F441820

General Info

Members Datasets Scaffolds Average Seq Length
429 259 392 262

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1001318|Ga0055536_10013185
Length 300
Sequence MVRRGDARACGVVPPGTMRPMSDRASLRLDHVLRAAATRLAGPDARHEAEQLLLHVIGRDRAWLFAHGDASLADADASAFDVLLARRIAGEPVAYLVGHRGFWTLDLQVSPATLIPRPETERLVELALERLPTDTPLRIADLGTASERPQAQVIATDFSEAALAIARANAVSNVIANVEFRYGSWWAPLRGERFHLIASNPPYIADGDAHLARGDLRFEPASALSSGADGLEAIRELVDKAPTHLMPGGWLLLEHGWDQGAAIRTLMTAAGFVDVATETDLEQRDRVTLGRVTEGQDASR

Samples

Sample ID Description Type Environment
1 2511231024 Pseudomonas sp. GM84 Isolate Nodule
2 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
5 2643221585 Pelomonas sp. Root662 Isolate Unclassified
6 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
7 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
10 2721755523 Delftia sp. HK171 Isolate Unclassified
11 2738541337 Pelomonas sp. BT06 Isolate Unclassified
12 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
13 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
14 2818991457 Xanthomonas translucens 569 Isolate Unclassified
15 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
16 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
17 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
18 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
19 2865014394 Pantoea sp. R-71966 Isolate Unclassified
20 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
21 2884411467 Dyella sp. AD56 Isolate Rhizosphere
22 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
23 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
24 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
25 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
26 2919085039 Luteibacter sp. 1214 Isolate Unclassified
27 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
28 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
29 2928963466 Dyella japonica 1073 Isolate Unclassified
30 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
31 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
32 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
33 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
34 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
35 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
44 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
45 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
101 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
140 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
159 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
160 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
161 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
169 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
170 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
171 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
172 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
173 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
174 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
175 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
176 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
177 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
178 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
179 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
180 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
253 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
254 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 8052494512 Pseudomonas putida LD6 Isolate Unclassified
