mga06r32_335759_c1_198_809 196
202 3300005434 Ga0070709_10063805 Ga0070709_100638051 197
203 3300005435 Ga0070714_100116838 Ga0070714_1001168383 197
204 3300005435 Ga0070714_100459429 Ga0070714_1004594291 197
205 3300005436 Ga0070713_100063879 Ga0070713_1000638792 197
206 3300009036 Ga0105244_10094587 Ga0105244_100945872 197
207 3300009098 Ga0105245_10175682 Ga0105245_101756822 197
208 3300009174 Ga0105241_10183167 Ga0105241_101831672 197
209 3300009545 Ga0105237_10211856 Ga0105237_102118562 197
210 3300009551 Ga0105238_10084267 Ga0105238_100842674 197
211 3300009553 Ga0105249_10099246 Ga0105249_100992463 197
212 3300010375 Ga0105239_11459840 Ga0105239_114598402 197
213 3300011119 Ga0105246_10579487 Ga0105246_105794872 197
214 3300013102 Ga0157371_10098332 Ga0157371_100983322 197
215 3300013306 Ga0163162_10226250 Ga0163162_102262501 197
216 3300013307 Ga0157372_10959011 Ga0157372_109590112 197
217 3300014325 Ga0163163_10462981 Ga0163163_104629812 197
218 3300014326 Ga0157380_10155284 Ga0157380_101552842 197
219 3300014745 Ga0157377_10047198 Ga0157377_100471983 197
220 3300014968 Ga0157379_10046498 Ga0157379_100464983 197
221 3300014968 Ga0157379_10836540 Ga0157379_108365402 197
222 3300025898 Ga0207692_10395048 Ga0207692_103950482 197
223 3300025906 Ga0207699_10584557 Ga0207699_105845571 197
224 3300025928 Ga0207700_10081492 Ga0207700_100814923 197
225 3300025929 Ga0207664_10138453 Ga0207664_101384533 197
226 3300025941 Ga0207711_10129652 Ga0207711_101296523 197
227 3300032005 Ga0307411_10748703 Ga0307411_107487032 197
228 3300035086 Ga0373934_0015237 Ga0373934_0015237_2205_2813 197
229 3300035111 Ga0373923_0010555 Ga0373923_0010555_2402_3010 197
230 3300035117 Ga0373953_0085436 Ga0373953_0085436_407_1015 197
231 3300035118 Ga0373954_0026734 Ga0373954_0026734_1659_2267 197
232 3300035119 Ga0373956_0008674 Ga0373956_0008674_3220_3828 197
233 3300035120 Ga0373957_0007918 Ga0373957_0007918_2629_3237 197
234 3300035172 Ga0373955_0201643 Ga0373955_0201643_30_638 197
235 3300035410 Ga0373924_0014350 Ga0373924_0014350_1345_1953 197
236 3300035691 Ga0373931_0061534 Ga0373931_0061534_437_1057 197
237 3300035692 Ga0373935_0500086 Ga0373935_0500086_29_637 197
238 3300035724 Ga0373933_0008908 Ga0373933_0008908_2136_2744 197
239 3300036401 Ga0373937_0249697 Ga0373937_0249697_255_863 197
240 3300039437 Ga0436365_1325436 Ga0436365_1325436_3128_3748 197
241 3300046454 Ga0495592_0038310 Ga0495592_0038310_703_1311 197
242 3300046462 Ga0495651_0037545 Ga0495651_0037545_1900_2508 197
243 3300046462 Ga0495651_0490472 Ga0495651_0490472_78_716 197
244 3300046511 Ga0495608_0037718 Ga0495608_0037718_2297_2905 197
245 3300046514 Ga0495618_0337590 Ga0495618_0337590_148_756 197
246 3300046516 Ga0495628_0099736 Ga0495628_0099736_288_896 197
247 3300046529 Ga0495652_0062310 Ga0495652_0062310_1158_1796 197
248 3300046529 Ga0495652_0241784 Ga0495652_0241784_472_1080 197
249 3300046533 Ga0495640_0048610 Ga0495640_0048610_875_1483 197
250 3300046535 Ga0495586_0053305 Ga0495586_0053305_1448_2056 197
251 3300046536 Ga0495587_0038597 Ga0495587_0038597_649_1257 197
252 3300046543 Ga0495645_0031424 Ga0495645_0031424_3030_3638 197
253 3300046559 Ga0495667_0041058 Ga0495667_0041058_202_810 197
254 3300046642 Ga0495634_0022023 Ga0495634_0022023_817_1425 197
255 3300046663 Ga0495635_0047700 Ga0495635_0047700_833_1441 197
256 3300046679 Ga0495623_0037944 Ga0495623_0037944_1937_2545 197
257 3300046680 Ga0495646_0030593 Ga0495646_0030593_1800_2408 197
