F441854

General Info

Members Datasets Scaffolds Average Seq Length
429 154 858 67

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100009803|Ga0070694_1000098033
Length 82
Sequence MIHSKCAGGPLHYNRAMSVAYTSNVHIERIKGPLRIARLPGESQPVVFSVHGAIAEHYKMDPASLTESHAATLDYVVAATAG

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
73 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
117 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.63
Rhizosphere 97.67
Stem 0
Stem Tuber 0
Unclassified 42.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100009803 3300005444 Bacteria 5883
2 MBSR1b_contig_2141048 2162886012 Bacteria 1075
3 LJNas_1000082 3300000546 Bacteria 13758
4 Ga0065715_10401728 3300005293 Unclassified 881
5 Ga0065707_10114302 3300005295 Unclassified 2301
6 Ga0068869_101108206 3300005334 Unclassified 693
7 Ga0070666_10385780 3300005335 Bacteria 1006
8 Ga0070666_10444848 3300005335 Unclassified 935
9 Ga0070680_100142750 3300005336 Bacteria 2008
10 Ga0070680_100602066 3300005336 Unclassified 943
11 Ga0068868_102285173 3300005338 Unclassified 516
12 Ga0070691_10004040 3300005341 Bacteria 6649
13 Ga0070687_100244521 3300005343 Bacteria 1111
14 Ga0070692_10409725 3300005345 Unclassified 858
15 Ga0070669_100667704 3300005353 Unclassified 875
16 Ga0070671_101576339 3300005355 Bacteria 582
17 Ga0070674_100460188 3300005356 Unclassified 1052
18 Ga0070673_101618935 3300005364 Unclassified 612
19 Ga0070709_10021021 3300005434 Bacteria 3798
20 Ga0070709_10783535 3300005434 Unclassified 747
21 Ga0070714_100128330 3300005435 Bacteria 2264
22 Ga0070714_100491182 3300005435 Bacteria 1170
23 Ga0070713_100067254 3300005436 Unclassified 3016
24 Ga0070713_100078918 3300005436 Bacteria 2803
25 Ga0070713_100297214 3300005436 Bacteria 1486
26 Ga0070713_100350856 3300005436 Unclassified 1369
27 Ga0070713_100798261 3300005436 Unclassified 905
28 Ga0070713_101206736 3300005436 Unclassified 732
29 Ga0070713_102236884 3300005436 Bacteria 529
30 Ga0070710_10466407 3300005437 Unclassified 859
31 Ga0070710_10599356 3300005437 Unclassified 766
32 Ga0070710_10696496 3300005437 Bacteria 716
33 Ga0070710_11191246 3300005437 Unclassified 563
34 Ga0070701_10408866 3300005438 Unclassified 862
35 Ga0070701_11106543 3300005438 Unclassified 558
36 Ga0070711_100274742 3300005439 Unclassified 1331
37 Ga0070711_100274947 3300005439 Unclassified 1330
38 Ga0070711_100488973 3300005439 Unclassified 1013
39 Ga0070711_100928931 3300005439 Unclassified 744
40 Ga0070711_101028021 3300005439 Unclassified 708
41 Ga0070705_100173367 3300005440 Bacteria 1454
42 Ga0070705_100249325 3300005440 Unclassified 1245
43 Ga0070705_101266670 3300005440 Unclassified 610
44 Ga0070700_100007814 3300005441 Bacteria 5798
45 Ga0070694_100094277 3300005444 Unclassified 2105
46 Ga0070694_100305240 3300005444 Bacteria 1221
47 Ga0070708_100000812 3300005445 Bacteria 23564
48 Ga0070708_100003438 3300005445 Bacteria 12398
49 Ga0070708_100025327 3300005445 Bacteria 5071
50 Ga0070708_100037121 3300005445 Unclassified 4249
51 Ga0070708_100045901 3300005445 Bacteria 3852
52 Ga0070708_100079156 3300005445 Bacteria 2973
53 Ga0070708_100280271 3300005445 Bacteria 1569
54 Ga0070708_100363259 3300005445 Unclassified 1364
55 Ga0070708_100373178 3300005445 Bacteria 1345
56 Ga0070708_100401169 3300005445 Unclassified 1293
57 Ga0070708_101271589 3300005445 Bacteria 688
58 Ga0070678_101826522 3300005456 Unclassified 573
59 Ga0070662_100272033 3300005457 Unclassified 1368
60 Ga0068867_100012794 3300005459 Bacteria 5937
61 Ga0068867_101313403 3300005459 Unclassified 668
62 Ga0070706_100108270 3300005467 Bacteria 2586
63 Ga0070706_100304418 3300005467 Bacteria 1487
64 Ga0070706_100357584 3300005467 Bacteria 1361
65 Ga0070706_100409150 3300005467 Bacteria 1263
66 Ga0070706_100569349 3300005467 Bacteria 1053
67 Ga0070706_100798569 3300005467 Unclassified 874
68 Ga0070706_100858673 3300005467 Unclassified 839
69 Ga0070706_101621806 3300005467 Unclassified 590
70 Ga0070707_100000050 3300005468 Bacteria 102427
71 Ga0070707_100016579 3300005468 Bacteria 6915