257 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
258 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
259 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.44
Metatranscriptomes 0.47
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.12
Nodule 0.23
Rhizoplane 4.2
Rhizosphere 60.61
Stem 0
Stem Tuber 0
Unclassified 22.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008251 3300001979 Bacteria 4166
2 JGI24739J22299_10000762 3300001989 Bacteria 11715
3 JGI25162J39368_1007206 3300002737 Bacteria 1771
4 rootH1_10029004 3300003316 Bacteria 1936
5 rootH1_10029004 3300003323 Bacteria 45866
6 rootH2_10023191 3300003320 Bacteria 7657
7 rootH2_10273930 3300003320 Bacteria 1939
8 rootL2_10029937 3300003322 Bacteria 3298
9 rootH1_10004937 3300003323 Bacteria 1824
10 rootH1_10040818 3300003323 Bacteria 1800
11 rootH1_10047105 3300003316 Bacteria 2349
12 rootH1_10047105 3300003323 Bacteria 1580
13 Ga0006562J51391_1033717 3300003578 Bacteria 9010
14 Ga0006562J51391_1033718 3300003578 Bacteria 7986
15 Ga0055533_1000688 3300003756 Bacteria 11102
16 Ga0055524_1044542 3300003775 Bacteria 1077
17 Ga0055536_1001318 3300003781 Bacteria 15207
18 Ga0055536_1001895 3300003781 Bacteria 12146
19 Ga0055536_1001900 3300003781 Bacteria 12115
20 Ga0055536_1004685 3300003781 Bacteria 6896
21 Ga0055536_1018376 3300003781 Bacteria 2243
22 Ga0055534_1000252 3300003784 Bacteria 37490
23 Ga0055530_10002026 3300003791 Bacteria 13694
24 Ga0055531_10000137 3300003794 Bacteria 83343
25 Ga0055531_10002549 3300003794 Bacteria 12119
26 Ga0055531_10002554 3300003794 Bacteria 12115
27 Ga0055531_10025096 3300003794 Bacteria 2177
28 Ga0055531_10053989 3300003794 Bacteria 1034
29 Ga0058692_1000032 3300003856 Bacteria 179581
30 Ga0058692_1000107 3300003856 Bacteria 55344
31 Ga0058692_1002986 3300003856 Bacteria 5427
32 Ga0058692_1011823 3300003856 Bacteria 2094
33 Ga0065165_1002123 3300005262 Bacteria 18041
34 Ga0065704_10008845 3300005289 Bacteria 2966
35 Ga0070658_10003129 3300005327 Bacteria 13660
36 Ga0070670_100054908 3300005331 Bacteria 3420
37 Ga0068869_100117733 3300005334 Bacteria 2028
38 Ga0070666_10000010 3300005335 Bacteria 264789
39 Ga0070680_100048943 3300005336 Bacteria 3446
40 Ga0070660_100037837 3300005339 Bacteria 3659
41 Ga0070661_100457289 3300005344 Bacteria 1016
42 Ga0070668_100002531 3300005347 Bacteria 13458
43 Ga0070668_100142034 3300005347 Bacteria 1936
44 Ga0070659_100121253 3300005366 Bacteria 2118
45 Ga0070663_100018995 3300005455 Bacteria 4520
46 Ga0070662_100066276 3300005457 Bacteria 2649
47 Ga0070665_100000092 3300005548 Bacteria 174397
48 Ga0070665_100005878 3300005548 Bacteria 12578
49 Ga0070665_100559274 3300005548 Bacteria 1156
50 Ga0068855_100025379 3300005563 Bacteria 7091
51 Ga0068855_100040109 3300005563 Bacteria 5558
52 Ga0068857_100000765 3300005577 Bacteria 23901
53 Ga0068854_100006033 3300005578 Bacteria 7676
54 Ga0068852_100042917 3300005616 Bacteria 3831
55 Ga0068859_100113354 3300005617 Bacteria 2775
56 Ga0068858_100057043 3300005842 Bacteria 3609
57 Ga0068858_100074345 3300005842 Bacteria 3155
58 Ga0068860_100059148 3300005843 Bacteria 3644
59 Ga0075365_10040729 3300006038 Bacteria 3030
60 Ga0075363_100054426 3300006048 Bacteria 2141
61 Ga0075364_10065183 3300006051 Bacteria 2391
62 Ga0075432_10028424 3300006058 Bacteria 1929
63 Ga0075370_10038971 3300006353 Bacteria 2676
64 Ga0075370_10073367 3300006353 Bacteria 1959
65 Ga0097620_100113361 3300006931 Bacteria 2775
66 Ga0105251_10004953 3300009011 Bacteria 8865
67 Ga0105251_10006174 3300009011 Bacteria 7699