258 3300046689 Ga0495613_0114861 Ga0495613_0114861_660_1268 197
259 3300046809 Ga0495600_0029788 Ga0495600_0029788_472_1080 197
260 3300047317 Ga0495604_0039282 Ga0495604_0039282_750_1358 197
261 3300047322 Ga0495680_0043755 Ga0495680_0043755_1001_1609 197
262 3300047444 Ga0495675_0093522 Ga0495675_0093522_1000_1608 197
263 3300047471 Ga0495684_0027043 Ga0495684_0027043_3064_3672 197
264 3300048088 Ga0495602_0290881 Ga0495602_0290881_390_998 197
265 3300048905 Ga0496102_0171277 Ga0496102_0171277_891_1511 197
266 3300048909 Ga0496106_0134586 Ga0496106_0134586_472_1092 197
267 3300048911 Ga0496108_0624937 Ga0496108_0624937_90_710 197
268 3300048915 Ga0496112_0157478 Ga0496112_0157478_816_1436 197
269 3300050508 nmdc:mga09592_142078_c1 nmdc:mga09592_142078_c1_392_1012 197
270 3300053077 Ga0495601_0085352 Ga0495601_0085352_536_1144 197
271 3300053078 Ga0495612_0002267 Ga0495612_0002267_2301_2939 197
272 3300053085 Ga0495619_0018766 Ga0495619_0018766_707_1345 197
273 3300053090 Ga0500646_0159194 Ga0500646_0159194_46_663 197
274 3300003203 JGI25406J46586_10004336 JGI25406J46586_100043364 198
275 3300005471 Ga0070698_100551649 Ga0070698_1005516492 198
276 3300005937 Ga0081455_10000037 Ga0081455_10000037123 198
277 3300005985 Ga0081539_10000027 Ga0081539_1000002746 198
278 3300009986 Ga0105033_100791 Ga0105033_1007914 198
279 3300025923 Ga0207681_10776433 Ga0207681_107764332 198
280 3300025937 Ga0207669_10043120 Ga0207669_100431202 198
281 3300027866 Ga0209813_10045571 Ga0209813_100455713 198
282 3300031456 Ga0307513_10049250 Ga0307513_100492503 198
283 3300031456 Ga0307513_10111497 Ga0307513_101114971 198
284 3300031995 Ga0307409_100554341 Ga0307409_1005543412 198
285 3300032126 Ga0307415_100422772 Ga0307415_1004227722 198
286 3300042438 Ga0439459_0088410 Ga0439459_0088410_32_664 198
287 3300044684 Ga0466966_0054112 Ga0466966_0054112_288_929 198
288 3300044719 Ga0466971_0014282 Ga0466971_0014282_453_1094 198
289 3300045836 Ga0466958_0051249 Ga0466958_0051249_350_991 198
290 3300046517 Ga0495630_0578868 Ga0495630_0578868_89_739 198
291 3300047320 Ga0495672_0250834 Ga0495672_0250834_47_697 198
292 3300050494 nmdc:mga06z11_70379_c1 nmdc:mga06z11_70379_c1_147_791 198
293 3300050495 nmdc:mga04h51_138844_c1 nmdc:mga04h51_138844_c1_162_806 198
294 3300053080 Ga0500635_0002961 Ga0500635_0002961_3325_3975 198
295 3300061719 Ga0466962_0033665 Ga0466962_0033665_131_772 198
296 iso_pu_bacteria 2775506925 2776373091 198
297 iso_pu_bacteria 8003314358 8003324069 198
298 iso_pu_bacteria 8056207758 8056209288 198
299 3300013297 Ga0157378_11474071 Ga0157378_114740711 199
300 3300025315 Ga0207697_10260130 Ga0207697_102601302 199
301 3300028379 Ga0268266_10037050 Ga0268266_100370502 199
302 iso_pu_bacteria 2816332139 2816505894 199
303 3300013296 Ga0157374_10696705 Ga0157374_106967052 200
304 3300026023 Ga0207677_10100172 Ga0207677_101001722 200
305 3300061734 Ga0530510_0071604 Ga0530510_0071604_1041_1646 200
306 iso_pu_bacteria 2558860112 2558907518 200
307 3300002073 JGI24745J21846_1003748 JGI24745J21846_10037482 202
308 3300005334 Ga0068869_100099350 Ga0068869_1000993502 202
309 3300005339 Ga0070660_100075469 Ga0070660_1000754692 202
310 3300005340 Ga0070689_100201222 Ga0070689_1002012222 202
311 3300005343 Ga0070687_100088492 Ga0070687_1000884922 202
312 3300005438 Ga0070701_10285212 Ga0070701_102852122 202
313 3300005539 Ga0068853_100241585 Ga0068853_1002415852 202
