F441870

General Info

Members Datasets Scaffolds Average Seq Length
429 199 428 228

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10015097|Ga0068851_100150973
Length 260
Sequence MVNGQRSMVNGQWSIGCSSYNCLSSKKIVVEKLANIYEEGQVLLIDKPYEWTSFDVIQKIRSLIKIRKVGHAGTLDPLATGLLIVCTGKFTKRINEYMAQQKEYTGSITLGATTPTFDLESRPENAKDITGITADQIKSATQAFTGEIMQVPPMHSAIKKDGKRVYEMARRGEMIELEPRKLFIEAFDITAIDKPVVQFRVRCSTGTYIRSLANDFGAALGCGGYLSSLCRTGIGEFRLENAMSIQQLEEQVKGAFNQKG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
194 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
197 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
198 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
199 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 0
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11197818 2162886012 Bacteria 1270
2 ARcpr5yngRDRAFT_c004441 3300000043 Bacteria 1329
3 JGI24751J29686_10000622 3300002459 Bacteria 9159
4 rootH2_10089851 3300003320 Bacteria 1911
5 rootH1_10009908 3300003323 Bacteria 24135
6 Ga0065712_10003918 3300005290 Bacteria 6847
7 Ga0065712_10014196 3300005290 Bacteria 2888
8 Ga0065715_10021413 3300005293 Archaea 1553
9 Ga0065715_10177508 3300005293 Bacteria 1498
10 Ga0065707_10233650 3300005295 Bacteria 1179
11 Ga0070658_10024622 3300005327 Bacteria 4827
12 Ga0070658_10672564 3300005327 Bacteria 898
13 Ga0070676_10024048 3300005328 Bacteria 3428
14 Ga0070676_10047519 3300005328 Bacteria 2506
15 Ga0070683_100108019 3300005329 Unclassified 2624
16 Ga0070683_100197586 3300005329 Bacteria 1910
17 Ga0070690_100035825 3300005330 Bacteria 3116
18 Ga0070690_100147819 3300005330 Bacteria 1600
19 Ga0070670_100026345 3300005331 Bacteria 5004
20 Ga0070670_100057010 3300005331 Bacteria 3353
21 Ga0070670_100133505 3300005331 Unclassified 2144
22 Ga0070670_100203861 3300005331 Bacteria 1719
23 Ga0070677_10007928 3300005333 Bacteria 3557
24 Ga0070677_10014351 3300005333 Bacteria 2787
25 Ga0070677_10207706 3300005333 Bacteria 949
26 Ga0068869_100011151 3300005334 Bacteria 5891
27 Ga0068869_100031822 3300005334 Bacteria 3713
28 Ga0068869_100058402 3300005334 Bacteria 2821
29 Ga0068869_100190952 3300005334 Bacteria 1610
30 Ga0070666_10000411 3300005335 Bacteria 26651
31 Ga0070680_100228152 3300005336 Bacteria 1572
32 Ga0068868_100027731 3300005338 Bacteria 4322
33 Ga0068868_100038230 3300005338 Bacteria 3725
34 Ga0068868_100148866 3300005338 Bacteria 1927
35 Ga0070660_100551440 3300005339 Bacteria 962
36 Ga0070660_100633643 3300005339 Bacteria 895
37 Ga0070689_100006400 3300005340 Bacteria 8147
38 Ga0070689_100024299 3300005340 Bacteria 4544
39 Ga0070689_100564193 3300005340 Bacteria 982
40 Ga0070687_100028470 3300005343 Bacteria 2711
41 Ga0070687_100108178 3300005343 Bacteria 1569
42 Ga0070661_100001597 3300005344 Bacteria 15722
43 Ga0070661_100003810 3300005344 Unclassified 10392
44 Ga0070668_100134289 3300005347 Bacteria 1988
45 Ga0070669_100007374 3300005353 Bacteria 7887
46 Ga0070669_100041209 3300005353 Bacteria 3358
47 Ga0070669_100171851 3300005353 Bacteria 1690
48 Ga0070675_100005760 3300005354 Bacteria 9478
49 Ga0070675_100027925 3300005354 Unclassified 4537
50 Ga0070675_100053791 3300005354 Bacteria 3311
51 Ga0070675_100129749 3300005354 Bacteria 2147
52 Ga0070671_100034349 3300005355 Unclassified 4197
53 Ga0070671_100042435 3300005355 Bacteria 3781
54 Ga0070671_100117842 3300005355 Bacteria 2233
55 Ga0070671_100876705 3300005355 Bacteria 783
56 Ga0070674_100015730 3300005356 Bacteria 4730
57 Ga0070673_100042491 3300005364 Unclassified 3505
58 Ga0070673_100192110 3300005364 Bacteria 1754
59 Ga0070673_100265629 3300005364 Bacteria 1500
60 Ga0070688_100003837 3300005365 Bacteria 7792
61 Ga0070688_100009259 3300005365 Bacteria 5376
62 Ga0070688_100249711 3300005365 Unclassified 1263
63 Ga0070688_100492454 3300005365 Bacteria 923
64 Ga0070659_100129777 3300005366 Unclassified 2046
65 Ga0070659_100236854 3300005366 Bacteria 1509
66 Ga0070659_100655439 3300005366 Bacteria 905
67 Ga0070667_100009646 3300005367 Bacteria 8008
68 Ga0070667_100016897 3300005367 Bacteria 6038
69 Ga0070701_10077186 3300005438 Bacteria 1795
70 Ga0070662_100021168 3300005457 Bacteria 4438
71 Ga0070662_100053950 3300005457 Bacteria 2912
72 Ga0070662_100151881 3300005457 Bacteria 1804
73 Ga0070681_10013719 3300005458 Bacteria 8066
74 Ga0070681_10018183 3300005458 Bacteria 7028
75 Ga0070681_10061630 3300005458 Bacteria 3725
76 Ga0070681_10195096 3300005458 Bacteria 1944
77 Ga0068867_100153359 3300005459 Bacteria 1811
78 Ga0068867_100526567 3300005459 Bacteria 1020
79 Ga0070698_100006546 3300005471 Bacteria 12634
80 Ga0070698_100023080 3300005471 Bacteria 6505
81 Ga0070698_101115572 3300005471 Bacteria 737
82 Ga0070679_100094333 3300005530 Bacteria 2979
83 Ga0070684_100002262 3300005535 Bacteria 14170
84 Ga0070684_100004285 3300005535 Bacteria 10821
85 Ga0070684_100184231 3300005535 Bacteria 1899
86 Ga0070697_100724881 3300005536 Bacteria 878
87 Ga0068853_100013552 3300005539 Bacteria 6663
88 Ga0068853_100048622 3300005539 Unclassified 3644
89 Ga0068853_100318864 3300005539 Bacteria 1440
90 Ga0070672_100048000 3300005543 Bacteria 3315
91 Ga0070672_100114418 3300005543 Bacteria 2202
92 Ga0070672_100137351 3300005543 Bacteria 2014
93 Ga0070665_100039798 3300005548 Unclassified 4725
94 Ga0070704_100036265 3300005549 Bacteria 3359
95 Ga0068855_100019049 3300005563 Bacteria 8251
96 Ga0068855_100076204 3300005563 Bacteria 3893
97 Ga0070664_100000944 3300005564 Bacteria 22708
98 Ga0070664_100006999 3300005564 Bacteria 9095
99 Ga0070664_100086702 3300005564 Bacteria 2705
100 Ga0070664_100117393 3300005564 Bacteria 2327
101 Ga0068857_100007370 3300005577 Bacteria 9469
102 Ga0068857_100034976 3300005577 Unclassified 4446
103 Ga0068857_100074610 3300005577 Bacteria 3023
104 Ga0068857_100919341 3300005577 Bacteria 839
105 Ga0068854_100026347 3300005578 Bacteria 3995
106 Ga0068854_100160195 3300005578 Bacteria 1742
107 Ga0068856_100063999 3300005614 Bacteria 3633
108 Ga0068852_100400694 3300005616 Bacteria 1350
109 Ga0068852_100588192 3300005616 Unclassified 1116
110 Ga0068859_100000037 3300005617 Bacteria 165480
111 Ga0068859_100013522 3300005617 Bacteria 8186
112 Ga0068859_100051053 3300005617 Bacteria 4156
113 Ga0068859_100077442 3300005617 Bacteria 3366
114 Ga0068859_100126066 3300005617 Bacteria 2629
115 Ga0068859_100845399 3300005617 Bacteria 1001
116 Ga0068864_100007550 3300005618 Bacteria 8960
117 Ga0068864_100012579 3300005618 Bacteria 6996
118 Ga0068864_100028050 3300005618 Bacteria 4757
119 Ga0068864_100799998 3300005618 Bacteria 926
120 Ga0068866_10073367 3300005718 Unclassified 1816
121 Ga0068861_100003218 3300005719 Bacteria 10803
122 Ga0068851_10015097 3300005834 Bacteria 3676
123 Ga0068851_10318066 3300005834 Unclassified 898