72 Ga0070707_100085268 3300005468 Bacteria 3053
73 Ga0070707_100114885 3300005468 Bacteria 2612
74 Ga0070707_100183325 3300005468 Bacteria 2041
75 Ga0070707_100198475 3300005468 Bacteria 1955
76 Ga0070707_100204142 3300005468 Bacteria 1926
77 Ga0070707_100225248 3300005468 Bacteria 1826
78 Ga0070707_100601046 3300005468 Bacteria 1062
79 Ga0070707_100623586 3300005468 Bacteria 1041
80 Ga0070707_100822006 3300005468 Bacteria 893
81 Ga0070707_100915408 3300005468 Bacteria 842
82 Ga0070707_101154242 3300005468 Unclassified 741
83 Ga0070707_101585874 3300005468 Unclassified 621
84 Ga0070707_101850470 3300005468 Bacteria 571
85 Ga0070707_102064554 3300005468 Unclassified 537
86 Ga0070698_100012795 3300005471 Bacteria 8887
87 Ga0070698_100014688 3300005471 Bacteria 8270
88 Ga0070698_100055867 3300005471 Bacteria 4001
89 Ga0070698_100093145 3300005471 Bacteria 2993
90 Ga0070698_101542028 3300005471 Unclassified 616
91 Ga0070699_100003604 3300005518 Bacteria 13696
92 Ga0070699_100003881 3300005518 Bacteria 13218
93 Ga0070699_100011263 3300005518 Bacteria 7725
94 Ga0070699_100159558 3300005518 Bacteria 1996
95 Ga0070699_100225670 3300005518 Bacteria 1670
96 Ga0070699_100234268 3300005518 Bacteria 1638
97 Ga0070699_100264221 3300005518 Bacteria 1539
98 Ga0070699_100337966 3300005518 Bacteria 1355
99 Ga0070699_100397570 3300005518 Bacteria 1246
100 Ga0070699_100708429 3300005518 Bacteria 920
101 Ga0070699_101144505 3300005518 Unclassified 714
102 Ga0070699_101315751 3300005518 Bacteria 663
103 Ga0070697_100001160 3300005536 Bacteria 19962
104 Ga0070697_100005065 3300005536 Bacteria 10127
105 Ga0070697_100023719 3300005536 Bacteria 4881
106 Ga0070697_100052724 3300005536 Bacteria 3305
107 Ga0070697_100087998 3300005536 Unclassified 2565
108 Ga0070697_100129609 3300005536 Bacteria 2115
109 Ga0070697_100132106 3300005536 Unclassified 2094
110 Ga0070697_100374412 3300005536 Bacteria 1232
111 Ga0070697_100647544 3300005536 Unclassified 930
112 Ga0070697_100723185 3300005536 Bacteria 879
113 Ga0070697_100878342 3300005536 Unclassified 795
114 Ga0070697_101348519 3300005536 Unclassified 637
115 Ga0068853_100894981 3300005539 Unclassified 852
116 Ga0070672_101123789 3300005543 Unclassified 699
117 Ga0070695_100007221 3300005545 Bacteria 6587
118 Ga0070695_100024169 3300005545 Unclassified 3740
119 Ga0070695_100116285 3300005545 Bacteria 1823
120 Ga0070695_100407449 3300005545 Bacteria 1032
121 Ga0070695_100455743 3300005545 Bacteria 981
122 Ga0070695_101512950 3300005545 Bacteria 559
123 Ga0070696_100013449 3300005546 Bacteria 5492
124 Ga0070696_100041390 3300005546 Unclassified 3183
125 Ga0070704_100005247 3300005549 Bacteria 7545
126 Ga0070704_100111002 3300005549 Unclassified 2086
127 Ga0068854_100138539 3300005578 Unclassified 1865
128 Ga0068854_100567343 3300005578 Unclassified 965
129 Ga0070702_100001800 3300005615 Bacteria 8908
130 Ga0068859_101022282 3300005617 Bacteria 908
131 Ga0068866_10120231 3300005718 Unclassified 1479
132 Ga0068866_11406915 3300005718 Unclassified 510
133 Ga0068861_100034683 3300005719 Unclassified 3732
134 Ga0068861_100301610 3300005719 Bacteria 1388
135 Ga0068861_100505235 3300005719 Unclassified 1093
136 Ga0068858_100181239 3300005842 Bacteria 1989
137 Ga0068858_100856899 3300005842 Unclassified 887
138 Ga0068858_101163724 3300005842 Bacteria 758
139 Ga0068860_100160015 3300005843 Unclassified 2171
140 Ga0068860_102865137 3300005843 Bacteria 500
141 Ga0068862_100902321 3300005844 Unclassified 869
142 Ga0070717_10063733 3300006028 Unclassified 3060
143 Ga0070717_10066475 3300006028 Bacteria 2998
144 Ga0070717_10082203 3300006028 Bacteria 2706
145 Ga0070717_10084983 3300006028 Unclassified 2662
146 Ga0070717_10366837 3300006028 Unclassified 1290
147 Ga0070717_10657517 3300006028 Unclassified 951
148 Ga0070717_10678219 3300006028 Bacteria 936
149 Ga0070717_10842047 3300006028 Unclassified 834
150 Ga0070717_11075974 3300006028 Unclassified 732
151 Ga0070717_11629733 3300006028 Bacteria 584
152 Ga0075432_10060382 3300006058 Bacteria 1349