68 Ga0105251_10008983 3300009011 Bacteria 5963
69 Ga0105251_10031734 3300009011 Bacteria 2640
70 Ga0105251_10043458 3300009011 Bacteria 2176
71 Ga0105251_10060547 3300009011 Bacteria 1782
72 Ga0105244_10005434 3300009036 Bacteria 8473
73 Ga0105244_10015889 3300009036 Bacteria 4305
74 Ga0105244_10116175 3300009036 Bacteria 1299
75 Ga0105250_10008018 3300009092 Bacteria 4504
76 Ga0105250_10059095 3300009092 Bacteria 1539
77 Ga0105240_10001824 3300009093 Bacteria 35727
78 Ga0105240_10001947 3300009093 Bacteria 34195
79 Ga0105240_10027799 3300009093 Bacteria 7401
80 Ga0105240_10036799 3300009093 Bacteria 6293
81 Ga0105243_10003789 3300009148 Bacteria 12102
82 Ga0105243_10017040 3300009148 Bacteria 5494
83 Ga0105243_10046109 3300009148 Bacteria 3427
84 Ga0105248_10044178 3300009177 Bacteria 4997
85 Ga0105237_10000145 3300009545 Bacteria 99941
86 Ga0105238_10000915 3300009551 Bacteria 30195
87 Ga0105238_10316376 3300009551 Bacteria 1546
88 Ga0105239_10001603 3300010375 Bacteria 29884
89 Ga0105239_10086992 3300010375 Bacteria 3444
90 Ga0105246_10120102 3300011119 Bacteria 1946
91 Ga0157314_1000113 3300012500 Bacteria 8755
92 Ga0157371_10130115 3300013102 Bacteria 1791
93 Ga0157370_10002903 3300013104 Bacteria 20440
94 Ga0157370_10027392 3300013104 Bacteria 5619
95 Ga0163162_10002334 3300013306 Bacteria 17809
96 Ga0163162_10054747 3300013306 Bacteria 4014
97 Ga0157372_10005933 3300013307 Bacteria 12988
98 Ga0157372_10351363 3300013307 Bacteria 1717
99 Ga0157375_10022239 3300013308 Bacteria 5834
100 Ga0182008_10001173 3300014497 Bacteria 18074
101 Ga0182008_10024645 3300014497 Bacteria 3061
102 Ga0182008_10024704 3300014497 Bacteria 3056
103 Ga0157376_10013351 3300014969 Bacteria 6127
104 Ga0182006_1014021 3300015261 Bacteria 3461
105 Ga0182007_10000173 3300015262 Bacteria 43981
106 Ga0182005_1000049 3300015265 Bacteria 123003
107 Ga0182005_1003460 3300015265 Bacteria 5348
108 Ga0163161_10006009 3300017792 Bacteria 8413
109 Ga0209435_105999 3300025206 Bacteria 1359
110 Ga0209566_105366 3300025225 Bacteria 1622
111 Ga0209674_100061 3300025226 Bacteria 280844
112 Ga0209437_100109 3300025233 Bacteria 217031
113 Ga0209437_100111 3300025233 Bacteria 214944
114 Ga0209437_103687 3300025233 Bacteria 2742
115 Ga0209759_1005374 3300025256 Bacteria 4507
116 Ga0209129_1005092 3300025258 Bacteria 4819
117 Ga0209676_1000436 3300025292 Bacteria 72143
118 Ga0209676_1000594 3300025292 Bacteria 53972
119 Ga0209676_1000781 3300025292 Bacteria 42548
120 Ga0209676_1000875 3300025292 Bacteria 38585
121 Ga0209676_1001136 3300025292 Bacteria 29134
122 Ga0209676_1003109 3300025292 Bacteria 10665
123 Ga0209758_1000647 3300025297 Bacteria 52818
124 Ga0209050_1000328 3300025298 Bacteria 94963
125 Ga0209050_1001301 3300025298 Bacteria 28152
126 Ga0209256_1004437 3300025299 Bacteria 8810
127 Ga0209256_1005725 3300025299 Bacteria 6969
128 Ga0209051_1001685 3300025303 Bacteria 17778
129 Ga0209051_1002676 3300025303 Bacteria 12453
130 Ga0209257_1000086 3300025304 Bacteria 287437
131 Ga0209257_1000131 3300025304 Bacteria 211464
132 Ga0209257_1000655 3300025304 Bacteria 54777
133 Ga0209257_1000788 3300025304 Bacteria 46352
134 Ga0209257_1003998 3300025304 Bacteria 11901
135 Ga0209257_1035431 3300025304 Bacteria 1545
136 Ga0207696_1000338 3300025711 Bacteria 48899
137 Ga0207696_1001979 3300025711 Bacteria 10396
138 Ga0207696_1003620 3300025711 Bacteria 6961
139 Ga0207696_1007734 3300025711 Bacteria 4177
140 Ga0207655_1001644 3300025728 Bacteria 19816
141 Ga0207655_1014535 3300025728 Bacteria 4443