124 Ga0068870_10014138 3300005840 Bacteria 3765
125 Ga0068870_10015455 3300005840 Bacteria 3622
126 Ga0068870_10556082 3300005840 Unclassified 773
127 Ga0068863_100045282 3300005841 Bacteria 4176
128 Ga0068863_100199289 3300005841 Bacteria 1925
129 Ga0068863_100445706 3300005841 Bacteria 1270
130 Ga0068858_100010795 3300005842 Bacteria 8634
131 Ga0068858_100148358 3300005842 Bacteria 2204
132 Ga0068858_100278713 3300005842 Bacteria 1592
133 Ga0068860_100000916 3300005843 Bacteria 32698
134 Ga0068860_100346137 3300005843 Bacteria 1462
135 Ga0068860_100564835 3300005843 Bacteria 1141
136 Ga0068862_100029579 3300005844 Bacteria 4616
137 Ga0068862_100031801 3300005844 Bacteria 4457
138 Ga0075366_10030265 3300006195 Bacteria 3182
139 Ga0075366_10155737 3300006195 Bacteria 1384
140 Ga0097621_100036275 3300006237 Bacteria 3944
141 Ga0097621_100256275 3300006237 Unclassified 1533
142 Ga0097621_100538915 3300006237 Bacteria 1061
143 Ga0068871_100047922 3300006358 Bacteria 3447
144 Ga0068871_100189571 3300006358 Bacteria 1771
145 Ga0068871_100294565 3300006358 Bacteria 1423
146 Ga0068871_100434726 3300006358 Bacteria 1174
147 Ga0075428_100034778 3300006844 Bacteria 5556
148 Ga0075428_100494305 3300006844 Bacteria 1309
149 Ga0075430_100001013 3300006846 Bacteria 22221
150 Ga0075431_100021532 3300006847 Bacteria 6595
151 Ga0075431_100249899 3300006847 Bacteria 1802
152 Ga0075429_100001439 3300006880 Bacteria 19542
153 Ga0068865_100015687 3300006881 Bacteria 4834
154 Ga0068865_100171076 3300006881 Bacteria 1665
155 Ga0068865_100381316 3300006881 Unclassified 1150
156 Ga0097620_100000037 3300006931 Bacteria 165480
157 Ga0097620_100013522 3300006931 Bacteria 8186
158 Ga0097620_100051052 3300006931 Bacteria 4156
159 Ga0097620_100077443 3300006931 Bacteria 3366
160 Ga0097620_100126062 3300006931 Bacteria 2629
161 Ga0097620_100845368 3300006931 Bacteria 1001
162 Ga0105251_10113000 3300009011 Bacteria 1236
163 Ga0111539_10024449 3300009094 Bacteria 7411
164 Ga0111539_10071521 3300009094 Bacteria 4093
165 Ga0111539_10134204 3300009094 Unclassified 2898
166 Ga0111539_10633899 3300009094 Bacteria 1244
167 Ga0105245_10437464 3300009098 Bacteria 1314
168 Ga0105247_10002502 3300009101 Bacteria 12491
169 Ga0105247_10005053 3300009101 Bacteria 8368
170 Ga0114129_10022504 3300009147 Bacteria 8944
171 Ga0114129_10288086 3300009147 Bacteria 2192
172 Ga0105241_10542017 3300009174 Unclassified 1043
173 Ga0105242_10206237 3300009176 Bacteria 1748
174 Ga0105248_10206973 3300009177 Bacteria 2211
175 Ga0105237_10004816 3300009545 Bacteria 15503
176 Ga0105237_10006816 3300009545 Bacteria 12597
177 Ga0105249_10022411 3300009553 Bacteria 5657
178 Ga0105249_10023785 3300009553 Bacteria 5502
179 Ga0105249_10030757 3300009553 Bacteria 4853
180 Ga0105249_10031267 3300009553 Bacteria 4814
181 Ga0105249_10052971 3300009553 Bacteria 3708
182 Ga0105249_10230259 3300009553 Bacteria 1827
183 Ga0105239_10013486 3300010375 Bacteria 9075
184 Ga0105239_10246384 3300010375 Bacteria 2006
185 Ga0105246_10037746 3300011119 Bacteria 3243
186 Ga0157373_10005047 3300013100 Bacteria 9916
187 Ga0157373_10028629 3300013100 Unclassified 4019
188 Ga0157373_10117774 3300013100 Bacteria 1867
189 Ga0157371_10003793 3300013102 Bacteria 13524
190 Ga0157371_10077641 3300013102 Bacteria 2351
191 Ga0157370_10001110 3300013104 Bacteria 33701
192 Ga0157370_10065696 3300013104 Bacteria 3432
193 Ga0157370_10488373 3300013104 Bacteria 1131
194 Ga0157369_10342458 3300013105 Bacteria 1553
195 Ga0157369_10565800 3300013105 Bacteria 1174
196 Ga0157374_10003989 3300013296 Bacteria 12402
197 Ga0157374_10018071 3300013296 Bacteria 6219
198 Ga0157374_10050137 3300013296 Bacteria 3879
199 Ga0157374_10295407 3300013296 Bacteria 1602
200 Ga0157378_10003004 3300013297 Bacteria 14995
201 Ga0157378_10040947 3300013297 Bacteria 4109
202 Ga0157378_10068711 3300013297 Unclassified 3177
203 Ga0157378_10090653 3300013297 Bacteria 2778
204 Ga0157378_10105926 3300013297 Bacteria 2572
205 Ga0157378_10448818 3300013297 Unclassified 1279
206 Ga0163162_10006705 3300013306 Bacteria 11162
207 Ga0163162_10019539 3300013306 Bacteria 6649
208 Ga0163162_10060402 3300013306 Bacteria 3826
209 Ga0163162_10155969 3300013306 Bacteria 2403
210 Ga0163162_11149827 3300013306 Unclassified 880
211 Ga0163162_11153507 3300013306 Bacteria 879
212 Ga0157372_10215194 3300013307 Bacteria 2227
213 Ga0157372_10283089 3300013307 Unclassified 1928
214 Ga0157372_10359131 3300013307 Bacteria 1697
215 Ga0157372_10742956 3300013307 Bacteria 1141
216 Ga0157375_10023196 3300013308 Bacteria 5723
217 Ga0157375_10033032 3300013308 Bacteria 4913
218 Ga0157375_10067792 3300013308 Bacteria 3566
219 Ga0157375_10104322 3300013308 Bacteria 2924
220 Ga0157375_10135583 3300013308 Bacteria 2585
221 Ga0157375_11174760 3300013308 Unclassified 900
222 Ga0163163_10002162 3300014325 Bacteria 16606
223 Ga0163163_10014336 3300014325 Bacteria 7286
224 Ga0163163_10079657 3300014325 Bacteria 3274
225 Ga0163163_10245778 3300014325 Unclassified 1839
226 Ga0163163_10726650 3300014325 Bacteria 1056
227 Ga0163163_11462736 3300014325 Unclassified 745
228 Ga0157380_10003097 3300014326 Bacteria 11345
229 Ga0157380_10003645 3300014326 Bacteria 10592
230 Ga0157380_10060046 3300014326 Bacteria 3037
231 Ga0157380_10473041 3300014326 Bacteria 1210
232 Ga0157380_10500953 3300014326 Unclassified 1180
233 Ga0157380_10505024 3300014326 Bacteria 1176
234 Ga0157377_10006845 3300014745 Bacteria 5464
235 Ga0157377_10009750 3300014745 Bacteria 4727
236 Ga0157377_10044805 3300014745 Bacteria 2468
237 Ga0157379_10043233 3300014968 Bacteria 4022
238 Ga0157379_10070058 3300014968 Bacteria 3137
239 Ga0157379_10086051 3300014968 Bacteria 2818
240 Ga0157379_10398576 3300014968 Bacteria 1265
241 Ga0157376_10012013 3300014969 Bacteria 6408
242 Ga0157376_10652144 3300014969 Bacteria 1053
243 Ga0163161_10672286 3300017792 Bacteria 860
244 Ga0209646_1002165 3300025246 Bacteria 4560
245 Ga0207642_10002789 3300025899 Bacteria 5452
246 Ga0207710_10000984 3300025900 Bacteria 14964
247 Ga0207710_10029138 3300025900 Bacteria 2400
248 Ga0207645_10011077 3300025907 Bacteria 6170
249 Ga0207643_10016403 3300025908 Bacteria 4041
250 Ga0207643_10051031 3300025908 Bacteria 2348
251 Ga0207705_10037123 3300025909 Bacteria 3486
252 Ga0207654_10058458 3300025911 Bacteria 2245
253 Ga0207654_10070208 3300025911 Bacteria 2078
254 Ga0207707_10196607 3300025912 Bacteria 1759
255 Ga0207695_10018081 3300025913 Bacteria 8158
256 Ga0207671_10002159 3300025914 Bacteria 21407
257 Ga0207671_10060360 3300025914 Bacteria 2813
258 Ga0207662_10050730 3300025918 Unclassified 2466
259 Ga0207657_10237866 3300025919 Bacteria 1455
260 Ga0207657_10383767 3300025919 Bacteria 1106
261 Ga0207649_10003838 3300025920 Bacteria 8195