153 Ga0075432_10062924 3300006058 Bacteria 1324
154 Ga0070715_10107318 3300006163 Bacteria 1312
155 Ga0070716_100084566 3300006173 Bacteria 1903
156 Ga0070716_100111207 3300006173 Bacteria 1698
157 Ga0070716_100456569 3300006173 Bacteria 933
158 Ga0070716_100458748 3300006173 Bacteria 931
159 Ga0070716_100496734 3300006173 Bacteria 899
160 Ga0070716_100576671 3300006173 Unclassified 843
161 Ga0070716_101163894 3300006173 Unclassified 618
162 Ga0070712_100041567 3300006175 Bacteria 3157
163 Ga0070712_100239259 3300006175 Bacteria 1445
164 Ga0070712_100344743 3300006175 Bacteria 1217
165 Ga0070712_100700025 3300006175 Unclassified 864
166 Ga0070712_101458725 3300006175 Unclassified 597
167 Ga0070712_101734068 3300006175 Unclassified 547
168 Ga0075433_10029280 3300006852 Unclassified 4690
169 Ga0075433_10189730 3300006852 Bacteria 1828
170 Ga0075433_10244361 3300006852 Bacteria 1593
171 Ga0075433_10268377 3300006852 Bacteria 1512
172 Ga0075433_10654560 3300006852 Bacteria 921
173 Ga0075433_10869885 3300006852 Bacteria 786
174 Ga0075433_11426320 3300006852 Unclassified 599
175 Ga0075434_100014641 3300006871 Bacteria 7502
176 Ga0075434_100048910 3300006871 Bacteria 4196
177 Ga0075434_100109073 3300006871 Bacteria 2778
178 Ga0075434_100131666 3300006871 Bacteria 2520
179 Ga0075434_100435650 3300006871 Unclassified 1332
180 Ga0075434_100536518 3300006871 Bacteria 1190
181 Ga0075434_100852664 3300006871 Bacteria 926
182 Ga0075434_102133177 3300006871 Bacteria 565
183 Ga0068865_100103657 3300006881 Unclassified 2087
184 Ga0075436_100011726 3300006914 Bacteria 6016
185 Ga0075436_100013066 3300006914 Bacteria 5692
186 Ga0075436_100019324 3300006914 Bacteria 4670
187 Ga0075436_100029254 3300006914 Unclassified 3789
188 Ga0075436_100060328 3300006914 Bacteria 2620
189 Ga0075436_100061995 3300006914 Bacteria 2584
190 Ga0075436_100146548 3300006914 Bacteria 1660
191 Ga0075436_100308656 3300006914 Bacteria 1135
192 Ga0075436_100318577 3300006914 Bacteria 1117
193 Ga0075436_100470170 3300006914 Unclassified 917
194 Ga0075436_100487094 3300006914 Unclassified 901
195 Ga0075436_100638887 3300006914 Unclassified 786
196 Ga0075436_100685560 3300006914 Unclassified 758
197 Ga0097620_101022109 3300006931 Bacteria 908
198 Ga0075435_100008421 3300007076 Bacteria 7399
199 Ga0075435_100009160 3300007076 Bacteria 7147
200 Ga0075435_100011447 3300007076 Bacteria 6528
201 Ga0075435_100081609 3300007076 Bacteria 2656
202 Ga0075435_100129752 3300007076 Bacteria 2109
203 Ga0075435_100186191 3300007076 Bacteria 1756
204 Ga0075435_100443889 3300007076 Unclassified 1119
205 Ga0075435_100690042 3300007076 Unclassified 887
206 Ga0075435_100830650 3300007076 Bacteria 805
207 Ga0075435_101409949 3300007076 Bacteria 611
208 Ga0075435_101561923 3300007076 Bacteria 579
209 Ga0075435_101794526 3300007076 Unclassified 538
210 Ga0099794_10022696 3300007265 Bacteria 2862
211 Ga0099794_10024168 3300007265 Unclassified 2787
212 Ga0099794_10027412 3300007265 Unclassified 2641
213 Ga0099794_10263975 3300007265 Unclassified 889
214 Ga0099794_10699929 3300007265 Unclassified 539
215 Ga0099795_10016445 3300007788 Unclassified 2340
216 Ga0099795_10021824 3300007788 Unclassified 2106
217 Ga0099795_10120689 3300007788 Bacteria 1048
218 Ga0099795_10262980 3300007788 Unclassified 748
219 Ga0105240_10036339 3300009093 Bacteria 6339
220 Ga0105240_10446312 3300009093 Bacteria 1449
221 Ga0105245_10318082 3300009098 Bacteria 1532
222 Ga0105245_11572121 3300009098 Bacteria 709
223 Ga0105247_10006665 3300009101 Bacteria 7128
224 Ga0114129_10001078 3300009147 Bacteria 35880
225 Ga0114129_10003166 3300009147 Bacteria 23085
226 Ga0114129_10031903 3300009147 Bacteria 7448
227 Ga0114129_10066811 3300009147 Bacteria 5014
228 Ga0114129_10140982 3300009147 Unclassified 3304
229 Ga0114129_10214885 3300009147 Bacteria 2597
230 Ga0114129_10426668 3300009147 Unclassified 1743
231 Ga0114129_10751503 3300009147 Unclassified 1248
232 Ga0114129_10779833 3300009147 Unclassified 1221
233 Ga0105243_10619560 3300009148 Unclassified 1044
