F441947

General Info

Members Datasets Scaffolds Average Seq Length
429 281 858 150

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_102690361|Ga0307409_1026903611
Length 136
Sequence MSAKKSEGFTAEERAAMRERAKELKAGESAVLAKIAEMQGPDRAMAKRLHEIVKASAPALLPKTWYGMPAYAKEDGKVVCFFQSAKKFDSRYATLGFSDEANLDDEGAMWPTSFALKELSATEEAKISALVKRAVS

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
80 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
265 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0.93
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 5.13
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_102690361 3300031995 Bacteria 526
2 JGI25164J39214_1001741 3300002772 Bacteria 4329
3 JGI25165J46597_1001395 3300003214 Bacteria 13230
4 JGI25407J50210_10002363 3300003373 Bacteria 4433
5 Ga0065715_10549204 3300005293 Bacteria 742
6 Ga0070676_10002031 3300005328 Bacteria 10277
7 Ga0070683_100022785 3300005329 Bacteria 5601
8 Ga0070683_101024956 3300005329 Bacteria 792
9 Ga0070690_100150408 3300005330 Bacteria 1588
10 Ga0068869_100031714 3300005334 Bacteria 3718
11 Ga0070666_10581918 3300005335 Bacteria 816
12 Ga0070680_100119628 3300005336 Bacteria 2198
13 Ga0070682_100025427 3300005337 Bacteria 3533
14 Ga0070682_100029543 3300005337 Bacteria 3301
15 Ga0070682_100687034 3300005337 Bacteria 819
16 Ga0068868_100010908 3300005338 Bacteria 6595
17 Ga0068868_100139785 3300005338 Bacteria 1987
18 Ga0070660_101148141 3300005339 Bacteria 658
19 Ga0070691_10030108 3300005341 Bacteria 2542
20 Ga0070661_100038591 3300005344 Bacteria 3477
21 Ga0070692_10033160 3300005345 Unclassified 2602
22 Ga0070668_100013900 3300005347 Bacteria 6020
23 Ga0070668_100032124 3300005347 Bacteria 3995
24 Ga0070669_100166593 3300005353 Bacteria 1716
25 Ga0070675_100017780 3300005354 Bacteria 5655
26 Ga0070674_100000038 3300005356 Bacteria 58036
27 Ga0070674_100103351 3300005356 Bacteria 2080
28 Ga0070659_100945302 3300005366 Unclassified 755
29 Ga0070667_100112100 3300005367 Bacteria 2366
30 Ga0070714_100038303 3300005435 Bacteria 4031
31 Ga0070714_100394166 3300005435 Bacteria 1307
32 Ga0070713_100149649 3300005436 Bacteria 2075
33 Ga0070701_10253435 3300005438 Bacteria 1064
34 Ga0070705_100001296 3300005440 Bacteria 13410
35 Ga0070700_100168217 3300005441 Bacteria 1516
36 Ga0070700_100230183 3300005441 Bacteria 1319
37 Ga0070694_100006748 3300005444 Bacteria 6972
38 Ga0070694_100169379 3300005444 Bacteria 1608
39 Ga0070678_100094699 3300005456 Bacteria 2299
40 Ga0070678_100192671 3300005456 Bacteria 1677
41 Ga0070678_100262882 3300005456 Bacteria 1452
42 Ga0070678_100567035 3300005456 Bacteria 1010
43 Ga0070662_100001357 3300005457 Bacteria 15034
44 Ga0070662_100171371 3300005457 Unclassified 1704
45 Ga0070662_100264955 3300005457 Bacteria 1385
46 Ga0068867_100001385 3300005459 Bacteria 16768
47 Ga0068867_100050431 3300005459 Bacteria 3067
48 Ga0070706_100148086 3300005467 Bacteria 2192
49 Ga0070699_100049245 3300005518 Bacteria 3647
50 Ga0070679_100054400 3300005530 Bacteria 3985
51 Ga0070679_100268404 3300005530 Bacteria 1661
52 Ga0070684_101108106 3300005535 Bacteria 744
53 Ga0070684_101577646 3300005535 Bacteria 619
54 Ga0070697_100000064 3300005536 Bacteria 84569
55 Ga0070672_100031374 3300005543 Bacteria 3998
56 Ga0070686_100284515 3300005544 Bacteria 1221
57 Ga0070686_101548812 3300005544 Bacteria 560
58 Ga0070695_100004293 3300005545 Bacteria 8344
59 Ga0070695_100654502 3300005545 Bacteria 830
60 Ga0070695_101836549 3300005545 Bacteria 509
61 Ga0070696_100002195 3300005546 Bacteria 12863
62 Ga0070696_100023571 3300005546 Bacteria 4183
63 Ga0070693_100006129 3300005547 Bacteria 5826
64 Ga0070693_100007907 3300005547 Bacteria 5218
65 Ga0070664_100035369 3300005564 Bacteria 4193
66 Ga0070664_100048061 3300005564 Bacteria 3606
67 Ga0070664_100563635 3300005564 Bacteria 1054
68 Ga0068857_100274722 3300005577 Bacteria 1549
69 Ga0068854_100003261 3300005578 Bacteria 10105
70 Ga0068856_100295604 3300005614 Bacteria 1637
71 Ga0070702_100002667 3300005615 Bacteria 7789