262 Ga0207652_10000236 3300025921 Bacteria 57800
263 Ga0207681_10011851 3300025923 Bacteria 5366
264 Ga0207681_10021050 3300025923 Bacteria 4140
265 Ga0207681_10157850 3300025923 Bacteria 1706
266 Ga0207650_10034407 3300025925 Bacteria 3674
267 Ga0207650_10055354 3300025925 Bacteria 2945
268 Ga0207650_10172505 3300025925 Bacteria 1720
269 Ga0207650_10246999 3300025925 Bacteria 1444
270 Ga0207650_10262155 3300025925 Bacteria 1402
271 Ga0207659_10007133 3300025926 Bacteria 6859
272 Ga0207659_10029738 3300025926 Bacteria 3726
273 Ga0207659_10049696 3300025926 Bacteria 2976
274 Ga0207659_10230910 3300025926 Bacteria 1492
275 Ga0207644_10049054 3300025931 Bacteria 3021
276 Ga0207644_10356413 3300025931 Bacteria 1189
277 Ga0207644_10379342 3300025931 Bacteria 1153
278 Ga0207690_10012675 3300025932 Bacteria 5051
279 Ga0207690_10258500 3300025932 Bacteria 1348
280 Ga0207706_10014306 3300025933 Bacteria 7192
281 Ga0207706_10062322 3300025933 Bacteria 3284
282 Ga0207706_10089112 3300025933 Bacteria 2712
283 Ga0207686_10278693 3300025934 Bacteria 1233
284 Ga0207709_10107297 3300025935 Bacteria 1859
285 Ga0207670_10004565 3300025936 Bacteria 7479
286 Ga0207670_10457778 3300025936 Bacteria 1030
287 Ga0207704_10043618 3300025938 Bacteria 2650
288 Ga0207704_10186948 3300025938 Unclassified 1503
289 Ga0207691_10008803 3300025940 Bacteria 9681
290 Ga0207691_10023981 3300025940 Bacteria 5739
291 Ga0207691_10038558 3300025940 Bacteria 4422
292 Ga0207691_10039394 3300025940 Bacteria 4372
293 Ga0207691_10462218 3300025940 Bacteria 1079
294 Ga0207711_10280484 3300025941 Bacteria 1534
295 Ga0207689_10001790 3300025942 Bacteria 20298
296 Ga0207689_10001949 3300025942 Bacteria 19537
297 Ga0207689_10001980 3300025942 Bacteria 19344
298 Ga0207689_10079260 3300025942 Bacteria 2699
299 Ga0207661_10007074 3300025944 Bacteria 7967
300 Ga0207661_10054254 3300025944 Bacteria 3211
301 Ga0207679_10000182 3300025945 Bacteria 51887
302 Ga0207679_10002032 3300025945 Bacteria 12551
303 Ga0207679_10087771 3300025945 Bacteria 2396
304 Ga0207667_10006591 3300025949 Bacteria 14036
305 Ga0207651_10075094 3300025960 Bacteria 2410
306 Ga0207651_10077607 3300025960 Bacteria 2379
307 Ga0207651_10214740 3300025960 Bacteria 1551
308 Ga0207651_10289427 3300025960 Bacteria 1357
309 Ga0207712_10004303 3300025961 Bacteria 8984
310 Ga0207712_10007339 3300025961 Bacteria 6959
311 Ga0207712_10020046 3300025961 Bacteria 4375
312 Ga0207712_10039993 3300025961 Bacteria 3215
313 Ga0207712_10044709 3300025961 Bacteria 3062
314 Ga0207712_10046666 3300025961 Bacteria 3004
315 Ga0207668_10027587 3300025972 Bacteria 3700
316 Ga0207668_10828079 3300025972 Bacteria 820
317 Ga0207640_10012505 3300025981 Bacteria 4837
318 Ga0207640_10118500 3300025981 Unclassified 1891
319 Ga0207640_10126018 3300025981 Bacteria 1844
320 Ga0207658_10023342 3300025986 Bacteria 4317
321 Ga0207658_10031260 3300025986 Bacteria 3779
322 Ga0207658_10253206 3300025986 Bacteria 1497
323 Ga0207658_10907548 3300025986 Unclassified 802
324 Ga0207677_10032935 3300026023 Bacteria 3337
325 Ga0207677_10329709 3300026023 Bacteria 1271
326 Ga0207677_10620161 3300026023 Bacteria 951
327 Ga0207703_10081860 3300026035 Bacteria 2692
328 Ga0207703_10188365 3300026035 Bacteria 1825
329 Ga0207639_10009609 3300026041 Bacteria 6679
330 Ga0207678_10040567 3300026067 Bacteria 4037
331 Ga0207702_10124330 3300026078 Bacteria 2313
332 Ga0207641_10000226 3300026088 Bacteria 72539
333 Ga0207641_10000576 3300026088 Bacteria 40495
334 Ga0207641_10010549 3300026088 Bacteria 7581
335 Ga0207641_10584178 3300026088 Bacteria 1092
336 Ga0207648_10005805 3300026089 Bacteria 12363
337 Ga0207674_10009043 3300026116 Bacteria 11442
338 Ga0207674_10025988 3300026116 Bacteria 6231
339 Ga0207674_10124192 3300026116 Unclassified 2547
340 Ga0207674_10335769 3300026116 Bacteria 1461
341 Ga0207674_10346992 3300026116 Bacteria 1435
342 Ga0207675_100001450 3300026118 Bacteria 23772
343 Ga0207675_100075366 3300026118 Bacteria 3158
344 Ga0207675_100484525 3300026118 Viruses 1230
345 Ga0207675_100520342 3300026118 Bacteria 1186
346 Ga0207683_10005557 3300026121 Bacteria 10800
347 Ga0207683_10170081 3300026121 Bacteria 1973
348 Ga0207698_10337786 3300026142 Bacteria 1417
349 Ga0209995_1011943 3300027471 Unclassified 1414
350 Ga0268265_10019655 3300028380 Bacteria 4701
351 Ga0268265_10142618 3300028380 Bacteria 2008
352 Ga0268264_10002166 3300028381 Bacteria 17515
353 Ga0268264_10094809 3300028381 Bacteria 2581
354 Ga0268264_10179080 3300028381 Bacteria 1924
355 Ga0268264_10264963 3300028381 Bacteria 1603
356 Ga0307515_10002910 3300028794 Bacteria 36374
357 Ga0307513_10296508 3300031456 Unclassified 1386
358 Ga0307416_100450270 3300032002 Bacteria 1340
359 Ga0373937_0093046 3300036401 Bacteria 2795
360 Ga0395899_0021581 3300037312 Bacteria 4883
361 Ga0395899_0061755 3300037312 Bacteria 2759
362 Ga0395900_0271759 3300037418 Bacteria 1689
363 Ga0395900_0695239 3300037418 Bacteria 951
364 Ga0395901_0203344 3300038443 Bacteria 2075
365 Ga0436365_1027072 3300039437 Bacteria 1505
366 Ga0451851_0440419 3300041507 Bacteria 1205
367 Ga0451843_1377229 3300041509 Bacteria 1166
368 Ga0439431_0037629 3300041997 Bacteria 1222
369 Ga0439441_052454 3300042001 Unclassified 843
370 Ga0439457_000201 3300042014 Bacteria 15715
371 Ga0466969_0000728 3300044656 Bacteria 17782
372 Ga0466969_0071734 3300044656 Bacteria 1665
373 Ga0466972_0000348 3300044658 Bacteria 25310
374 Ga0453683_0339919 3300044673 Bacteria 963
375 Ga0466966_0003773 3300044684 Bacteria 9992
376 Ga0466961_0309106 3300044693 Bacteria 965
377 Ga0466968_0063126 3300044735 Unclassified 1601
378 Ga0466970_0084973 3300044765 Bacteria 1714
379 Ga0466957_0002811 3300044842 Bacteria 9413
380 Ga0466957_0002959 3300044842 Bacteria 9216
381 Ga0466959_0000111 3300045049 Bacteria 52637
382 Ga0495638_0195753 3300046460 Bacteria 1144
383 Ga0495650_0015591 3300046471 Bacteria 3891
384 Ga0495621_0007229 3300046539 Bacteria 3280
385 Ga0495621_0020395 3300046539 Bacteria 2175
386 Ga0495672_0004427 3300047320 Bacteria 11512
387 Ga0495672_0080899 3300047320 Unclassified 1811
388 Ga0495680_0129486 3300047322 Unclassified 1856
389 Ga0495686_0060831 3300047472 Unclassified 2347
390 Ga0495686_0117506 3300047472 Unclassified 1589
391 Ga0501032_0158432 3300049569 Bacteria 1487
392 Ga0501033_0019333 3300049570 Bacteria 5150
393 Ga0501033_0089553 3300049570 Bacteria 2251
394 Ga0501034_0002222 3300049571 Bacteria 23945
395 Ga0501034_0187265 3300049571 Bacteria 2033
396 Ga0501037_0054944 3300049573 Unclassified 2912
397 Ga0501037_0375828 3300049573 Bacteria 977
398 Ga0501038_0075010 3300049574 Bacteria 2860
399 Ga0501038_0256902 3300049574 Bacteria 1382
400 Ga0501039_0125197 3300049575 Unclassified 2016
401 Ga0501043_0361089 3300049579 Bacteria 1102