234 Ga0105242_10141767 3300009176 Bacteria 2086
235 Ga0105248_10223924 3300009177 Bacteria 2117
236 Ga0105248_10346371 3300009177 Unclassified 1673
237 Ga0105248_10408556 3300009177 Bacteria 1529
238 Ga0105248_10499932 3300009177 Unclassified 1371
239 Ga0099796_10020685 3300010159 Unclassified 2015
240 Ga0099796_10269580 3300010159 Bacteria 713
241 Ga0099796_10342851 3300010159 Unclassified 642
242 Ga0099796_10586816 3300010159 Unclassified 502
243 Ga0163162_11597846 3300013306 Unclassified 744
244 Ga0157380_10120384 3300014326 Unclassified 2223
245 Ga0157379_10012140 3300014968 Bacteria 7523
246 Ga0213874_10049797 3300021377 Bacteria 1282
247 Ga0224570_105754 3300022730 Unclassified 755
248 Ga0224569_101857 3300022732 Bacteria 1745
249 Ga0224572_1030448 3300024225 Unclassified 1030
250 Ga0228598_1000556 3300024227 Bacteria 7803
251 Ga0228598_1028596 3300024227 Bacteria 1097
252 Ga0207653_10092651 3300025885 Unclassified 1060
253 Ga0207692_10185769 3300025898 Unclassified 1214
254 Ga0207692_10355172 3300025898 Unclassified 904
255 Ga0207642_10215685 3300025899 Unclassified 1069
256 Ga0207710_10029415 3300025900 Bacteria 2391
257 Ga0207680_10339186 3300025903 Bacteria 1054
258 Ga0207685_10073180 3300025905 Unclassified 1395
259 Ga0207699_10268732 3300025906 Unclassified 1181
260 Ga0207699_10729267 3300025906 Unclassified 726
261 Ga0207699_10918650 3300025906 Unclassified 646
262 Ga0207645_10038668 3300025907 Unclassified 3058
263 Ga0207684_10000898 3300025910 Bacteria 33862
264 Ga0207684_10370605 3300025910 Unclassified 1232
265 Ga0207684_10665955 3300025910 Unclassified 886
266 Ga0207684_11310748 3300025910 Unclassified 596
267 Ga0207684_11486923 3300025910 Bacteria 552
268 Ga0207684_11687881 3300025910 Unclassified 511
269 Ga0207695_10087688 3300025913 Bacteria 3134
270 Ga0207695_10263566 3300025913 Bacteria 1620
271 Ga0207693_10027962 3300025915 Unclassified 4458
272 Ga0207693_10149531 3300025915 Unclassified 1837
273 Ga0207693_10182440 3300025915 Bacteria 1652
274 Ga0207693_10209268 3300025915 Bacteria 1533
275 Ga0207693_10358334 3300025915 Unclassified 1141
276 Ga0207693_10594070 3300025915 Unclassified 862
277 Ga0207693_11075793 3300025915 Unclassified 612
278 Ga0207663_10525851 3300025916 Unclassified 922
279 Ga0207663_10557547 3300025916 Bacteria 896
280 Ga0207663_10675234 3300025916 Unclassified 817
281 Ga0207663_11624441 3300025916 Unclassified 520
282 Ga0207663_11639850 3300025916 Bacteria 518
283 Ga0207660_10501409 3300025917 Bacteria 985
284 Ga0207646_10000037 3300025922 Bacteria 196362
285 Ga0207646_10003539 3300025922 Bacteria 17564
286 Ga0207646_10029788 3300025922 Bacteria 4956
287 Ga0207646_10051193 3300025922 Bacteria 3695
288 Ga0207646_10161903 3300025922 Unclassified 2019
289 Ga0207646_10203586 3300025922 Bacteria 1788
290 Ga0207646_10283646 3300025922 Bacteria 1497
291 Ga0207646_10314045 3300025922 Bacteria 1416
292 Ga0207646_11029751 3300025922 Bacteria 727
293 Ga0207681_10096345 3300025923 Unclassified 2124
294 Ga0207687_10292548 3300025927 Bacteria 1309
295 Ga0207700_10135647 3300025928 Unclassified 2015
296 Ga0207700_10204964 3300025928 Bacteria 1664
297 Ga0207700_10380200 3300025928 Bacteria 1235
298 Ga0207700_11245181 3300025928 Unclassified 664
299 Ga0207700_11819018 3300025928 Unclassified 535
300 Ga0207664_10061462 3300025929 Bacteria 2997
301 Ga0207664_10136631 3300025929 Bacteria 2069
302 Ga0207664_10195913 3300025929 Unclassified 1741
303 Ga0207664_10636530 3300025929 Unclassified 958
304 Ga0207686_10444813 3300025934 Bacteria 996
305 Ga0207709_10022327 3300025935 Unclassified 3589
306 Ga0207669_10305667 3300025937 Unclassified 1211
307 Ga0207704_10051110 3300025938 Unclassified 2497
308 Ga0207665_10015381 3300025939 Bacteria 5024
309 Ga0207665_10029672 3300025939 Bacteria 3614
310 Ga0207665_10089067 3300025939 Unclassified 2137
311 Ga0207665_10247648 3300025939 Unclassified 1315
312 Ga0207665_10908370 3300025939 Unclassified 699
313 Ga0207665_11627272 3300025939 Bacteria 512
314 Ga0207711_10164082 3300025941 Bacteria 2013