72 Ga0070702_100070616 3300005615 Bacteria 2062
73 Ga0070702_100205824 3300005615 Bacteria 1306
74 Ga0068866_10001243 3300005718 Bacteria 11055
75 Ga0068866_10076409 3300005718 Bacteria 1786
76 Ga0068866_10405074 3300005718 Bacteria 881
77 Ga0068861_100006477 3300005719 Bacteria 7977
78 Ga0068861_100074586 3300005719 Unclassified 2638
79 Ga0068861_100117702 3300005719 Bacteria 2139
80 Ga0068861_100139977 3300005719 Bacteria 1974
81 Ga0068861_101124606 3300005719 Bacteria 756
82 Ga0068851_10018349 3300005834 Bacteria 3370
83 Ga0068870_10011916 3300005840 Bacteria 4045
84 Ga0068870_10151178 3300005840 Bacteria 1368
85 Ga0068858_100032942 3300005842 Bacteria 4812
86 Ga0068858_100928665 3300005842 Unclassified 851
87 Ga0068860_100322250 3300005843 Bacteria 1517
88 Ga0068862_100038752 3300005844 Bacteria 4044
89 Ga0081455_10067149 3300005937 Bacteria 2990
90 Ga0081538_10003401 3300005981 Bacteria 15062
91 Ga0081538_10065666 3300005981 Bacteria 2041
92 Ga0081538_10097051 3300005981 Bacteria 1499
93 Ga0070717_10245343 3300006028 Bacteria 1581
94 Ga0070717_10344430 3300006028 Bacteria 1331
95 Ga0070715_10001584 3300006163 Bacteria 6695
96 Ga0070716_100320735 3300006173 Bacteria 1085
97 Ga0097621_100060572 3300006237 Bacteria 3103
98 Ga0068871_100039759 3300006358 Bacteria 3765
99 Ga0068871_100797669 3300006358 Bacteria 870
100 Ga0075431_100048808 3300006847 Bacteria 4366
101 Ga0075431_100087355 3300006847 Bacteria 3218
102 Ga0075433_10520422 3300006852 Bacteria 1046
103 Ga0075434_100268122 3300006871 Bacteria 1727
104 Ga0075429_100130539 3300006880 Bacteria 2198
105 Ga0068865_100003522 3300006881 Bacteria 9385
106 Ga0068865_100061139 3300006881 Bacteria 2639
107 Ga0099795_10029316 3300007788 Bacteria 1880
108 Ga0105240_12501820 3300009093 Unclassified 534
109 Ga0111539_12863219 3300009094 Archaea 558
110 Ga0105245_10273026 3300009098 Bacteria 1650
111 Ga0105245_11415731 3300009098 Bacteria 745
112 Ga0114129_10077383 3300009147 Bacteria 4627
113 Ga0114129_10162217 3300009147 Bacteria 3052
114 Ga0114129_10195476 3300009147 Bacteria 2743
115 Ga0114129_12116586 3300009147 Bacteria 678
116 Ga0105243_10004784 3300009148 Bacteria 10642
117 Ga0105243_10064196 3300009148 Bacteria 2945
118 Ga0105243_10358852 3300009148 Bacteria 1341
119 Ga0105241_10008154 3300009174 Bacteria 7714
120 Ga0105241_10730410 3300009174 Bacteria 906
121 Ga0105242_10001493 3300009176 Bacteria 18419
122 Ga0105242_10094729 3300009176 Bacteria 2519
123 Ga0105242_10148404 3300009176 Bacteria 2042
124 Ga0105248_10003036 3300009177 Bacteria 18617
125 Ga0105238_10574007 3300009551 Bacteria 1134
126 Ga0105249_10010901 3300009553 Bacteria 7989
127 Ga0105239_10010913 3300010375 Bacteria 10150
128 Ga0105239_10155241 3300010375 Bacteria 2556
129 Ga0105239_10228660 3300010375 Bacteria 2087
130 Ga0157336_1004094 3300012477 Bacteria 906
131 Ga0157335_1011866 3300012492 Bacteria 721
132 Ga0157373_10292653 3300013100 Bacteria 1155
133 Ga0157371_10467848 3300013102 Bacteria 928
134 Ga0157369_11397384 3300013105 Bacteria 713
135 Ga0157374_10183036 3300013296 Bacteria 2048
136 Ga0157378_10001549 3300013297 Bacteria 20761
137 Ga0157378_10942768 3300013297 Bacteria 895
138 Ga0163162_10003514 3300013306 Bacteria 14986
139 Ga0163162_10007377 3300013306 Bacteria 10694
140 Ga0157372_10871294 3300013307 Bacteria 1045
141 Ga0157375_10277130 3300013308 Bacteria 1840
142 Ga0157375_10416010 3300013308 Bacteria 1510
143 Ga0157375_10642421 3300013308 Bacteria 1218
144 Ga0163163_10223034 3300014325 Bacteria 1934
145 Ga0163163_11301119 3300014325 Bacteria 789
146 Ga0157380_10261993 3300014326 Bacteria 1571
147 Ga0157380_10562559 3300014326 Bacteria 1121
148 Ga0157379_10597622 3300014968 Bacteria 1030
149 Ga0157379_11131878 3300014968 Bacteria 751
150 Ga0157376_10039215 3300014969 Bacteria 3861
151 Ga0157376_10302859 3300014969 Bacteria 1514
152 Ga0206350_10193973 3300020080 Bacteria 1066
153 Ga0224712_10146592 3300022467 Bacteria 1043
154 Ga0207427_100178 3300025231 Bacteria 67956
155 Ga0209437_100304 3300025233 Bacteria 67955