402 Ga0501047_0016917 3300049581 Bacteria 6971
403 Ga0501047_0198201 3300049581 Bacteria 1869
404 Ga0501047_0397101 3300049581 Bacteria 1212
405 Ga0501070_0355197 3300049586 Bacteria 1189
406 Ga0501225_0000507 3300049705 Bacteria 12138
407 Ga0501241_005158 3300049758 Bacteria 2439
408 Ga0501035_0049714 3300049822 Bacteria 3757
409 Ga0501035_0576958 3300049822 Bacteria 919
410 Ga0501035_0646460 3300049822 Unclassified 858
411 Ga0501044_0023540 3300049823 Bacteria 6551
412 Ga0501044_0025948 3300049823 Bacteria 6209
413 nmdc:mga0k408_15497_c1 3300050493 Bacteria 4216
414 nmdc:mga0k408_17476_c2 3300050493 Bacteria 2693
415 nmdc:mga05p37_37205_c1 3300050507 Bacteria 5968
416 nmdc:mga05p37_8159_c1 3300050507 Bacteria 12374
417 nmdc:mga0qj67_53419_c1 3300050509 Unclassified 3199
418 nmdc:mga06r32_194332_c1 3300050510 Bacteria 2016
419 nmdc:mga08y16_831162_c1 3300050511 Unclassified 914
420 nmdc:mga08y16_83651_c1 3300050511 Bacteria 3326
421 Ga0500578_0001683 3300053086 Bacteria 21230
422 Ga0500644_0020854 3300053088 Bacteria 1955
423 Ga0500583_0000031 3300053092 Bacteria 104319
424 Ga0500641_0077125 3300053096 Bacteria 1410
425 Ga0500572_027170 3300053111 Bacteria 1566
426 Ga0500589_024153 3300053147 Bacteria 2807
427 Ga0500584_135029 3300053726 Bacteria 952
428 Ga0500611_000023 3300053727 Bacteria 102347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1027072 Ga0436365_1027072_36_734 205
2 3300005578 Ga0068854_100160195 Ga0068854_1001601952 206
3 3300025981 Ga0207640_10126018 Ga0207640_101260182 206
4 3300005616 Ga0068852_100588192 Ga0068852_1005881922 211
5 3300025912 Ga0207707_10196607 Ga0207707_101966073 211
6 3300006881 Ga0068865_100171076 Ga0068865_1001710762 212
7 3300025940 Ga0207691_10023981 Ga0207691_100239815 212
8 3300026023 Ga0207677_10620161 Ga0207677_106201611 212
9 3300005548 Ga0070665_100039798 Ga0070665_1000397983 213
10 3300005578 Ga0068854_100026347 Ga0068854_1000263474 213
11 3300005718 Ga0068866_10073367 Ga0068866_100733671 213
12 3300005842 Ga0068858_100278713 Ga0068858_1002787132 213
13 3300006237 Ga0097621_100036275 Ga0097621_1000362752 213
14 3300006358 Ga0068871_100047922 Ga0068871_1000479222 213
15 3300006881 Ga0068865_100015687 Ga0068865_1000156872 213
16 3300025899 Ga0207642_10002789 Ga0207642_100027893 213
17 3300025938 Ga0207704_10043618 Ga0207704_100436182 213
18 3300025981 Ga0207640_10118500 Ga0207640_101185002 213
19 3300026023 Ga0207677_10329709 Ga0207677_103297092 213
20 3300026089 Ga0207648_10005805 Ga0207648_100058052 213
21 3300026116 Ga0207674_10025988 Ga0207674_100259883 213
22 3300026118 Ga0207675_100075366 Ga0207675_1000753662 213
23 3300026121 Ga0207683_10005557 Ga0207683_100055579 213
24 3300028380 Ga0268265_10142618 Ga0268265_101426182 213
25 3300005329 Ga0070683_100108019 Ga0070683_1001080191 214
26 3300005330 Ga0070690_100035825 Ga0070690_1000358252 214
27 3300005618 Ga0068864_100799998 Ga0068864_1007999982 214
28 3300006358 Ga0068871_100434726 Ga0068871_1004347262 214
29 3300025911 Ga0207654_10058458 Ga0207654_100584582 214
30 3300025944 Ga0207661_10054254 Ga0207661_100542542 214
31 3300049822 Ga0501035_0646460 Ga0501035_0646460_188_835 215
32 3300005295 Ga0065707_10233650 Ga0065707_102336501 216
33 3300005843 Ga0068860_100346137 Ga0068860_1003461372 216
34 3300006195 Ga0075366_10155737 Ga0075366_101557372 216
35 3300006847 Ga0075431_100249899 Ga0075431_1002498992 216
36 3300028381 Ga0268264_10264963 Ga0268264_102649632 216
37 3300049581 Ga0501047_0198201 Ga0501047_0198201_14_673 216
38 3300050509 nmdc:mga0qj67_53419_c1 nmdc:mga0qj67_53419_c1_23_679 216
39 3300005536 Ga0070697_100724881 Ga0070697_1007248812 217
40 3300006358 Ga0068871_100294565 Ga0068871_1002945652 217
41 3300025918 Ga0207662_10050730 Ga0207662_100507302 217
42 3300032002 Ga0307416_100450270 Ga0307416_1004502702 217
43 3300026118 Ga0207675_100484525 Ga0207675_1004845251 218
44 3300013306 Ga0163162_10060402 Ga0163162_100604022 220
45 3300014969 Ga0157376_10012013 Ga0157376_100120132 220
46 3300025986 Ga0207658_10907548 Ga0207658_109075481 221
47 3300047320 Ga0495672_0004427 Ga0495672_0004427_10742_11407 221
48 3300005329 Ga0070683_100197586 Ga0070683_1001975862 222
49 3300005366 Ga0070659_100236854 Ga0070659_1002368542 222
50 3300005458 Ga0070681_10018183 Ga0070681_100181835 222
51 3300005458 Ga0070681_10061630 Ga0070681_100616303 222
52 3300005458 Ga0070681_10195096 Ga0070681_101950961 222
53 3300005530 Ga0070679_100094333 Ga0070679_1000943332 222
54 3300005535 Ga0070684_100184231 Ga0070684_1001842313 222
55 3300005614 Ga0068856_100063999 Ga0068856_1000639992 222
56 3300013100 Ga0157373_10117774 Ga0157373_101177743 222
57 3300013102 Ga0157371_10003793 Ga0157371_100037935 222
58 3300013102 Ga0157371_10077641 Ga0157371_100776414 222
59 3300013104 Ga0157370_10001110 Ga0157370_1000111015 222
60 3300013104 Ga0157370_10065696 Ga0157370_100656963 222
61 3300013104 Ga0157370_10488373 Ga0157370_104883733 222
62 3300013105 Ga0157369_10565800 Ga0157369_105658003 222
63 3300013297 Ga0157378_10090653 Ga0157378_100906532 222
64 3300013307 Ga0157372_10215194 Ga0157372_102151942 222
65 3300025909 Ga0207705_10037123 Ga0207705_100371233 222
66 3300025921 Ga0207652_10000236 Ga0207652_100002365 222
67 3300026067 Ga0207678_10040567 Ga0207678_100405674 222
68 3300026078 Ga0207702_10124330 Ga0207702_101243302 222
69 3300037312 Ga0395899_0021581 Ga0395899_0021581_3970_4638 222
70 3300037312 Ga0395899_0061755 Ga0395899_0061755_1815_2483 222
71 3300037418 Ga0395900_0271759 Ga0395900_0271759_807_1475 222
72 3300038443 Ga0395901_0203344 Ga0395901_0203344_1303_1971 222
73 3300005331 Ga0070670_100203861 Ga0070670_1002038612 223
74 3300005338 Ga0068868_100038230 Ga0068868_1000382302 223
75 3300005344 Ga0070661_100001597 Ga0070661_1000015973 223
76 3300005344 Ga0070661_100003810 Ga0070661_1000038108 223
77 3300005353 Ga0070669_100171851 Ga0070669_1001718512 223
78 3300005354 Ga0070675_100053791 Ga0070675_1000537913 223
79 3300005364 Ga0070673_100192110 Ga0070673_1001921102 223
80 3300005365 Ga0070688_100003837 Ga0070688_1000038374 223
81 3300005366 Ga0070659_100129777 Ga0070659_1001297772 223
82 3300005457 Ga0070662_100053950 Ga0070662_1000539502 223
83 3300005535 Ga0070684_100002262 Ga0070684_1000022622 223
84 3300005535 Ga0070684_100004285 Ga0070684_1000042851 223
85 3300005539 Ga0068853_100013552 Ga0068853_1000135526 223
86 3300005564 Ga0070664_100000944 Ga0070664_10000094413 223
87 3300005564 Ga0070664_100006999 Ga0070664_1000069997 223
88 3300005577 Ga0068857_100007370 Ga0068857_10000737011 223
89 3300005617 Ga0068859_100077442 Ga0068859_1000774422 223
90 3300005618 Ga0068864_100012579 Ga0068864_1000125794 223
91 3300006931 Ga0097620_100077443 Ga0097620_1000774432 223
92 3300009011 Ga0105251_10113000 Ga0105251_101130002 223