315 Ga0207711_10573622 3300025941 Bacteria 1052
316 Ga0207711_11229715 3300025941 Unclassified 691
317 Ga0207689_11451912 3300025942 Unclassified 574
318 Ga0207651_11064179 3300025960 Unclassified 724
319 Ga0207640_10192664 3300025981 Unclassified 1538
320 Ga0207640_11303261 3300025981 Unclassified 648
321 Ga0207677_10681143 3300026023 Unclassified 910
322 Ga0207703_10067548 3300026035 Bacteria 2942
323 Ga0207703_10478851 3300026035 Bacteria 1166
324 Ga0207703_11746157 3300026035 Unclassified 598
325 Ga0207708_10471337 3300026075 Unclassified 1049
326 Ga0207675_100243489 3300026118 Unclassified 1738
327 Ga0207675_100313132 3300026118 Bacteria 1531
328 Ga0209179_1063390 3300027512 Unclassified 804
329 Ga0209588_1010231 3300027671 Bacteria 2817
330 Ga0209588_1012800 3300027671 Bacteria 2552
331 Ga0209588_1031027 3300027671 Unclassified 1709
332 Ga0209588_1166444 3300027671 Unclassified 695
333 Ga0209588_1186304 3300027671 Unclassified 650
334 Ga0207428_10597920 3300027907 Bacteria 795
335 Ga0265356_1000387 3300028017 Bacteria 7992
336 Ga0268264_10144584 3300028381 Bacteria 2125
337 Ga0265338_10390405 3300028800 Bacteria 994
338 Ga0265762_1000166 3300030760 Bacteria 10399
339 Ga0265760_10000643 3300031090 Bacteria 9894
340 Ga0265760_10000797 3300031090 Bacteria 9073
341 Ga0265760_10011407 3300031090 Bacteria 2538
342 Ga0265760_10023880 3300031090 Bacteria 1778
343 Ga0307408_101298521 3300031548 Unclassified 682
344 Ga0316214_1004620 3300033545 Bacteria 1780
345 Ga0373929_0005341 3300035085 Unclassified 2309
346 Ga0373940_0049100 3300035088 Bacteria 1181
347 Ga0373937_2178412 3300036401 Bacteria 500
348 Ga0242420_099801 3300038996 Unclassified 617
349 Ga0436363_1534040 3300039450 Bacteria 4929
350 Ga0451577_0109583 3300042876 Bacteria 2469
351 Ga0451577_0170351 3300042876 Unclassified 1962
352 Ga0453683_0001708 3300044673 Bacteria 18260
353 Ga0453683_0038909 3300044673 Bacteria 2989
354 Ga0453683_0240654 3300044673 Unclassified 1152
355 Ga0453684_0048404 3300044712 Bacteria 5623
356 Ga0451576_0223241 3300045051 Bacteria 1967
357 Ga0495592_0149469 3300046454 Unclassified 1617
358 Ga0495651_0000340 3300046462 Bacteria 36162
359 Ga0495653_0194996 3300046463 Bacteria 1379
360 Ga0495666_0539903 3300046526 Unclassified 520
361 Ga0495665_0256661 3300046531 Unclassified 899
362 Ga0495587_0482796 3300046536 Unclassified 686
363 Ga0495645_0079618 3300046543 Bacteria 2353
364 Ga0495645_0269442 3300046543 Bacteria 1124
365 Ga0495634_0028936 3300046642 Bacteria 3841
366 Ga0495613_0023396 3300046689 Unclassified 4603
367 Ga0495613_0191786 3300046689 Unclassified 1444
368 Ga0495600_0058769 3300046809 Bacteria 2512
369 Ga0495674_0128949 3300047319 Unclassified 2132
370 Ga0495674_0690325 3300047319 Bacteria 802
371 Ga0495680_0000376 3300047322 Bacteria 50038
372 Ga0495675_0022145 3300047444 Bacteria 4050
373 Ga0496100_0366345 3300048903 Bacteria 1092
374 Ga0496102_1444394 3300048905 Bacteria 607
375 Ga0496106_0098979 3300048909 Unclassified 2260
376 Ga0496106_0904291 3300048909 Bacteria 697
377 Ga0496107_1082384 3300048910 Bacteria 580
378 Ga0496112_0445567 3300048915 Bacteria 1233
379 Ga0496113_0540160 3300048916 Unclassified 935
380 Ga0501075_1019480 3300049591 Bacteria 629
381 Ga0501081_0097357 3300049743 Unclassified 2076
382 nmdc:mga05p37_115406_c1 3300050507 Unclassified 3301
383 nmdc:mga05p37_1263875_c1 3300050507 Bacteria 756
384 nmdc:mga05p37_189366_c1 3300050507 Bacteria 2499
385 nmdc:mga05p37_20510_c1 3300050507 Bacteria 7995
386 nmdc:mga05p37_26148_c1 3300050507 Bacteria 7097
387 nmdc:mga05p37_52687_c2 3300050507 Bacteria 2465
388 nmdc:mga05p37_7979_c1 3300050507 Bacteria 12495
389 nmdc:mga05p37_87596_c1 3300050507 Unclassified 3838
390 nmdc:mga05p37_945739_c1 3300050507 Bacteria 923
391 nmdc:mga06r32_1262740_c1 3300050510 Unclassified 683
392 nmdc:mga0n895_122533_c1 3300050512 Bacteria 2622
393 nmdc:mga0n895_136379_c1 3300050512 Bacteria 2481
394 nmdc:mga0n895_147581_c1 3300050512 Unclassified 2382
395 nmdc:mga0n895_201396_c1 3300050512 Bacteria 2022