156 Ga0209233_1000287 3300025261 Bacteria 67956
157 Ga0207656_10072950 3300025321 Bacteria 1529
158 Ga0207642_10001413 3300025899 Bacteria 7447
159 Ga0207642_10045027 3300025899 Bacteria 1957
160 Ga0207642_10267944 3300025899 Bacteria 977
161 Ga0207688_10004947 3300025901 Bacteria 7253
162 Ga0207685_10014320 3300025905 Bacteria 2480
163 Ga0207645_10001747 3300025907 Bacteria 17636
164 Ga0207643_10011863 3300025908 Bacteria 4703
165 Ga0207643_10016415 3300025908 Bacteria 4040
166 Ga0207643_10130558 3300025908 Bacteria 1495
167 Ga0207684_10007977 3300025910 Bacteria 9457
168 Ga0207684_10163571 3300025910 Bacteria 1917
169 Ga0207654_10005872 3300025911 Bacteria 6186
170 Ga0207695_11576576 3300025913 Unclassified 537
171 Ga0207671_10268629 3300025914 Bacteria 1343
172 Ga0207693_10021693 3300025915 Bacteria 5105
173 Ga0207660_10151856 3300025917 Bacteria 1780
174 Ga0207660_10536196 3300025917 Bacteria 951
175 Ga0207657_10028764 3300025919 Bacteria 5065
176 Ga0207652_10186547 3300025921 Bacteria 1865
177 Ga0207652_10198524 3300025921 Bacteria 1805
178 Ga0207652_10483553 3300025921 Bacteria 1115
179 Ga0207646_10001379 3300025922 Bacteria 30135
180 Ga0207681_10004196 3300025923 Bacteria 8910
181 Ga0207681_10704966 3300025923 Bacteria 839
182 Ga0207694_10097676 3300025924 Bacteria 2324
183 Ga0207659_10259715 3300025926 Bacteria 1412
184 Ga0207687_10008002 3300025927 Bacteria 6920
185 Ga0207687_10085775 3300025927 Bacteria 2285
186 Ga0207687_11457878 3300025927 Bacteria 588
187 Ga0207700_10884262 3300025928 Bacteria 799
188 Ga0207664_10003765 3300025929 Bacteria 10188
189 Ga0207690_10714509 3300025932 Unclassified 824
190 Ga0207706_10000153 3300025933 Bacteria 75743
191 Ga0207706_10016394 3300025933 Bacteria 6690
192 Ga0207706_10056130 3300025933 Bacteria 3473
193 Ga0207686_10000844 3300025934 Bacteria 18615
194 Ga0207686_10029563 3300025934 Bacteria 3233
195 Ga0207686_10074572 3300025934 Bacteria 2193
196 Ga0207709_10010489 3300025935 Bacteria 5102
197 Ga0207709_10064429 3300025935 Bacteria 2301
198 Ga0207709_10094372 3300025935 Bacteria 1964
199 Ga0207669_10000659 3300025937 Bacteria 14927
200 Ga0207669_10144510 3300025937 Bacteria 1656
201 Ga0207704_10000636 3300025938 Bacteria 15497
202 Ga0207704_10043406 3300025938 Bacteria 2655
203 Ga0207665_10000927 3300025939 Bacteria 19822
204 Ga0207691_10026708 3300025940 Bacteria 5417
205 Ga0207711_10001813 3300025941 Bacteria 19515
206 Ga0207689_10016325 3300025942 Bacteria 6289
207 Ga0207689_10445097 3300025942 Bacteria 1082
208 Ga0207689_10489077 3300025942 Bacteria 1030
209 Ga0207661_10158940 3300025944 Bacteria 1959
210 Ga0207661_10429379 3300025944 Bacteria 1201
211 Ga0207679_10028850 3300025945 Bacteria 3857
212 Ga0207679_10037745 3300025945 Bacteria 3437
213 Ga0207667_10060333 3300025949 Bacteria 3970
214 Ga0207712_10002753 3300025961 Bacteria 11243
215 Ga0207712_10018438 3300025961 Bacteria 4546
216 Ga0207712_10287142 3300025961 Bacteria 1345
217 Ga0207668_10010167 3300025972 Bacteria 5675
218 Ga0207668_10179606 3300025972 Bacteria 1668
219 Ga0207668_10936075 3300025972 Bacteria 772
220 Ga0207640_10004393 3300025981 Bacteria 7642
221 Ga0207677_10196913 3300026023 Bacteria 1598
222 Ga0207703_10089100 3300026035 Bacteria 2591
223 Ga0207703_10090032 3300026035 Unclassified 2578
224 Ga0207639_10255701 3300026041 Bacteria 1529
225 Ga0207678_10608386 3300026067 Bacteria 958
226 Ga0207708_10024416 3300026075 Bacteria 4573
227 Ga0207708_10108907 3300026075 Bacteria 2149
228 Ga0207708_10151660 3300026075 Bacteria 1825
229 Ga0207708_10821451 3300026075 Bacteria 801
230 Ga0207641_10868055 3300026088 Bacteria 895
231 Ga0207641_11513522 3300026088 Bacteria 673
232 Ga0207648_10000028 3300026089 Bacteria 130116
233 Ga0207648_10047854 3300026089 Bacteria 3746
234 Ga0207648_10167385 3300026089 Bacteria 1942
235 Ga0207676_10979331 3300026095 Bacteria 832
236 Ga0207674_10303787 3300026116 Bacteria 1545
237 Ga0207675_100011982 3300026118 Bacteria 8103
238 Ga0207675_100016101 3300026118 Bacteria 6984
239 Ga0207675_100094556 3300026118 Bacteria 2812