93 3300009101 Ga0105247_10002502 Ga0105247_100025022 223
94 3300009174 Ga0105241_10542017 Ga0105241_105420172 223
95 3300009553 Ga0105249_10022411 Ga0105249_100224114 223
96 3300013100 Ga0157373_10028629 Ga0157373_100286292 223
97 3300013296 Ga0157374_10003989 Ga0157374_100039897 223
98 3300013297 Ga0157378_10068711 Ga0157378_100687111 223
99 3300013306 Ga0163162_10019539 Ga0163162_100195395 223
100 3300013307 Ga0157372_10742956 Ga0157372_107429562 223
101 3300013308 Ga0157375_10023196 Ga0157375_100231962 223
102 3300014325 Ga0163163_10002162 Ga0163163_100021626 223
103 3300014325 Ga0163163_10726650 Ga0163163_107266502 223
104 3300014745 Ga0157377_10044805 Ga0157377_100448052 223
105 3300014968 Ga0157379_10086051 Ga0157379_100860512 223
106 3300025900 Ga0207710_10000984 Ga0207710_1000098411 223
107 3300025907 Ga0207645_10011077 Ga0207645_100110772 223
108 3300025920 Ga0207649_10003838 Ga0207649_100038383 223
109 3300025926 Ga0207659_10007133 Ga0207659_100071334 223
110 3300025932 Ga0207690_10012675 Ga0207690_100126752 223
111 3300025933 Ga0207706_10062322 Ga0207706_100623222 223
112 3300025942 Ga0207689_10001949 Ga0207689_1000194913 223
113 3300025944 Ga0207661_10007074 Ga0207661_100070744 223
114 3300025945 Ga0207679_10000182 Ga0207679_1000018244 223
115 3300025945 Ga0207679_10002032 Ga0207679_1000203211 223
116 3300025961 Ga0207712_10007339 Ga0207712_100073393 223
117 3300025981 Ga0207640_10012505 Ga0207640_100125052 223
118 3300025986 Ga0207658_10253206 Ga0207658_102532062 223
119 3300026041 Ga0207639_10009609 Ga0207639_100096092 223
120 3300026116 Ga0207674_10009043 Ga0207674_1000904312 223
121 3300026116 Ga0207674_10124192 Ga0207674_101241922 223
122 3300047322 Ga0495680_0129486 Ga0495680_0129486_636_1307 223
123 3300053096 Ga0500641_0077125 Ga0500641_0077125_345_1016 223
124 3300005339 Ga0070660_100633643 Ga0070660_1006336431 224
125 3300006195 Ga0075366_10030265 Ga0075366_100302652 224
126 3300009094 Ga0111539_10633899 Ga0111539_106338992 224
127 3300009553 Ga0105249_10052971 Ga0105249_100529713 224
128 3300013100 Ga0157373_10005047 Ga0157373_100050474 224
129 3300017792 Ga0163161_10672286 Ga0163161_106722862 224
130 3300025913 Ga0207695_10018081 Ga0207695_100180812 224
131 3300025925 Ga0207650_10172505 Ga0207650_101725052 224
132 3300025961 Ga0207712_10039993 Ga0207712_100399933 224
133 3300041509 Ga0451843_1377229 Ga0451843_1377229_141_827 224
134 3300047320 Ga0495672_0080899 Ga0495672_0080899_538_1224 224
135 3300047472 Ga0495686_0060831 Ga0495686_0060831_754_1428 224
136 3300047472 Ga0495686_0117506 Ga0495686_0117506_817_1491 224
137 3300050493 nmdc:mga0k408_15497_c1 nmdc:mga0k408_15497_c1_139_813 224
138 3300050511 nmdc:mga08y16_831162_c1 nmdc:mga08y16_831162_c1_94_783 224
139 3300049569 Ga0501032_0158432 Ga0501032_0158432_189_866 225
140 3300049570 Ga0501033_0019333 Ga0501033_0019333_961_1647 225
141 3300049570 Ga0501033_0089553 Ga0501033_0089553_997_1674 225
142 3300049571 Ga0501034_0002222 Ga0501034_0002222_17776_18462 225
143 3300049573 Ga0501037_0054944 Ga0501037_0054944_805_1491 225
144 3300049573 Ga0501037_0375828 Ga0501037_0375828_19_705 225
145 3300049574 Ga0501038_0075010 Ga0501038_0075010_1775_2461 225
146 3300049574 Ga0501038_0256902 Ga0501038_0256902_594_1271 225
147 3300049575 Ga0501039_0125197 Ga0501039_0125197_866_1552 225
148 3300049581 Ga0501047_0016917 Ga0501047_0016917_885_1571 225
149 3300049581 Ga0501047_0397101 Ga0501047_0397101_301_987 225
150 3300049822 Ga0501035_0049714 Ga0501035_0049714_141_818 225
151 3300049823 Ga0501044_0023540 Ga0501044_0023540_2236_2922 225
152 3300005290 Ga0065712_10003918 Ga0065712_100039184 226
153 3300005327 Ga0070658_10024622 Ga0070658_100246222 226
154 3300005327 Ga0070658_10672564 Ga0070658_106725641 226
155 3300005328 Ga0070676_10047519 Ga0070676_100475192 226
156 3300005331 Ga0070670_100133505 Ga0070670_1001335052 226
157 3300005333 Ga0070677_10207706 Ga0070677_102077061 226
158 3300005334 Ga0068869_100031822 Ga0068869_1000318221 226
159 3300005336 Ga0070680_100228152 Ga0070680_1002281521 226
160 3300005339 Ga0070660_100551440 Ga0070660_1005514401 226
161 3300005340 Ga0070689_100024299 Ga0070689_1000242993 226
162 3300005354 Ga0070675_100129749 Ga0070675_1001297492 226
163 3300005355 Ga0070671_100876705 Ga0070671_1008767051 226
164 3300005356 Ga0070674_100015730 Ga0070674_1000157302 226
165 3300005364 Ga0070673_100265629 Ga0070673_1002656292 226
166 3300005457 Ga0070662_100151881 Ga0070662_1001518812 226
167 3300005458 Ga0070681_10013719 Ga0070681_100137195 226
168 3300005459 Ga0068867_100153359 Ga0068867_1001533592 226
169 3300005471 Ga0070698_100006546 Ga0070698_10000654612 226
170 3300005471 Ga0070698_100023080 Ga0070698_1000230803 226
171 3300005539 Ga0068853_100048622 Ga0068853_1000486222 226
172 3300005563 Ga0068855_100076204 Ga0068855_1000762042 226
173 3300005577 Ga0068857_100919341 Ga0068857_1009193412 226
174 3300005617 Ga0068859_100051053 Ga0068859_1000510531 226
175 3300005834 Ga0068851_10318066 Ga0068851_103180661 226
176 3300005841 Ga0068863_100199289 Ga0068863_1001992892 226
177 3300005842 Ga0068858_100148358 Ga0068858_1001483582 226
178 3300005843 Ga0068860_100564835 Ga0068860_1005648352 226
179 3300006880 Ga0075429_100001439 Ga0075429_10000143917 226
180 3300006931 Ga0097620_100051052 Ga0097620_1000510521 226
181 3300009176 Ga0105242_10206237 Ga0105242_102062372 226
182 3300009177 Ga0105248_10206973 Ga0105248_102069732 226
183 3300009553 Ga0105249_10030757 Ga0105249_100307572 226
184 3300010375 Ga0105239_10246384 Ga0105239_102463841 226
185 3300013105 Ga0157369_10342458 Ga0157369_103424582 226
186 3300013296 Ga0157374_10018071 Ga0157374_100180713 226
187 3300013296 Ga0157374_10295407 Ga0157374_102954072 226
188 3300013297 Ga0157378_10105926 Ga0157378_101059262 226
189 3300013306 Ga0163162_10155969 Ga0163162_101559692 226
190 3300013308 Ga0157375_10104322 Ga0157375_101043222 226
191 3300013308 Ga0157375_11174760 Ga0157375_111747601 226
192 3300014326 Ga0157380_10473041 Ga0157380_104730412 226
193 3300014745 Ga0157377_10006845 Ga0157377_100068454 226
194 3300014968 Ga0157379_10043233 Ga0157379_100432332 226
195 3300014969 Ga0157376_10652144 Ga0157376_106521442 226
196 3300025919 Ga0207657_10237866 Ga0207657_102378662 226
197 3300025919 Ga0207657_10383767 Ga0207657_103837671 226
198 3300025923 Ga0207681_10157850 Ga0207681_101578502 226
199 3300025932 Ga0207690_10258500 Ga0207690_102585002 226
200 3300025933 Ga0207706_10089112 Ga0207706_100891122 226
201 3300025934 Ga0207686_10278693 Ga0207686_102786932 226
202 3300025936 Ga0207670_10004565 Ga0207670_100045653 226
203 3300025940 Ga0207691_10008803 Ga0207691_100088036 226
204 3300025941 Ga0207711_10280484 Ga0207711_102804842 226
205 3300025942 Ga0207689_10001980 Ga0207689_100019808 226