142 Ga0207655_1020541 3300025728 Bacteria 3389
143 Ga0207655_1039687 3300025728 Bacteria 2040
144 Ga0207655_1076865 3300025728 Bacteria 1219
145 Ga0207713_1000001 3300025735 Bacteria 2295391
146 Ga0207713_1001106 3300025735 Bacteria 23014
147 Ga0207713_1031924 3300025735 Bacteria 2320
148 Ga0207713_1038696 3300025735 Bacteria 2021
149 Ga0207680_10000002 3300025903 Bacteria 1018646
150 Ga0207647_10007615 3300025904 Bacteria 7802
151 Ga0207705_10030609 3300025909 Bacteria 3840
152 Ga0207705_10100242 3300025909 Bacteria 2130
153 Ga0207695_10001022 3300025913 Bacteria 49260
154 Ga0207695_10001062 3300025913 Bacteria 48136
155 Ga0207695_10005281 3300025913 Bacteria 17222
156 Ga0207695_10027845 3300025913 Bacteria 6283
157 Ga0207671_10000028 3300025914 Bacteria 263092
158 Ga0207660_10035547 3300025917 Bacteria 3460
159 Ga0207657_10020004 3300025919 Bacteria 6341
160 Ga0207649_10422350 3300025920 Bacteria 1001
161 Ga0207694_10001235 3300025924 Bacteria 22135
162 Ga0207650_10106691 3300025925 Bacteria 2163
163 Ga0207706_10061708 3300025933 Bacteria 3301
164 Ga0207709_10002319 3300025935 Bacteria 12040
165 Ga0207711_10023485 3300025941 Bacteria 5162
166 Ga0207667_10000480 3300025949 Bacteria 53149
167 Ga0207667_10011589 3300025949 Bacteria 10238
168 Ga0207667_10158562 3300025949 Bacteria 2328
169 Ga0207668_10055416 3300025972 Bacteria 2756
170 Ga0207640_10000313 3300025981 Bacteria 32457
171 Ga0207640_10001974 3300025981 Bacteria 11063
172 Ga0207703_10031962 3300026035 Bacteria 4164
173 Ga0207703_10067039 3300026035 Bacteria 2953
174 Ga0207678_10042782 3300026067 Bacteria 3922
175 Ga0207674_10000091 3300026116 Bacteria 99785
176 Ga0209371_1000028 3300027312 Bacteria 429688
177 Ga0209371_1000055 3300027312 Bacteria 257599
178 Ga0209371_1000288 3300027312 Bacteria 57378
179 Ga0209371_1000819 3300027312 Bacteria 25598
180 Ga0209371_1001645 3300027312 Bacteria 14395
181 Ga0209371_1001825 3300027312 Bacteria 13229
182 Ga0209371_1005323 3300027312 Bacteria 5165
183 Ga0268266_10000001 3300028379 Bacteria 4040580
184 Ga0268266_10000004 3300028379 Bacteria 1495817
185 Ga0268266_10256144 3300028379 Bacteria 1620
186 Ga0268266_10497266 3300028379 Bacteria 1164
187 Ga0268264_10049616 3300028381 Bacteria 3492
188 Ga0307515_10016568 3300028794 Bacteria 13488
189 Ga0307515_10105783 3300028794 Bacteria 3346
190 Ga0268256_1000030 3300030500 Bacteria 429688
191 Ga0268256_1000054 3300030500 Bacteria 257599
192 Ga0268256_1000135 3300030500 Bacteria 101750
193 Ga0268256_1000678 3300030500 Bacteria 25598
194 Ga0268256_1001593 3300030500 Bacteria 13220
195 Ga0268256_1002291 3300030500 Bacteria 9923
196 Ga0268256_1003662 3300030500 Bacteria 6791
197 Ga0316176_1075752 3300030732 Bacteria 3334
198 Ga0316183_1001193 3300030742 Bacteria 7562
199 Ga0307408_100000023 3300031548 Bacteria 295931
200 Ga0316576_10183548 3300031727 Bacteria 1578
201 Ga0307405_10256397 3300031731 Bacteria 1304
202 Ga0307412_10047673 3300031911 Bacteria 2815
203 Ga0307414_10093561 3300032004 Bacteria 2241
204 Ga0307411_10000103 3300032005 Bacteria 26223
205 Ga0307510_10002543 3300033180 Bacteria 20792
206 Ga0307510_10026179 3300033180 Bacteria 6712
207 Ga0373948_0010295 3300034817 Bacteria 1630
208 Ga0373950_0002781 3300034818 Bacteria 2445
209 Ga0373939_0000049 3300035114 Bacteria 42693
210 Ga0373962_0060232 3300035242 Bacteria 1113
211 Ga0373931_0002532 3300035691 Bacteria 8117
212 Ga0316582_0143590 3300036647 Bacteria 1610
213 Ga0395899_0003383 3300037312 Bacteria 12655
214 Ga0395900_0014177 3300037418 Bacteria 8139
215 Ga0395900_0217707 3300037418 Bacteria 1926