240 Ga0207675_101058481 3300026118 Bacteria 830
241 Ga0207683_10004424 3300026121 Bacteria 12146
242 Ga0207683_10275947 3300026121 Bacteria 1536
243 Ga0207683_10543947 3300026121 Bacteria 1073
244 Ga0209179_1021074 3300027512 Bacteria 1270
245 Ga0268265_10020616 3300028380 Bacteria 4603
246 Ga0268264_10002359 3300028381 Bacteria 16660
247 Ga0268264_10126904 3300028381 Bacteria 2256
248 Ga0265332_10074513 3300031238 Bacteria 1443
249 Ga0265325_10003223 3300031241 Bacteria 10737
250 Ga0265325_10375840 3300031241 Bacteria 625
251 Ga0265339_10002333 3300031249 Bacteria 13651
252 Ga0265331_10000014 3300031250 Bacteria 294002
253 Ga0307408_100144684 3300031548 Bacteria 1870
254 Ga0307408_101116840 3300031548 Bacteria 732
255 Ga0265313_10000391 3300031595 Bacteria 47272
256 Ga0265314_10000164 3300031711 Bacteria 101134
257 Ga0316577_10109650 3300031733 Bacteria 1549
258 Ga0307413_10573038 3300031824 Bacteria 919
259 Ga0307410_10015346 3300031852 Bacteria 4541
260 Ga0307406_10007789 3300031901 Bacteria 5955
261 Ga0307412_10296380 3300031911 Bacteria 1276
262 Ga0307409_100014123 3300031995 Bacteria 5177
263 Ga0307416_100023881 3300032002 Bacteria 4448
264 Ga0307411_10430747 3300032005 Bacteria 1098
265 Ga0307415_100033589 3300032126 Bacteria 3331
266 Ga0307415_100436348 3300032126 Bacteria 1128
267 Ga0316593_10064183 3300032168 Bacteria 1260
268 Ga0316593_10374209 3300032168 Bacteria 548
269 Ga0373926_0440427 3300035083 Bacteria 516
270 Ga0373934_0060833 3300035086 Bacteria 1504
271 Ga0373940_0009187 3300035088 Bacteria 2292
272 Ga0373951_0045108 3300035091 Bacteria 1072
273 Ga0373932_0208878 3300035112 Bacteria 697
274 Ga0373936_0113677 3300035113 Bacteria 1151
275 Ga0373939_0099905 3300035114 Bacteria 994
276 Ga0373945_0043222 3300035116 Bacteria 1634
277 Ga0373953_0057946 3300035117 Bacteria 1578
278 Ga0373954_0001387 3300035118 Bacteria 9806
279 Ga0373956_0007325 3300035119 Bacteria 4440
280 Ga0373957_0017294 3300035120 Bacteria 2508
281 Ga0373960_0113632 3300035121 Bacteria 891
282 Ga0373943_0057670 3300035170 Bacteria 1930
283 Ga0373946_0079537 3300035171 Bacteria 1432
284 Ga0373955_0009602 3300035172 Bacteria 4540
285 Ga0373955_0014960 3300035172 Bacteria 3789
286 Ga0373924_0019892 3300035410 Bacteria 2605
287 Ga0373935_0071238 3300035692 Bacteria 2242
288 Ga0373927_0020334 3300035695 Bacteria 4354
289 Ga0373927_0094554 3300035695 Bacteria 1942
290 Ga0373933_0006607 3300035724 Bacteria 6320
291 Ga0373933_0018744 3300035724 Bacteria 3896
292 Ga0373947_0002543 3300035725 Bacteria 10958
293 Ga0373937_0007676 3300036401 Bacteria 9346
294 Ga0373937_0574622 3300036401 Bacteria 1070
295 Ga0373925_0000824 3300037068 Bacteria 28544
296 Ga0373925_0925861 3300037068 Bacteria 718
297 Ga0395899_0103588 3300037312 Bacteria 2052
298 Ga0395899_0575124 3300037312 Bacteria 721
299 Ga0395900_0065131 3300037418 Bacteria 3743
300 Ga0395900_0725383 3300037418 Bacteria 926
301 Ga0395898_0177200 3300037466 Bacteria 2037
302 Ga0395898_0876703 3300037466 Bacteria 836
303 Ga0395905_0893072 3300037471 Bacteria 792
304 Ga0436365_1696946 3300039437 Bacteria 1427
305 Ga0439463_097451 3300042016 Bacteria 758
306 Ga0439464_0098507 3300042439 Bacteria 887
307 Ga0453684_0135813 3300044712 Bacteria 2945
308 Ga0466971_0264152 3300044719 Bacteria 822
309 Ga0466971_0346988 3300044719 Bacteria 718
310 Ga0466957_0129052 3300044842 Bacteria 1618
311 Ga0451576_0004416 3300045051 Bacteria 18293
312 Ga0451576_0859937 3300045051 Bacteria 952
313 Ga0466958_0603228 3300045836 Bacteria 714
314 Ga0495592_0418003 3300046454 Bacteria 846
315 Ga0495603_0134330 3300046455 Bacteria 1440
316 Ga0495603_0640679 3300046455 Bacteria 608
317 Ga0495629_0025533 3300046459 Bacteria 4197
318 Ga0495641_0019538 3300046461 Bacteria 3463
319 Ga0495651_0185971 3300046462 Bacteria 1466
320 Ga0495653_0036370 3300046463 Bacteria 3878
321 Ga0495653_0144413 3300046463 Bacteria 1670
322 Ga0495582_0003778 3300046473 Bacteria 8535
323 Ga0495582_0145554 3300046473 Archaea 1344
324 Ga0495639_0000471 3300046475 Bacteria 19185