206 3300025961 Ga0207712_10020046 Ga0207712_100200464 226
207 3300025972 Ga0207668_10828079 Ga0207668_108280791 226
208 3300025986 Ga0207658_10031260 Ga0207658_100312602 226
209 3300026035 Ga0207703_10081860 Ga0207703_100818601 226
210 3300026088 Ga0207641_10000576 Ga0207641_100005762 226
211 3300028381 Ga0268264_10179080 Ga0268264_101790802 226
212 3300037418 Ga0395900_0695239 Ga0395900_0695239_51_731 226
213 3300041507 Ga0451851_0440419 Ga0451851_0440419_318_1007 226
214 3300042001 Ga0439441_052454 Ga0439441_052454_118_801 226
215 3300044842 Ga0466957_0002811 Ga0466957_0002811_6966_7661 226
216 3300046460 Ga0495638_0195753 Ga0495638_0195753_39_737 226
217 3300049586 Ga0501070_0355197 Ga0501070_0355197_172_852 226
218 3300050493 nmdc:mga0k408_17476_c2 nmdc:mga0k408_17476_c2_964_1662 226
219 3300050510 nmdc:mga06r32_194332_c1 nmdc:mga06r32_194332_c1_771_1457 226
220 3300053092 Ga0500583_0000031 Ga0500583_0000031_27437_28135 226
221 iso_pu_bacteria 2738541278 2738730503 226
222 3300005338 Ga0068868_100027731 Ga0068868_1000277311 227
223 3300013307 Ga0157372_10283089 Ga0157372_102830893 227
224 3300025960 Ga0207651_10214740 Ga0207651_102147401 227
225 3300027471 Ga0209995_1011943 Ga0209995_10119432 227
226 3300044656 Ga0466969_0000728 Ga0466969_0000728_8849_9538 227
227 3300044684 Ga0466966_0003773 Ga0466966_0003773_4249_4938 227
228 3300044693 Ga0466961_0309106 Ga0466961_0309106_238_927 227
229 3300044765 Ga0466970_0084973 Ga0466970_0084973_772_1461 227
230 3300045049 Ga0466959_0000111 Ga0466959_0000111_21298_21987 227
231 3300046471 Ga0495650_0015591 Ga0495650_0015591_689_1375 227
232 3300049571 Ga0501034_0187265 Ga0501034_0187265_51_749 227
233 3300049579 Ga0501043_0361089 Ga0501043_0361089_295_993 227
234 3300000043 ARcpr5yngRDRAFT_c004441 ARcpr5yngRDRAFT_0044412 228
235 3300003320 rootH2_10089851 rootH2_100898513 228
236 3300005355 Ga0070671_100042435 Ga0070671_1000424351 228
237 3300005367 Ga0070667_100009646 Ga0070667_1000096461 228
238 3300005563 Ga0068855_100019049 Ga0068855_1000190494 228
239 3300005577 Ga0068857_100074610 Ga0068857_1000746102 228
240 3300005616 Ga0068852_100400694 Ga0068852_1004006942 228
241 3300005617 Ga0068859_100013522 Ga0068859_1000135222 228
242 3300005618 Ga0068864_100028050 Ga0068864_1000280502 228
243 3300005841 Ga0068863_100045282 Ga0068863_1000452822 228
244 3300005843 Ga0068860_100000916 Ga0068860_1000009167 228
245 3300006237 Ga0097621_100538915 Ga0097621_1005389152 228
246 3300006931 Ga0097620_100013522 Ga0097620_1000135222 228
247 3300009545 Ga0105237_10006816 Ga0105237_100068166 228
248 3300010375 Ga0105239_10013486 Ga0105239_100134862 228
249 3300013296 Ga0157374_10050137 Ga0157374_100501373 228
250 3300013297 Ga0157378_10003004 Ga0157378_100030045 228
251 3300013297 Ga0157378_10040947 Ga0157378_100409473 228
252 3300025246 Ga0209646_1002165 Ga0209646_10021652 228
253 3300025914 Ga0207671_10060360 Ga0207671_100603602 228
254 3300025931 Ga0207644_10049054 Ga0207644_100490543 228
255 3300025949 Ga0207667_10006591 Ga0207667_100065914 228
256 3300025986 Ga0207658_10023342 Ga0207658_100233424 228
257 3300026023 Ga0207677_10032935 Ga0207677_100329352 228
258 3300026088 Ga0207641_10010549 Ga0207641_100105496 228
259 3300026116 Ga0207674_10346992 Ga0207674_103469922 228
260 3300026142 Ga0207698_10337786 Ga0207698_103377862 228
261 3300028381 Ga0268264_10094809 Ga0268264_100948092 228
262 3300044656 Ga0466969_0071734 Ga0466969_0071734_383_1075 228
263 3300044658 Ga0466972_0000348 Ga0466972_0000348_8233_8931 228
264 3300053088 Ga0500644_0020854 Ga0500644_0020854_19_714 228
265 2162886012 MBSR1b_contig_11197818 MBSR1b_0520.00002590 229
266 3300002459 JGI24751J29686_10000622 JGI24751J29686_100006222 229
267 3300003323 rootH1_10009908 rootH1_1000990812 229
268 3300005290 Ga0065712_10014196 Ga0065712_100141962 229
269 3300005293 Ga0065715_10021413 Ga0065715_100214133 229
270 3300005293 Ga0065715_10177508 Ga0065715_101775082 229
271 3300005328 Ga0070676_10024048 Ga0070676_100240482 229
272 3300005330 Ga0070690_100147819 Ga0070690_1001478191 229
273 3300005331 Ga0070670_100026345 Ga0070670_1000263454 229
274 3300005331 Ga0070670_100057010 Ga0070670_1000570103 229
275 3300005333 Ga0070677_10007928 Ga0070677_100079283 229
276 3300005333 Ga0070677_10014351 Ga0070677_100143512 229
277 3300005334 Ga0068869_100011151 Ga0068869_1000111512 229
278 3300005334 Ga0068869_100058402 Ga0068869_1000584022 229
279 3300005334 Ga0068869_100190952 Ga0068869_1001909522 229
280 3300005335 Ga0070666_10000411 Ga0070666_1000041122 229
281 3300005338 Ga0068868_100148866 Ga0068868_1001488662 229
282 3300005340 Ga0070689_100006400 Ga0070689_1000064005 229
283 3300005340 Ga0070689_100564193 Ga0070689_1005641931 229
284 3300005343 Ga0070687_100028470 Ga0070687_1000284702 229
285 3300005343 Ga0070687_100108178 Ga0070687_1001081782 229
286 3300005347 Ga0070668_100134289 Ga0070668_1001342892 229
287 3300005353 Ga0070669_100007374 Ga0070669_1000073747 229
288 3300005353 Ga0070669_100041209 Ga0070669_1000412093 229
289 3300005354 Ga0070675_100005760 Ga0070675_1000057609 229
290 3300005354 Ga0070675_100027925 Ga0070675_1000279252 229
291 3300005355 Ga0070671_100034349 Ga0070671_1000343492 229
292 3300005355 Ga0070671_100117842 Ga0070671_1001178423 229
293 3300005364 Ga0070673_100042491 Ga0070673_1000424913 229
294 3300005365 Ga0070688_100009259 Ga0070688_1000092592 229
295 3300005365 Ga0070688_100249711 Ga0070688_1002497112 229
296 3300005365 Ga0070688_100492454 Ga0070688_1004924541 229
297 3300005366 Ga0070659_100655439 Ga0070659_1006554391 229
298 3300005367 Ga0070667_100016897 Ga0070667_1000168972 229
299 3300005438 Ga0070701_10077186 Ga0070701_100771862 229
300 3300005457 Ga0070662_100021168 Ga0070662_1000211685 229
301 3300005459 Ga0068867_100526567 Ga0068867_1005265672 229
302 3300005471 Ga0070698_101115572 Ga0070698_1011155721 229
303 3300005539 Ga0068853_100318864 Ga0068853_1003188642 229
304 3300005543 Ga0070672_100048000 Ga0070672_1000480002 229
305 3300005543 Ga0070672_100114418 Ga0070672_1001144182 229
306 3300005543 Ga0070672_100137351 Ga0070672_1001373513 229
307 3300005549 Ga0070704_100036265 Ga0070704_1000362653 229
308 3300005564 Ga0070664_100086702 Ga0070664_1000867021 229
309 3300005564 Ga0070664_100117393 Ga0070664_1001173932 229
310 3300005577 Ga0068857_100034976 Ga0068857_1000349761 229
311 3300005617 Ga0068859_100000037 Ga0068859_10000003722 229
312 3300005617 Ga0068859_100126066 Ga0068859_1001260664 229
313 3300005617 Ga0068859_100845399 Ga0068859_1008453991 229
314 3300005618 Ga0068864_100007550 Ga0068864_1000075505 229
315 3300005719 Ga0068861_100003218 Ga0068861_1000032182 229
316 3300005834 Ga0068851_10015097 Ga0068851_100150973 229
317 3300005840 Ga0068870_10014138 Ga0068870_100141383 229