396 nmdc:mga0n895_3856_c1 3300050512 Bacteria 12172
397 nmdc:mga0n895_407926_c1 3300050512 Bacteria 1374
398 nmdc:mga0n895_538387_c1 3300050512 Bacteria 1174
399 nmdc:mga0n895_55473_c1 3300050512 Unclassified 3900
400 nmdc:mga0rr50_143876_c1 3300050513 Bacteria 1920
401 nmdc:mga0rr50_24542_c1 3300050513 Unclassified 4177
402 nmdc:mga0rr50_255457_c1 3300050513 Bacteria 1457
403 nmdc:mga0rr50_36564_c1 3300050513 Unclassified 3538
404 nmdc:mga0rr50_414168_c1 3300050513 Unclassified 1139
405 nmdc:mga0rr50_50083_c1 3300050513 Bacteria 3094
406 nmdc:mga0rr50_94338_c1 3300050513 Bacteria 2336
407 nmdc:mga08x19_1078505_c1 3300050514 Bacteria 570
408 nmdc:mga08x19_165700_c1 3300050514 Bacteria 1503
409 nmdc:mga08x19_17642_c1 3300050514 Bacteria 4371
410 nmdc:mga08x19_18092_c1 3300050514 Bacteria 4317
411 nmdc:mga08x19_24799_c1 3300050514 Bacteria 3731
412 nmdc:mga08x19_279491_c1 3300050514 Unclassified 1156
413 nmdc:mga08x19_2974_c1 3300050514 Bacteria 10178
414 nmdc:mga08x19_299240_c1 3300050514 Bacteria 1117
415 nmdc:mga08x19_328364_c1 3300050514 Unclassified 1065
416 nmdc:mga08x19_36455_c1 3300050514 Unclassified 3115
417 nmdc:mga08x19_380926_c1 3300050514 Unclassified 988
418 nmdc:mga08x19_492525_c1 3300050514 Unclassified 865
419 nmdc:mga08x19_500778_c1 3300050514 Unclassified 858
420 nmdc:mga08x19_568924_c1 3300050514 Unclassified 802
421 nmdc:mga08x19_87675_c1 3300050514 Bacteria 2051
422 nmdc:mga0a205_178314_c1 3300050515 Bacteria 2020
423 nmdc:mga0a205_200964_c1 3300050515 Bacteria 1884
424 nmdc:mga0a205_233394_c1 3300050515 Bacteria 1722
425 nmdc:mga0a205_271781_c1 3300050515 Bacteria 1572
426 nmdc:mga0a205_29668_c1 3300050515 Bacteria 5235
427 nmdc:mga0a205_8965_c1 3300050515 Bacteria 9118
428 Ga0495619_0932173 3300053085 Unclassified 583
429 Ga0501082_0765287 3300060353 Bacteria 845
430 Ga0070694_100009803
431 MBSR1b_contig_2141048
432 LJNas_1000082
433 Ga0065715_10401728
434 Ga0065707_10114302
435 Ga0068869_101108206
436 Ga0070666_10385780
437 Ga0070666_10444848
438 Ga0070680_100142750
439 Ga0070680_100602066
440 Ga0068868_102285173
441 Ga0070691_10004040
442 Ga0070687_100244521
443 Ga0070692_10409725
444 Ga0070669_100667704
445 Ga0070671_101576339
446 Ga0070674_100460188
447 Ga0070673_101618935
448 Ga0070709_10021021
449 Ga0070709_10783535
450 Ga0070714_100128330
451 Ga0070714_100491182
452 Ga0070713_100067254
453 Ga0070713_100078918
454 Ga0070713_100297214
455 Ga0070713_100350856
456 Ga0070713_100798261
457 Ga0070713_101206736
458 Ga0070713_102236884
459 Ga0070710_10466407
460 Ga0070710_10599356
461 Ga0070710_10696496
462 Ga0070710_11191246
463 Ga0070701_10408866
464 Ga0070701_11106543
465 Ga0070711_100274742
466 Ga0070711_100274947
467 Ga0070711_100488973
468 Ga0070711_100928931
469 Ga0070711_101028021
470 Ga0070705_100173367
471 Ga0070705_100249325
472 Ga0070705_101266670
473 Ga0070700_100007814
474 Ga0070694_100094277
475 Ga0070694_100305240
476 Ga0070708_100000812
477 Ga0070708_100003438
478 Ga0070708_100025327
479 Ga0070708_100037121
480 Ga0070708_100045901
481 Ga0070708_100079156
482 Ga0070708_100280271
483 Ga0070708_100363259
484 Ga0070708_100373178
485 Ga0070708_100401169
486 Ga0070708_101271589
487 Ga0070678_101826522
488 Ga0070662_100272033
489 Ga0068867_100012794
490 Ga0068867_101313403
491 Ga0070706_100108270
492 Ga0070706_100304418
493 Ga0070706_100357584
494 Ga0070706_100409150
495 Ga0070706_100569349
496 Ga0070706_100798569
497 Ga0070706_100858673
498 Ga0070706_101621806
499 Ga0070707_100000050
500 Ga0070707_100016579
501 Ga0070707_100085268
502 Ga0070707_100114885
503 Ga0070707_100183325
504 Ga0070707_100198475
505 Ga0070707_100204142
506 Ga0070707_100225248
507 Ga0070707_100601046
508 Ga0070707_100623586
509 Ga0070707_100822006
510 Ga0070707_100915408
511 Ga0070707_101154242
512 Ga0070707_101585874
513 Ga0070707_101850470
514 Ga0070707_102064554
515 Ga0070698_100012795
516 Ga0070698_100014688
517 Ga0070698_100055867
518 Ga0070698_100093145
519 Ga0070698_101542028
520 Ga0070699_100003604
521 Ga0070699_100003881