325 Ga0495585_0112193 3300046492 Bacteria 1449
326 Ga0495608_0009988 3300046511 Bacteria 6625
327 Ga0495618_0006475 3300046514 Bacteria 7109
328 Ga0495628_0074654 3300046516 Bacteria 2641
329 Ga0495630_0000547 3300046517 Bacteria 27532
330 Ga0495666_0058529 3300046526 Bacteria 1843
331 Ga0495652_0007005 3300046529 Bacteria 10418
332 Ga0495652_0282188 3300046529 Bacteria 1215
333 Ga0495665_0188509 3300046531 Bacteria 1070
334 Ga0495640_0000687 3300046533 Bacteria 25269
335 Ga0495586_0294091 3300046535 Bacteria 930
336 Ga0495587_0002346 3300046536 Bacteria 12653
337 Ga0495587_0101911 3300046536 Bacteria 1653
338 Ga0495645_0045435 3300046543 Bacteria 3204
339 Ga0495667_0014904 3300046559 Bacteria 5252
340 Ga0495634_0002956 3300046642 Bacteria 13882
341 Ga0495635_0004159 3300046663 Bacteria 10037
342 Ga0495635_0549520 3300046663 Bacteria 757
343 Ga0495635_0964759 3300046663 Bacteria 544
344 Ga0495659_0142894 3300046664 Bacteria 956
345 Ga0495588_0084773 3300046674 Bacteria 1656
346 Ga0495657_0001269 3300046675 Bacteria 21972
347 Ga0495599_0010769 3300046678 Bacteria 5603
348 Ga0495647_0001396 3300046681 Bacteria 7451
349 Ga0495647_0042986 3300046681 Bacteria 1727
350 Ga0495647_0159594 3300046681 Bacteria 971
351 Ga0495658_0005973 3300046683 Bacteria 5978
352 Ga0495624_0070584 3300046690 Bacteria 2174
353 Ga0495600_0080566 3300046809 Bacteria 2125
354 Ga0495660_0178783 3300046810 Bacteria 1028
355 Ga0495581_0013939 3300047315 Bacteria 4662
356 Ga0495581_0190096 3300047315 Archaea 1201
357 Ga0495581_0329456 3300047315 Bacteria 892
358 Ga0495604_0004226 3300047317 Bacteria 11365
359 Ga0495674_0053415 3300047319 Bacteria 3552
360 Ga0495674_0373143 3300047319 Bacteria 1155
361 Ga0495676_0049920 3300047321 Bacteria 3359
362 Ga0495680_0241618 3300047322 Bacteria 1282
363 Ga0495680_0246074 3300047322 Bacteria 1268
364 Ga0495684_0010043 3300047471 Bacteria 7318
365 Ga0495684_0084775 3300047471 Bacteria 2403
366 Ga0495684_0154436 3300047471 Bacteria 1715
367 Ga0495593_0006231 3300047673 Bacteria 7006
368 Ga0495602_0088680 3300048088 Bacteria 2574
369 Ga0495602_0311839 3300048088 Bacteria 1148
370 Ga0495614_0040391 3300048089 Bacteria 2002
371 Ga0496100_0096042 3300048903 Bacteria 2033
372 Ga0496102_0080436 3300048905 Bacteria 3002
373 Ga0496102_0838420 3300048905 Bacteria 842
374 Ga0496103_0026344 3300048906 Bacteria 3520
375 Ga0496104_0006252 3300048907 Bacteria 10465
376 Ga0496104_0134587 3300048907 Bacteria 2374
377 Ga0496105_0658026 3300048908 Bacteria 808
378 Ga0496106_0033862 3300048909 Bacteria 3813
379 Ga0496106_0058197 3300048909 Bacteria 2925
380 Ga0496107_0107505 3300048910 Bacteria 2049
381 Ga0496107_0286028 3300048910 Bacteria 1227
382 Ga0496108_0002382 3300048911 Bacteria 15038
383 Ga0496108_0089782 3300048911 Bacteria 2612
384 Ga0496109_0002135 3300048912 Bacteria 16451
385 Ga0496109_0429727 3300048912 Bacteria 1248
386 Ga0496110_0057801 3300048913 Bacteria 3415
387 Ga0496111_0012496 3300048914 Bacteria 5751
388 Ga0496112_0074998 3300048915 Bacteria 3345
389 Ga0496112_0183318 3300048915 Bacteria 2057
390 Ga0496113_0002976 3300048916 Bacteria 10022
391 Ga0496113_0340270 3300048916 Bacteria 1203
392 Ga0496115_0114523 3300048918 Bacteria 2216
393 Ga0496122_0031260 3300048925 Bacteria 4436
394 Ga0496123_0012397 3300048926 Bacteria 7273
395 Ga0501040_0121962 3300049576 Bacteria 1829
396 Ga0501040_0433983 3300049576 Bacteria 945
397 Ga0501041_0154681 3300049577 Bacteria 1433
398 Ga0501041_0493061 3300049577 Bacteria 779
399 Ga0501042_0165700 3300049578 Bacteria 1594
400 Ga0501048_0209610 3300049582 Bacteria 1382
401 Ga0501072_0631295 3300049588 Bacteria 844
402 Ga0501074_0446457 3300049590 Bacteria 917
403 Ga0501074_1271858 3300049590 Bacteria 516
404 Ga0501076_0120809 3300049592 Bacteria 2122
405 Ga0501076_1555684 3300049592 Bacteria 543
406 Ga0501202_178560 3300049652 Bacteria 571
407 Ga0501261_058143 3300049690 Bacteria 650
408 Ga0501079_0485827 3300049741 Bacteria 971
409 Ga0501045_0845163 3300049824 Bacteria 673