318 3300005840 Ga0068870_10015455 Ga0068870_100154552 229
319 3300005840 Ga0068870_10556082 Ga0068870_105560821 229
320 3300005841 Ga0068863_100445706 Ga0068863_1004457061 229
321 3300005842 Ga0068858_100010795 Ga0068858_1000107955 229
322 3300005844 Ga0068862_100029579 Ga0068862_1000295791 229
323 3300005844 Ga0068862_100031801 Ga0068862_1000318012 229
324 3300006237 Ga0097621_100256275 Ga0097621_1002562751 229
325 3300006358 Ga0068871_100189571 Ga0068871_1001895712 229
326 3300006844 Ga0075428_100034778 Ga0075428_1000347783 229
327 3300006844 Ga0075428_100494305 Ga0075428_1004943052 229
328 3300006846 Ga0075430_100001013 Ga0075430_1000010137 229
329 3300006847 Ga0075431_100021532 Ga0075431_1000215323 229
330 3300006881 Ga0068865_100381316 Ga0068865_1003813162 229
331 3300006931 Ga0097620_100000037 Ga0097620_10000003722 229
332 3300006931 Ga0097620_100126062 Ga0097620_1001260622 229
333 3300006931 Ga0097620_100845368 Ga0097620_1008453681 229
334 3300009094 Ga0111539_10024449 Ga0111539_100244494 229
335 3300009094 Ga0111539_10071521 Ga0111539_100715214 229
336 3300009094 Ga0111539_10134204 Ga0111539_101342042 229
337 3300009098 Ga0105245_10437464 Ga0105245_104374642 229
338 3300009101 Ga0105247_10005053 Ga0105247_100050536 229
339 3300009147 Ga0114129_10022504 Ga0114129_100225042 229
340 3300009147 Ga0114129_10288086 Ga0114129_102880862 229
341 3300009545 Ga0105237_10004816 Ga0105237_100048168 229
342 3300009553 Ga0105249_10023785 Ga0105249_100237852 229
343 3300009553 Ga0105249_10031267 Ga0105249_100312678 229
344 3300009553 Ga0105249_10230259 Ga0105249_102302592 229
345 3300011119 Ga0105246_10037746 Ga0105246_100377462 229
346 3300013297 Ga0157378_10448818 Ga0157378_104488182 229
347 3300013306 Ga0163162_10006705 Ga0163162_100067053 229
348 3300013306 Ga0163162_11149827 Ga0163162_111498271 229
349 3300013306 Ga0163162_11153507 Ga0163162_111535071 229
350 3300013307 Ga0157372_10359131 Ga0157372_103591312 229
351 3300013308 Ga0157375_10033032 Ga0157375_100330323 229
352 3300013308 Ga0157375_10067792 Ga0157375_100677924 229
353 3300013308 Ga0157375_10135583 Ga0157375_101355833 229
354 3300014325 Ga0163163_10014336 Ga0163163_100143365 229
355 3300014325 Ga0163163_10079657 Ga0163163_100796572 229
356 3300014325 Ga0163163_10245778 Ga0163163_102457781 229
357 3300014325 Ga0163163_11462736 Ga0163163_114627361 229
358 3300014326 Ga0157380_10003097 Ga0157380_1000309710 229
359 3300014326 Ga0157380_10003645 Ga0157380_100036458 229
360 3300014326 Ga0157380_10060046 Ga0157380_100600463 229
361 3300014326 Ga0157380_10500953 Ga0157380_105009532 229
362 3300014326 Ga0157380_10505024 Ga0157380_105050242 229
363 3300014745 Ga0157377_10009750 Ga0157377_100097502 229
364 3300014968 Ga0157379_10070058 Ga0157379_100700582 229
365 3300014968 Ga0157379_10398576 Ga0157379_103985762 229
366 3300025900 Ga0207710_10029138 Ga0207710_100291382 229
367 3300025908 Ga0207643_10016403 Ga0207643_100164032 229
368 3300025908 Ga0207643_10051031 Ga0207643_100510312 229
369 3300025911 Ga0207654_10070208 Ga0207654_100702082 229
370 3300025914 Ga0207671_10002159 Ga0207671_1000215911 229
371 3300025923 Ga0207681_10011851 Ga0207681_100118517 229
372 3300025923 Ga0207681_10021050 Ga0207681_100210502 229
373 3300025925 Ga0207650_10034407 Ga0207650_100344072 229
374 3300025925 Ga0207650_10055354 Ga0207650_100553543 229
375 3300025925 Ga0207650_10246999 Ga0207650_102469992 229
376 3300025925 Ga0207650_10262155 Ga0207650_102621552 229
377 3300025926 Ga0207659_10029738 Ga0207659_100297385 229
378 3300025926 Ga0207659_10049696 Ga0207659_100496963 229
379 3300025926 Ga0207659_10230910 Ga0207659_102309102 229
380 3300025931 Ga0207644_10356413 Ga0207644_103564132 229
381 3300025931 Ga0207644_10379342 Ga0207644_103793421 229
382 3300025933 Ga0207706_10014306 Ga0207706_100143066 229
383 3300025935 Ga0207709_10107297 Ga0207709_101072971 229
384 3300025936 Ga0207670_10457778 Ga0207670_104577782 229
385 3300025938 Ga0207704_10186948 Ga0207704_101869482 229
386 3300025940 Ga0207691_10038558 Ga0207691_100385584 229
387 3300025940 Ga0207691_10039394 Ga0207691_100393944 229
388 3300025940 Ga0207691_10462218 Ga0207691_104622182 229
389 3300025942 Ga0207689_10001790 Ga0207689_1000179010 229
390 3300025942 Ga0207689_10079260 Ga0207689_100792604 229
391 3300025945 Ga0207679_10087771 Ga0207679_100877712 229
392 3300025960 Ga0207651_10075094 Ga0207651_100750942 229
393 3300025960 Ga0207651_10077607 Ga0207651_100776072 229
394 3300025960 Ga0207651_10289427 Ga0207651_102894272 229
395 3300025961 Ga0207712_10004303 Ga0207712_1000430311 229
396 3300025961 Ga0207712_10044709 Ga0207712_100447093 229
397 3300025961 Ga0207712_10046666 Ga0207712_100466662 229
398 3300025972 Ga0207668_10027587 Ga0207668_100275872 229
399 3300026035 Ga0207703_10188365 Ga0207703_101883652 229
400 3300026088 Ga0207641_10000226 Ga0207641_1000022629 229
401 3300026088 Ga0207641_10584178 Ga0207641_105841782 229
402 3300026116 Ga0207674_10335769 Ga0207674_103357692 229
403 3300026118 Ga0207675_100001450 Ga0207675_10000145021 229
404 3300026118 Ga0207675_100520342 Ga0207675_1005203422 229
405 3300026121 Ga0207683_10170081 Ga0207683_101700812 229
406 3300028380 Ga0268265_10019655 Ga0268265_100196553 229
407 3300028381 Ga0268264_10002166 Ga0268264_1000216614 229
408 3300028794 Ga0307515_10002910 Ga0307515_1000291017 229
409 3300031456 Ga0307513_10296508 Ga0307513_102965082 229
410 3300036401 Ga0373937_0093046 Ga0373937_0093046_227_925 229
411 3300041997 Ga0439431_0037629 Ga0439431_0037629_46_735 229
412 3300042014 Ga0439457_000201 Ga0439457_000201_1719_2414 229
413 3300044673 Ga0453683_0339919 Ga0453683_0339919_155_853 229
414 3300044735 Ga0466968_0063126 Ga0466968_0063126_315_1016 229
415 3300044842 Ga0466957_0002959 Ga0466957_0002959_5879_6577 229
416 3300046539 Ga0495621_0007229 Ga0495621_0007229_1580_2278 229
417 3300046539 Ga0495621_0020395 Ga0495621_0020395_1452_2150 229
418 3300049705 Ga0501225_0000507 Ga0501225_0000507_5198_5893 229
419 3300049758 Ga0501241_005158 Ga0501241_005158_19_729 229
420 3300049822 Ga0501035_0576958 Ga0501035_0576958_110_814 229
421 3300049823 Ga0501044_0025948 Ga0501044_0025948_1068_1772 229
422 3300050507 nmdc:mga05p37_37205_c1 nmdc:mga05p37_37205_c1_2084_2782 229
423 3300050507 nmdc:mga05p37_8159_c1 nmdc:mga05p37_8159_c1_11109_11804 229
424 3300050511 nmdc:mga08y16_83651_c1 nmdc:mga08y16_83651_c1_1420_2109 229
425 3300053086 Ga0500578_0001683 Ga0500578_0001683_10347_11042 229
426 3300053111 Ga0500572_027170 Ga0500572_027170_46_741 229
427 3300053147 Ga0500589_024153 Ga0500589_024153_1344_2045 229
428 3300053726 Ga0500584_135029 Ga0500584_135029_149_844 229
429 3300053727 Ga0500611_000023 Ga0500611_000023_81363_82055 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01509