314 3300005578 Ga0068854_100024814 Ga0068854_1000248142 202
315 3300005615 Ga0070702_100232954 Ga0070702_1002329541 202
316 3300005616 Ga0068852_100450096 Ga0068852_1004500962 202
317 3300005841 Ga0068863_100519524 Ga0068863_1005195242 202
318 3300005842 Ga0068858_100439420 Ga0068858_1004394202 202
319 3300005844 Ga0068862_100323733 Ga0068862_1003237332 202
320 3300017792 Ga0163161_10457868 Ga0163161_104578682 202
321 3300020081 Ga0206354_11504117 Ga0206354_115041172 202
322 3300025899 Ga0207642_10028273 Ga0207642_100282734 202
323 3300025901 Ga0207688_10140885 Ga0207688_101408852 202
324 3300025903 Ga0207680_10148909 Ga0207680_101489092 202
325 3300025904 Ga0207647_10150763 Ga0207647_101507632 202
326 3300025914 Ga0207671_10360335 Ga0207671_103603352 202
327 3300025918 Ga0207662_10348258 Ga0207662_103482582 202
328 3300025919 Ga0207657_10029810 Ga0207657_100298105 202
329 3300025924 Ga0207694_10110898 Ga0207694_101108982 202
330 3300025926 Ga0207659_10063372 Ga0207659_100633722 202
331 3300025927 Ga0207687_10049715 Ga0207687_100497151 202
332 3300025935 Ga0207709_10070093 Ga0207709_100700933 202
333 3300025940 Ga0207691_10040264 Ga0207691_100402642 202
334 3300025972 Ga0207668_10125886 Ga0207668_101258862 202
335 3300025986 Ga0207658_10028741 Ga0207658_100287414 202
336 3300026035 Ga0207703_10098895 Ga0207703_100988953 202
337 3300026067 Ga0207678_10002198 Ga0207678_100021986 202
338 3300026067 Ga0207678_10301547 Ga0207678_103015472 202
339 3300026075 Ga0207708_10039283 Ga0207708_100392832 202
340 3300026116 Ga0207674_10057068 Ga0207674_100570684 202
341 3300026121 Ga0207683_10050798 Ga0207683_100507983 202
342 3300059503 Ga0587080_022773 Ga0587080_022773_153_809 202
343 3300059641 Ga0587068_035076 Ga0587068_035076_139_795 202
344 3300009979 Ga0105032_101750 Ga0105032_1017503 203
345 3300009986 Ga0105033_102532 Ga0105033_1025322 203
346 3300009988 Ga0105035_101095 Ga0105035_1010952 203
347 3300009993 Ga0105028_105678 Ga0105028_1056782 203
348 3300031548 Ga0307408_100278091 Ga0307408_1002780911 203
349 3300032126 Ga0307415_100820468 Ga0307415_1008204681 203
350 3300006852 Ga0075433_10530959 Ga0075433_105309592 204
351 3300002459 JGI24751J29686_10023809 JGI24751J29686_100238092 205
352 3300005328 Ga0070676_10499061 Ga0070676_104990611 205
353 3300005329 Ga0070683_100107361 Ga0070683_1001073614 205
354 3300005331 Ga0070670_100186013 Ga0070670_1001860131 205
355 3300005337 Ga0070682_100053965 Ga0070682_1000539652 205
356 3300005338 Ga0068868_100214281 Ga0068868_1002142812 205
357 3300005340 Ga0070689_100171935 Ga0070689_1001719353 205
358 3300005343 Ga0070687_100152555 Ga0070687_1001525552 205
359 3300005345 Ga0070692_10124706 Ga0070692_101247062 205
360 3300005347 Ga0070668_100060309 Ga0070668_1000603094 205
361 3300005365 Ga0070688_100048816 Ga0070688_1000488163 205
362 3300005366 Ga0070659_100713996 Ga0070659_1007139961 205
363 3300005456 Ga0070678_100359930 Ga0070678_1003599302 205
364 3300005466 Ga0070685_10632274 Ga0070685_106322741 205
365 3300005535 Ga0070684_100222384 Ga0070684_1002223843 205
366 3300005546 Ga0070696_100640437 Ga0070696_1006404371 205
367 3300005547 Ga0070693_100303781 Ga0070693_1003037812 205
368 3300005548 Ga0070665_100899760 Ga0070665_1008997602 205
369 3300005577 Ga0068857_100193353 Ga0068857_1001933532 205
370 3300005578 Ga0068854_100061042 Ga0068854_1000610422 205
371 3300005614 Ga0068856_100082271 Ga0068856_1000822712 205
372 3300005614 Ga0068856_101350694 Ga0068856_1013506941 205