410 nmdc:mga05p37_1334555_c1 3300050507 Bacteria 728
411 nmdc:mga05p37_34129_c1 3300050507 Bacteria 6232
412 nmdc:mga05p37_60574_c1 3300050507 Bacteria 4660
413 nmdc:mga09592_28571_c1 3300050508 Bacteria 4633
414 nmdc:mga09592_628436_c1 3300050508 Bacteria 918
415 nmdc:mga06r32_157057_c1 3300050510 Bacteria 2256
416 nmdc:mga06r32_510188_c1 3300050510 Bacteria 1179
417 nmdc:mga08y16_1381051_c1 3300050511 Bacteria 668
418 nmdc:mga0n895_1796722_c1 3300050512 Bacteria 574
419 nmdc:mga08x19_114338_c1 3300050514 Bacteria 1803
420 nmdc:mga0a205_50957_c2 3300050515 Bacteria 3614
421 nmdc:mga0a205_7450_c1 3300050515 Bacteria 9397
422 nmdc:mga0a205_90687_c1 3300050515 Bacteria 2953
423 Ga0495601_0525075 3300053077 Bacteria 763
424 Ga0495612_0000227 3300053078 Bacteria 23843
425 Ga0495595_0002251 3300053084 Bacteria 7510
426 Ga0501084_0295936 3300054114 Bacteria 1367
427 Ga0501082_0131458 3300060353 Bacteria 2172
428 Ga0530510_0953569 3300061734 Bacteria 656
429 8001785511 8001781756 Bacteria 9586736
430 Ga0307409_102690361
431 JGI25164J39214_1001741
432 JGI25165J46597_1001395
433 JGI25407J50210_10002363
434 Ga0065715_10549204
435 Ga0070676_10002031
436 Ga0070683_100022785
437 Ga0070683_101024956
438 Ga0070690_100150408
439 Ga0068869_100031714
440 Ga0070666_10581918
441 Ga0070680_100119628
442 Ga0070682_100025427
443 Ga0070682_100029543
444 Ga0070682_100687034
445 Ga0068868_100010908
446 Ga0068868_100139785
447 Ga0070660_101148141
448 Ga0070691_10030108
449 Ga0070661_100038591
450 Ga0070692_10033160
451 Ga0070668_100013900
452 Ga0070668_100032124
453 Ga0070669_100166593
454 Ga0070675_100017780
455 Ga0070674_100000038
456 Ga0070674_100103351
457 Ga0070659_100945302
458 Ga0070667_100112100
459 Ga0070714_100038303
460 Ga0070714_100394166
461 Ga0070713_100149649
462 Ga0070701_10253435
463 Ga0070705_100001296
464 Ga0070700_100168217
465 Ga0070700_100230183
466 Ga0070694_100006748
467 Ga0070694_100169379
468 Ga0070678_100094699
469 Ga0070678_100192671
470 Ga0070678_100262882
471 Ga0070678_100567035
472 Ga0070662_100001357
473 Ga0070662_100171371
474 Ga0070662_100264955
475 Ga0068867_100001385
476 Ga0068867_100050431
477 Ga0070706_100148086
478 Ga0070699_100049245
479 Ga0070679_100054400
480 Ga0070679_100268404
481 Ga0070684_101108106
482 Ga0070684_101577646
483 Ga0070697_100000064
484 Ga0070672_100031374
485 Ga0070686_100284515
486 Ga0070686_101548812
487 Ga0070695_100004293
488 Ga0070695_100654502
489 Ga0070695_101836549
490 Ga0070696_100002195
491 Ga0070696_100023571
492 Ga0070693_100006129
493 Ga0070693_100007907
494 Ga0070664_100035369
495 Ga0070664_100048061
496 Ga0070664_100563635
497 Ga0068857_100274722
498 Ga0068854_100003261
499 Ga0068856_100295604
500 Ga0070702_100002667
501 Ga0070702_100070616
502 Ga0070702_100205824
503 Ga0068866_10001243
504 Ga0068866_10076409
505 Ga0068866_10405074
506 Ga0068861_100006477
507 Ga0068861_100074586
508 Ga0068861_100117702
509 Ga0068861_100139977
510 Ga0068861_101124606
511 Ga0068851_10018349
512 Ga0068870_10011916
513 Ga0068870_10151178
514 Ga0068858_100032942
515 Ga0068858_100928665
516 Ga0068860_100322250
517 Ga0068862_100038752
518 Ga0081455_10067149
519 Ga0081538_10003401
520 Ga0081538_10065666
521 Ga0081538_10097051
522 Ga0070717_10245343
523 Ga0070717_10344430
524 Ga0070715_10001584
525 Ga0070716_100320735
526 Ga0097621_100060572
527 Ga0068871_100039759
528 Ga0068871_100797669
529 Ga0075431_100048808
530 Ga0075431_100087355
531 Ga0075433_10520422
532 Ga0075434_100268122
533 Ga0075429_100130539
534 Ga0068865_100003522
535 Ga0068865_100061139
536 Ga0099795_10029316
537 Ga0105240_12501820
538 Ga0111539_12863219
539 Ga0105245_10273026
540 Ga0105245_11415731
541 Ga0114129_10077383
542 Ga0114129_10162217
543 Ga0114129_10195476
544 Ga0114129_12116586
545 Ga0105243_10004784
546 Ga0105243_10064196
547 Ga0105243_10358852
548 Ga0105241_10008154
549 Ga0105241_10730410
550 Ga0105242_10001493
551 Ga0105242_10094729
552 Ga0105242_10148404
553 Ga0105248_10003036
554 Ga0105238_10574007
555 Ga0105249_10010901
556 Ga0105239_10010913
557 Ga0105239_10155241