TruB_N

TruB family pseudouridylate synthase (N terminal domain)

61

209

0.99

PF16198

TruB_C_2

tRNA pseudouridylate synthase B C-terminal domain

210

258

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lwr-assembly1.cif.gz_A structure of h/aca rnp bound to a substrate rna containing 4su 0.9383 7 222
2ey4-assembly1.cif.gz_A crystal structure of a cbf5-nop10-gar1 complex 0.9298 7 220
2aus-assembly1.cif.gz_C crystal structure of the archaeal box h/aca srnp nop10-cbf5 complex 0.9277 7 228
2aus-assembly2.cif.gz_A crystal structure of the archaeal box h/aca srnp nop10-cbf5 complex 0.9274 6 228
1ze1-assembly4.cif.gz_D conformational change of pseudouridine 55 synthase upon its association with rna substrate 0.924 10 224
ID Description Score Start End Superfamily
af_Q57612_45_223_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9455 11 222 3.30.2350.10
af_Q0WVR7_318_539_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9409 10 224 3.30.2350.10
2apoA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9367 70 205 3.30.70.3190
af_P9WHP7_7_227_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9323 11 220 3.30.2350.10
af_Q57612_45_223_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9302 11 222 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A3D5AC24-F1-model_v4 tRNA pseudouridine(55) synthase (EC 5.4.99.25) 0.9628 107 227 GO:0003723
GO:0006400
GO:0160148
GO:1990481
AF-A0A7Y4Y8B3-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.9604 6 224 GO:0003723
GO:0031119
GO:0160148
GO:1990481
AF-A0A162MG14-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.9545 10 224 GO:0003723
GO:0031119
GO:0160148
GO:1990481
AF-A0A4Q5Z973-F1-model_v4 tRNA pseudouridine(55) synthase (EC 5.4.99.25) 0.9541 2 191 GO:0003723
GO:0006400
GO:0160148
GO:1990481
AF-A0A536TVW9-F1-model_v4 tRNA pseudouridine(55) synthase (EC 5.4.99.25) 0.9539 32 217 GO:0003723
GO:0006400
GO:0160148
GO:1990481

Feature Viewer

pLDDT pTM Quality
88.95 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map