522 Ga0070699_100011263
523 Ga0070699_100159558
524 Ga0070699_100225670
525 Ga0070699_100234268
526 Ga0070699_100264221
527 Ga0070699_100337966
528 Ga0070699_100397570
529 Ga0070699_100708429
530 Ga0070699_101144505
531 Ga0070699_101315751
532 Ga0070697_100001160
533 Ga0070697_100005065
534 Ga0070697_100023719
535 Ga0070697_100052724
536 Ga0070697_100087998
537 Ga0070697_100129609
538 Ga0070697_100132106
539 Ga0070697_100374412
540 Ga0070697_100647544
541 Ga0070697_100723185
542 Ga0070697_100878342
543 Ga0070697_101348519
544 Ga0068853_100894981
545 Ga0070672_101123789
546 Ga0070695_100007221
547 Ga0070695_100024169
548 Ga0070695_100116285
549 Ga0070695_100407449
550 Ga0070695_100455743
551 Ga0070695_101512950
552 Ga0070696_100013449
553 Ga0070696_100041390
554 Ga0070704_100005247
555 Ga0070704_100111002
556 Ga0068854_100138539
557 Ga0068854_100567343
558 Ga0070702_100001800
559 Ga0068859_101022282
560 Ga0068866_10120231
561 Ga0068866_11406915
562 Ga0068861_100034683
563 Ga0068861_100301610
564 Ga0068861_100505235
565 Ga0068858_100181239
566 Ga0068858_100856899
567 Ga0068858_101163724
568 Ga0068860_100160015
569 Ga0068860_102865137
570 Ga0068862_100902321
571 Ga0070717_10063733
572 Ga0070717_10066475
573 Ga0070717_10082203
574 Ga0070717_10084983
575 Ga0070717_10366837
576 Ga0070717_10657517
577 Ga0070717_10678219
578 Ga0070717_10842047
579 Ga0070717_11075974
580 Ga0070717_11629733
581 Ga0075432_10060382
582 Ga0075432_10062924
583 Ga0070715_10107318
584 Ga0070716_100084566
585 Ga0070716_100111207
586 Ga0070716_100456569
587 Ga0070716_100458748
588 Ga0070716_100496734
589 Ga0070716_100576671
590 Ga0070716_101163894
591 Ga0070712_100041567
592 Ga0070712_100239259
593 Ga0070712_100344743
594 Ga0070712_100700025
595 Ga0070712_101458725
596 Ga0070712_101734068
597 Ga0075433_10029280
598 Ga0075433_10189730
599 Ga0075433_10244361
600 Ga0075433_10268377
601 Ga0075433_10654560
602 Ga0075433_10869885
603 Ga0075433_11426320
604 Ga0075434_100014641
605 Ga0075434_100048910
606 Ga0075434_100109073
607 Ga0075434_100131666
608 Ga0075434_100435650
609 Ga0075434_100536518
610 Ga0075434_100852664
611 Ga0075434_102133177
612 Ga0068865_100103657
613 Ga0075436_100011726
614 Ga0075436_100013066
615 Ga0075436_100019324
616 Ga0075436_100029254
617 Ga0075436_100060328
618 Ga0075436_100061995
619 Ga0075436_100146548
620 Ga0075436_100308656
621 Ga0075436_100318577
622 Ga0075436_100470170
623 Ga0075436_100487094
624 Ga0075436_100638887
625 Ga0075436_100685560
626 Ga0097620_101022109
627 Ga0075435_100008421
628 Ga0075435_100009160
629 Ga0075435_100011447
630 Ga0075435_100081609
631 Ga0075435_100129752
632 Ga0075435_100186191
633 Ga0075435_100443889
634 Ga0075435_100690042
635 Ga0075435_100830650
636 Ga0075435_101409949
637 Ga0075435_101561923
638 Ga0075435_101794526
639 Ga0099794_10022696
640 Ga0099794_10024168
641 Ga0099794_10027412
642 Ga0099794_10263975
643 Ga0099794_10699929
644 Ga0099795_10016445
645 Ga0099795_10021824
646 Ga0099795_10120689
647 Ga0099795_10262980
648 Ga0105240_10036339
649 Ga0105240_10446312
650 Ga0105245_10318082
651 Ga0105245_11572121
652 Ga0105247_10006665
653 Ga0114129_10001078
654 Ga0114129_10003166
655 Ga0114129_10031903
656 Ga0114129_10066811
657 Ga0114129_10140982
658 Ga0114129_10214885
659 Ga0114129_10426668
660 Ga0114129_10751503
661 Ga0114129_10779833
662 Ga0105243_10619560
663 Ga0105242_10141767
664 Ga0105248_10223924
665 Ga0105248_10346371
666 Ga0105248_10408556
667 Ga0105248_10499932
668 Ga0099796_10020685
669 Ga0099796_10269580
670 Ga0099796_10342851
671 Ga0099796_10586816
672 Ga0163162_11597846
673 Ga0157380_10120384
674 Ga0157379_10012140
675 Ga0213874_10049797
676 Ga0224570_105754
677 Ga0224569_101857
678 Ga0224572_1030448
679 Ga0228598_1000556
680 Ga0228598_1028596
681 Ga0207653_10092651
682 Ga0207692_10185769
683 Ga0207692_10355172
684 Ga0207642_10215685
685 Ga0207710_10029415
686 Ga0207680_10339186
687 Ga0207685_10073180
688 Ga0207699_10268732
689 Ga0207699_10729267
690 Ga0207699_10918650
691 Ga0207645_10038668
692 Ga0207684_10000898