558 Ga0105239_10228660
559 Ga0157336_1004094
560 Ga0157335_1011866
561 Ga0157373_10292653
562 Ga0157371_10467848
563 Ga0157369_11397384
564 Ga0157374_10183036
565 Ga0157378_10001549
566 Ga0157378_10942768
567 Ga0163162_10003514
568 Ga0163162_10007377
569 Ga0157372_10871294
570 Ga0157375_10277130
571 Ga0157375_10416010
572 Ga0157375_10642421
573 Ga0163163_10223034
574 Ga0163163_11301119
575 Ga0157380_10261993
576 Ga0157380_10562559
577 Ga0157379_10597622
578 Ga0157379_11131878
579 Ga0157376_10039215
580 Ga0157376_10302859
581 Ga0206350_10193973
582 Ga0224712_10146592
583 Ga0207427_100178
584 Ga0209437_100304
585 Ga0209233_1000287
586 Ga0207656_10072950
587 Ga0207642_10001413
588 Ga0207642_10045027
589 Ga0207642_10267944
590 Ga0207688_10004947
591 Ga0207685_10014320
592 Ga0207645_10001747
593 Ga0207643_10011863
594 Ga0207643_10016415
595 Ga0207643_10130558
596 Ga0207684_10007977
597 Ga0207684_10163571
598 Ga0207654_10005872
599 Ga0207695_11576576
600 Ga0207671_10268629
601 Ga0207693_10021693
602 Ga0207660_10151856
603 Ga0207660_10536196
604 Ga0207657_10028764
605 Ga0207652_10186547
606 Ga0207652_10198524
607 Ga0207652_10483553
608 Ga0207646_10001379
609 Ga0207681_10004196
610 Ga0207681_10704966
611 Ga0207694_10097676
612 Ga0207659_10259715
613 Ga0207687_10008002
614 Ga0207687_10085775
615 Ga0207687_11457878
616 Ga0207700_10884262
617 Ga0207664_10003765
618 Ga0207690_10714509
619 Ga0207706_10000153
620 Ga0207706_10016394
621 Ga0207706_10056130
622 Ga0207686_10000844
623 Ga0207686_10029563
624 Ga0207686_10074572
625 Ga0207709_10010489
626 Ga0207709_10064429
627 Ga0207709_10094372
628 Ga0207669_10000659
629 Ga0207669_10144510
630 Ga0207704_10000636
631 Ga0207704_10043406
632 Ga0207665_10000927
633 Ga0207691_10026708
634 Ga0207711_10001813
635 Ga0207689_10016325
636 Ga0207689_10445097
637 Ga0207689_10489077
638 Ga0207661_10158940
639 Ga0207661_10429379
640 Ga0207679_10028850
641 Ga0207679_10037745
642 Ga0207667_10060333
643 Ga0207712_10002753
644 Ga0207712_10018438
645 Ga0207712_10287142
646 Ga0207668_10010167
647 Ga0207668_10179606
648 Ga0207668_10936075
649 Ga0207640_10004393
650 Ga0207677_10196913
651 Ga0207703_10089100
652 Ga0207703_10090032
653 Ga0207639_10255701
654 Ga0207678_10608386
655 Ga0207708_10024416
656 Ga0207708_10108907
657 Ga0207708_10151660
658 Ga0207708_10821451
659 Ga0207641_10868055
660 Ga0207641_11513522
661 Ga0207648_10000028
662 Ga0207648_10047854
663 Ga0207648_10167385
664 Ga0207676_10979331
665 Ga0207674_10303787
666 Ga0207675_100011982
667 Ga0207675_100016101
668 Ga0207675_100094556
669 Ga0207675_101058481
670 Ga0207683_10004424
671 Ga0207683_10275947
672 Ga0207683_10543947
673 Ga0209179_1021074
674 Ga0268265_10020616
675 Ga0268264_10002359
676 Ga0268264_10126904
677 Ga0265332_10074513
678 Ga0265325_10003223
679 Ga0265325_10375840
680 Ga0265339_10002333
681 Ga0265331_10000014
682 Ga0307408_100144684
683 Ga0307408_101116840
684 Ga0265313_10000391
685 Ga0265314_10000164
686 Ga0316577_10109650
687 Ga0307413_10573038
688 Ga0307410_10015346
689 Ga0307406_10007789
690 Ga0307412_10296380
691 Ga0307409_100014123
692 Ga0307416_100023881
693 Ga0307411_10430747
694 Ga0307415_100033589
695 Ga0307415_100436348
696 Ga0316593_10064183
697 Ga0316593_10374209
698 Ga0373926_0440427
699 Ga0373934_0060833
700 Ga0373940_0009187
701 Ga0373951_0045108
702 Ga0373932_0208878
703 Ga0373936_0113677
704 Ga0373939_0099905
705 Ga0373945_0043222
706 Ga0373953_0057946
707 Ga0373954_0001387
708 Ga0373956_0007325
709 Ga0373957_0017294
710 Ga0373960_0113632
711 Ga0373943_0057670
712 Ga0373946_0079537
713 Ga0373955_0009602
714 Ga0373955_0014960
715 Ga0373924_0019892
716 Ga0373935_0071238
717 Ga0373927_0020334
718 Ga0373927_0094554
719 Ga0373933_0006607
720 Ga0373933_0018744
721 Ga0373947_0002543
722 Ga0373937_0007676
723 Ga0373937_0574622
724 Ga0373925_0000824
725 Ga0373925_0925861
726 Ga0395899_0103588
727 Ga0395899_0575124
728 Ga0395900_0065131
729 Ga0395900_0725383
730 Ga0395898_0177200
731 Ga0395898_0876703
732 Ga0395905_0893072
733 Ga0436365_1696946