373 3300005618 Ga0068864_100117072 Ga0068864_1001170722 205
374 3300005618 Ga0068864_100275589 Ga0068864_1002755891 205
375 3300005719 Ga0068861_100275522 Ga0068861_1002755222 205
376 3300005840 Ga0068870_10080592 Ga0068870_100805922 205
377 3300005841 Ga0068863_100303725 Ga0068863_1003037252 205
378 3300005842 Ga0068858_100379816 Ga0068858_1003798162 205
379 3300006358 Ga0068871_100362211 Ga0068871_1003622112 205
380 3300006880 Ga0075429_100593144 Ga0075429_1005931442 205
381 3300009094 Ga0111539_10340512 Ga0111539_103405121 205
382 3300009551 Ga0105238_10176839 Ga0105238_101768392 205
383 3300013102 Ga0157371_10226975 Ga0157371_102269752 205
384 3300013307 Ga0157372_10074379 Ga0157372_100743791 205
385 3300014745 Ga0157377_10174949 Ga0157377_101749492 205
386 3300020082 Ga0206353_12020200 Ga0206353_120202002 205
387 3300021384 Ga0213876_10018335 Ga0213876_100183352 205
388 3300025907 Ga0207645_10286989 Ga0207645_102869892 205
389 3300025908 Ga0207643_10009527 Ga0207643_100095272 205
390 3300025908 Ga0207643_10019829 Ga0207643_100198294 205
391 3300025911 Ga0207654_10536592 Ga0207654_105365922 205
392 3300025925 Ga0207650_10139348 Ga0207650_101393482 205
393 3300025928 Ga0207700_10516377 Ga0207700_105163772 205
394 3300025931 Ga0207644_10084351 Ga0207644_100843512 205
395 3300025933 Ga0207706_10162828 Ga0207706_101628282 205
396 3300025941 Ga0207711_10465293 Ga0207711_104652932 205
397 3300025942 Ga0207689_10098687 Ga0207689_100986873 205
398 3300025942 Ga0207689_10380585 Ga0207689_103805852 205
399 3300025981 Ga0207640_10263998 Ga0207640_102639982 205
400 3300026067 Ga0207678_10073429 Ga0207678_100734291 205
401 3300026088 Ga0207641_10471042 Ga0207641_104710422 205
402 3300026089 Ga0207648_10144231 Ga0207648_101442312 205
403 3300026095 Ga0207676_10112601 Ga0207676_101126013 205
404 3300026116 Ga0207674_10291618 Ga0207674_102916182 205
405 3300026142 Ga0207698_10048769 Ga0207698_100487692 205
406 3300028379 Ga0268266_10603624 Ga0268266_106036242 205
407 3300028381 Ga0268264_10787818 Ga0268264_107878182 205
408 3300050515 nmdc:mga0a205_444174_c1 nmdc:mga0a205_444174_c1_107_760 205
409 3300001989 JGI24739J22299_10079389 JGI24739J22299_100793891 206
410 3300002067 JGI24735J21928_10021689 JGI24735J21928_100216891 206
411 3300005338 Ga0068868_100763428 Ga0068868_1007634281 206
412 3300005459 Ga0068867_100066548 Ga0068867_1000665482 206
413 3300005535 Ga0070684_100132289 Ga0070684_1001322893 206
414 3300005617 Ga0068859_100336548 Ga0068859_1003365482 206
415 3300006931 Ga0097620_100336538 Ga0097620_1003365382 206
416 3300009094 Ga0111539_11649355 Ga0111539_116493551 206
417 3300009098 Ga0105245_10267271 Ga0105245_102672712 206
418 3300013308 Ga0157375_10017195 Ga0157375_100171952 206
419 3300025901 Ga0207688_10115647 Ga0207688_101156471 206
420 3300025924 Ga0207694_10416676 Ga0207694_104166762 206
421 3300025927 Ga0207687_10129733 Ga0207687_101297333 206
422 3300025972 Ga0207668_10202521 Ga0207668_102025211 206
423 3300025972 Ga0207668_10221145 Ga0207668_102211453 206
424 3300026023 Ga0207677_10731866 Ga0207677_107318661 206
425 3300026121 Ga0207683_10568685 Ga0207683_105686852 206
426 3300027907 Ga0207428_10273434 Ga0207428_102734341 206
427 3300031456 Ga0307513_10013448 Ga0307513_1001344812 206
428 3300031852 Ga0307410_10286958 Ga0307410_102869582 206
429 3300035691 Ga0373931_0332666 Ga0373931_0332666_151_810 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03029