693 Ga0207684_10370605
694 Ga0207684_10665955
695 Ga0207684_11310748
696 Ga0207684_11486923
697 Ga0207684_11687881
698 Ga0207695_10087688
699 Ga0207695_10263566
700 Ga0207693_10027962
701 Ga0207693_10149531
702 Ga0207693_10182440
703 Ga0207693_10209268
704 Ga0207693_10358334
705 Ga0207693_10594070
706 Ga0207693_11075793
707 Ga0207663_10525851
708 Ga0207663_10557547
709 Ga0207663_10675234
710 Ga0207663_11624441
711 Ga0207663_11639850
712 Ga0207660_10501409
713 Ga0207646_10000037
714 Ga0207646_10003539
715 Ga0207646_10029788
716 Ga0207646_10051193
717 Ga0207646_10161903
718 Ga0207646_10203586
719 Ga0207646_10283646
720 Ga0207646_10314045
721 Ga0207646_11029751
722 Ga0207681_10096345
723 Ga0207687_10292548
724 Ga0207700_10135647
725 Ga0207700_10204964
726 Ga0207700_10380200
727 Ga0207700_11245181
728 Ga0207700_11819018
729 Ga0207664_10061462
730 Ga0207664_10136631
731 Ga0207664_10195913
732 Ga0207664_10636530
733 Ga0207686_10444813
734 Ga0207709_10022327
735 Ga0207669_10305667
736 Ga0207704_10051110
737 Ga0207665_10015381
738 Ga0207665_10029672
739 Ga0207665_10089067
740 Ga0207665_10247648
741 Ga0207665_10908370
742 Ga0207665_11627272
743 Ga0207711_10164082
744 Ga0207711_10573622
745 Ga0207711_11229715
746 Ga0207689_11451912
747 Ga0207651_11064179
748 Ga0207640_10192664
749 Ga0207640_11303261
750 Ga0207677_10681143
751 Ga0207703_10067548
752 Ga0207703_10478851
753 Ga0207703_11746157
754 Ga0207708_10471337
755 Ga0207675_100243489
756 Ga0207675_100313132
757 Ga0209179_1063390
758 Ga0209588_1010231
759 Ga0209588_1012800
760 Ga0209588_1031027
761 Ga0209588_1166444
762 Ga0209588_1186304
763 Ga0207428_10597920
764 Ga0265356_1000387
765 Ga0268264_10144584
766 Ga0265338_10390405
767 Ga0265762_1000166
768 Ga0265760_10000643
769 Ga0265760_10000797
770 Ga0265760_10011407
771 Ga0265760_10023880
772 Ga0307408_101298521
773 Ga0316214_1004620
774 Ga0373929_0005341
775 Ga0373940_0049100
776 Ga0373937_2178412
777 Ga0242420_099801
778 Ga0436363_1534040
779 Ga0451577_0109583
780 Ga0451577_0170351
781 Ga0453683_0001708
782 Ga0453683_0038909
783 Ga0453683_0240654
784 Ga0453684_0048404
785 Ga0451576_0223241
786 Ga0495592_0149469
787 Ga0495651_0000340
788 Ga0495653_0194996
789 Ga0495666_0539903
790 Ga0495665_0256661
791 Ga0495587_0482796
792 Ga0495645_0079618
793 Ga0495645_0269442
794 Ga0495634_0028936
795 Ga0495613_0023396
796 Ga0495613_0191786
797 Ga0495600_0058769
798 Ga0495674_0128949
799 Ga0495674_0690325
800 Ga0495680_0000376
801 Ga0495675_0022145
802 Ga0496100_0366345
803 Ga0496102_1444394
804 Ga0496106_0098979
805 Ga0496106_0904291
806 Ga0496107_1082384
807 Ga0496112_0445567
808 Ga0496113_0540160
809 Ga0501075_1019480
810 Ga0501081_0097357
811 nmdc:mga05p37_115406_c1
812 nmdc:mga05p37_1263875_c1
813 nmdc:mga05p37_189366_c1
814 nmdc:mga05p37_20510_c1
815 nmdc:mga05p37_26148_c1
816 nmdc:mga05p37_52687_c2
817 nmdc:mga05p37_7979_c1
818 nmdc:mga05p37_87596_c1
819 nmdc:mga05p37_945739_c1
820 nmdc:mga06r32_1262740_c1
821 nmdc:mga0n895_122533_c1
822 nmdc:mga0n895_136379_c1
823 nmdc:mga0n895_147581_c1
824 nmdc:mga0n895_201396_c1
825 nmdc:mga0n895_3856_c1
826 nmdc:mga0n895_407926_c1
827 nmdc:mga0n895_538387_c1
828 nmdc:mga0n895_55473_c1
829 nmdc:mga0rr50_143876_c1
830 nmdc:mga0rr50_24542_c1
831 nmdc:mga0rr50_255457_c1
832 nmdc:mga0rr50_36564_c1
833 nmdc:mga0rr50_414168_c1
834 nmdc:mga0rr50_50083_c1
835 nmdc:mga0rr50_94338_c1
836 nmdc:mga08x19_1078505_c1
837 nmdc:mga08x19_165700_c1
838 nmdc:mga08x19_17642_c1
839 nmdc:mga08x19_18092_c1
840 nmdc:mga08x19_24799_c1
841 nmdc:mga08x19_279491_c1
842 nmdc:mga08x19_2974_c1
843 nmdc:mga08x19_299240_c1
844 nmdc:mga08x19_328364_c1
845 nmdc:mga08x19_36455_c1
846 nmdc:mga08x19_380926_c1
847 nmdc:mga08x19_492525_c1
848 nmdc:mga08x19_500778_c1
849 nmdc:mga08x19_568924_c1
850 nmdc:mga08x19_87675_c1
851 nmdc:mga0a205_178314_c1
852 nmdc:mga0a205_200964_c1
853 nmdc:mga0a205_233394_c1
854 nmdc:mga0a205_271781_c1
855 nmdc:mga0a205_29668_c1
856 nmdc:mga0a205_8965_c1
857 Ga0495619_0932173
858 Ga0501082_0765287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map