734 Ga0439463_097451
735 Ga0439464_0098507
736 Ga0453684_0135813
737 Ga0466971_0264152
738 Ga0466971_0346988
739 Ga0466957_0129052
740 Ga0451576_0004416
741 Ga0451576_0859937
742 Ga0466958_0603228
743 Ga0495592_0418003
744 Ga0495603_0134330
745 Ga0495603_0640679
746 Ga0495629_0025533
747 Ga0495641_0019538
748 Ga0495651_0185971
749 Ga0495653_0036370
750 Ga0495653_0144413
751 Ga0495582_0003778
752 Ga0495582_0145554
753 Ga0495639_0000471
754 Ga0495585_0112193
755 Ga0495608_0009988
756 Ga0495618_0006475
757 Ga0495628_0074654
758 Ga0495630_0000547
759 Ga0495666_0058529
760 Ga0495652_0007005
761 Ga0495652_0282188
762 Ga0495665_0188509
763 Ga0495640_0000687
764 Ga0495586_0294091
765 Ga0495587_0002346
766 Ga0495587_0101911
767 Ga0495645_0045435
768 Ga0495667_0014904
769 Ga0495634_0002956
770 Ga0495635_0004159
771 Ga0495635_0549520
772 Ga0495635_0964759
773 Ga0495659_0142894
774 Ga0495588_0084773
775 Ga0495657_0001269
776 Ga0495599_0010769
777 Ga0495647_0001396
778 Ga0495647_0042986
779 Ga0495647_0159594
780 Ga0495658_0005973
781 Ga0495624_0070584
782 Ga0495600_0080566
783 Ga0495660_0178783
784 Ga0495581_0013939
785 Ga0495581_0190096
786 Ga0495581_0329456
787 Ga0495604_0004226
788 Ga0495674_0053415
789 Ga0495674_0373143
790 Ga0495676_0049920
791 Ga0495680_0241618
792 Ga0495680_0246074
793 Ga0495684_0010043
794 Ga0495684_0084775
795 Ga0495684_0154436
796 Ga0495593_0006231
797 Ga0495602_0088680
798 Ga0495602_0311839
799 Ga0495614_0040391
800 Ga0496100_0096042
801 Ga0496102_0080436
802 Ga0496102_0838420
803 Ga0496103_0026344
804 Ga0496104_0006252
805 Ga0496104_0134587
806 Ga0496105_0658026
807 Ga0496106_0033862
808 Ga0496106_0058197
809 Ga0496107_0107505
810 Ga0496107_0286028
811 Ga0496108_0002382
812 Ga0496108_0089782
813 Ga0496109_0002135
814 Ga0496109_0429727
815 Ga0496110_0057801
816 Ga0496111_0012496
817 Ga0496112_0074998
818 Ga0496112_0183318
819 Ga0496113_0002976
820 Ga0496113_0340270
821 Ga0496115_0114523
822 Ga0496122_0031260
823 Ga0496123_0012397
824 Ga0501040_0121962
825 Ga0501040_0433983
826 Ga0501041_0154681
827 Ga0501041_0493061
828 Ga0501042_0165700
829 Ga0501048_0209610
830 Ga0501072_0631295
831 Ga0501074_0446457
832 Ga0501074_1271858
833 Ga0501076_0120809
834 Ga0501076_1555684
835 Ga0501202_178560
836 Ga0501261_058143
837 Ga0501079_0485827
838 Ga0501045_0845163
839 nmdc:mga05p37_1334555_c1
840 nmdc:mga05p37_34129_c1
841 nmdc:mga05p37_60574_c1
842 nmdc:mga09592_28571_c1
843 nmdc:mga09592_628436_c1
844 nmdc:mga06r32_157057_c1
845 nmdc:mga06r32_510188_c1
846 nmdc:mga08y16_1381051_c1
847 nmdc:mga0n895_1796722_c1
848 nmdc:mga08x19_114338_c1
849 nmdc:mga0a205_50957_c2
850 nmdc:mga0a205_7450_c1
851 nmdc:mga0a205_90687_c1
852 Ga0495601_0525075
853 Ga0495612_0000227
854 Ga0495595_0002251
855 Ga0501084_0295936
856 Ga0501082_0131458
857 Ga0530510_0953569
858 8001785511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6644 57 150
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6336 71 155
7vfm-assembly1.cif.gz_A crystal structure of sdgb (udp and sd peptide-binding form) 0.5569 74 122
7ec1-assembly1.cif.gz_B crystal structure of sdgb (ligand-free form) 0.5342 75 122
7vfk-assembly1.cif.gz_B crystal structure of sdgb (ligand-free form) 0.5296 74 122
ID Description Score Start End Superfamily
af_Q9VTA7_109_191_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.7417 45 78 1.25.40.90
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7219 54 157 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6597 54 157 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6518 57 151 3.90.1150.200
4gdgA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.6004 92 122 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A7W1IU15-F1-model_v4 DUF1801 domain-containing protein 0.9996 54 158
AF-A0A7C2F2Y7-F1-model_v4 DUF1801 domain-containing protein 0.9975 43 158
AF-A0A535T070-F1-model_v4 DUF1801 domain-containing protein 0.9894 90 158
AF-A0A4V0XH56-F1-model_v4 YdhG-like domain-containing protein 0.989 83 158
AF-F0T5S3-F1-model_v4 Uncharacterized protein 0.9879 51 159

Map