ATP_bind_1

Conserved hypothetical ATP binding protein

19

191

0.96

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

14

190

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvm-assembly1.cif.gz_A crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate 0.7551 108 177
8ezj-assembly1.cif.gz_D cryo-em structure of the s. cerevisiae arf-like protein arl1 bound to the arf guanine nucleotide exchange factor gea2 0.7496 26 198
7pub-assembly1.cif.gz_IA late assembly intermediate of the trypanosoma brucei mitoribosomal small subunit 0.7471 22 198
2erx-assembly2.cif.gz_B crystal structure of diras2 in complex with gdp and inorganic phosphate 0.747 25 198
4w29-assembly1.cif.gz_AY 70s ribosome translocation intermediate containing elongation factor efg/gdp/fusidic acid, mrna, and trnas trapped in the ap/ap pe/e chimeric hybrid state. 0.7461 26 167
ID Description Score Start End Superfamily
af_O50391_4_190_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8368 16 198 3.40.50.300
af_O50391_4_190_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.815 16 198 3.40.50.300
af_Q58735_1_154_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8123 25 195 3.40.50.300
af_Q9QXJ4_75_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7846 25 181 3.40.50.300
af_Q58735_1_154_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7838 25 195 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0F0H0N9-F1-model_v4 ATP-binding protein 0.9926 111 203 GO:0005524
GO:0005525
GO:0016787
AF-A0A5R8YHJ6-F1-model_v4 ATP-binding protein 0.9907 102 203 GO:0005524
GO:0005525
GO:0016787
AF-A0A1I1VGF8-F1-model_v4 ATP-binding protein 0.9877 122 201
AF-A0A838S6T3-F1-model_v4 ATP-binding protein 0.9866 121 204 GO:0005524
AF-A0A510TK95-F1-model_v4 ATP-binding protein 0.9865 107 201 GO:0005525
GO:0016787

Feature Viewer

pLDDT pTM Quality
81.16 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map