216 Ga0395905_0000151 3300037471 Bacteria 115485
217 Ga0395905_0001245 3300037471 Bacteria 31535
218 Ga0395905_0054278 3300037471 Bacteria 3750
219 Ga0395905_0151294 3300037471 Bacteria 2183
220 Ga0395905_0221292 3300037471 Bacteria 1771
221 Ga0395901_0060028 3300038443 Bacteria 3956
222 Ga0395901_0224288 3300038443 Bacteria 1964
223 Ga0439438_001496 3300041405 Bacteria 10302
224 Ga0439447_002053 3300041407 Bacteria 7402
225 Ga0439453_0009846 3300041408 Bacteria 1565
226 Ga0439466_0000023 3300041411 Bacteria 84850
227 Ga0439465_0010570 3300041413 Bacteria 2898
228 Ga0451853_2432414 3300041512 Bacteria 1782
229 Ga0439432_041229 3300042006 Bacteria 1462
230 Ga0439449_0005300 3300042007 Bacteria 4943
231 Ga0439449_0007077 3300042007 Bacteria 4272
232 Ga0439449_0016839 3300042007 Bacteria 2745
233 Ga0439449_0019837 3300042007 Bacteria 2520
234 Ga0439452_023787 3300042010 Bacteria 1573
235 Ga0439462_0030736 3300042015 Bacteria 1421
236 Ga0439462_0037299 3300042015 Bacteria 1294
237 Ga0450912_006224 3300042116 Bacteria 941
238 Ga0450888_000387 3300042126 Bacteria 4158
239 Ga0450890_005579 3300042127 Bacteria 1615
240 Ga0450891_001137 3300042129 Bacteria 2769
241 Ga0450892_000804 3300042130 Bacteria 3456
242 Ga0450900_005505 3300042136 Bacteria 1498
243 Ga0450902_007353 3300042137 Bacteria 1703
244 Ga0450903_007759 3300042138 Bacteria 1760
245 Ga0450905_002224 3300042142 Bacteria 2481
246 Ga0450889_000235 3300042144 Bacteria 6134
247 Ga0450907_000118 3300042146 Bacteria 30301
248 Ga0450893_0000871 3300042532 Bacteria 4489
249 Ga0450893_0028042 3300042532 Bacteria 994
250 Ga0450901_000331 3300042533 Bacteria 5785
251 Ga0450901_003489 3300042533 Bacteria 1639
252 Ga0451577_0037873 3300042876 Bacteria 4340
253 Ga0466982_0000007 3300044672 Bacteria 250854
254 Ga0466982_0001323 3300044672 Bacteria 8896
255 Ga0453683_0012232 3300044673 Bacteria 5630
256 Ga0466965_0145934 3300044683 Bacteria 1234
257 Ga0466966_0001249 3300044684 Bacteria 16281
258 Ga0453684_0244647 3300044712 Bacteria 2063
259 Ga0466971_0016051 3300044719 Bacteria 3300
260 Ga0466968_0014991 3300044735 Bacteria 3069
261 Ga0466970_0059644 3300044765 Bacteria 2043
262 Ga0466960_0008325 3300044901 Bacteria 4243
263 Ga0451576_0096001 3300045051 Bacteria 3083
264 Ga0451576_0315317 3300045051 Bacteria 1636
265 Ga0466958_0162422 3300045836 Bacteria 1412
266 Ga0495617_002282 3300046452 Bacteria 7757
267 Ga0495638_0000176 3300046460 Bacteria 99164
268 Ga0495638_0103724 3300046460 Bacteria 1697
269 Ga0495650_0000527 3300046471 Bacteria 55856
270 Ga0495650_0001015 3300046471 Bacteria 31654
271 Ga0495596_0040116 3300046500 Bacteria 1848
272 Ga0495607_0000133 3300046501 Bacteria 78789
273 Ga0495583_0025376 3300046506 Bacteria 2961
274 Ga0495606_0080751 3300046507 Bacteria 2022
275 Ga0495610_0005031 3300046512 Bacteria 9551
276 Ga0495616_0008727 3300046513 Bacteria 5975
277 Ga0495616_0105397 3300046513 Bacteria 1316
278 Ga0495620_0000027 3300046515 Bacteria 123465
279 Ga0495631_0000036 3300046518 Bacteria 81635
280 Ga0495631_0098419 3300046518 Bacteria 1259
281 Ga0495632_0002568 3300046519 Bacteria 13740
282 Ga0495643_0000934 3300046522 Bacteria 30347
283 Ga0495643_0002287 3300046522 Bacteria 15484
284 Ga0495648_0001781 3300046524 Bacteria 20722
285 Ga0495648_0002102 3300046524 Bacteria 18781
286 Ga0495648_0002519 3300046524 Bacteria 16806
287 Ga0495663_0024751 3300046525 Bacteria 1747
288 Ga0495642_0047136 3300046528 Bacteria 1764
289 Ga0495609_0084856 3300046538 Bacteria 1381
290 Ga0495621_0075179 3300046539 Bacteria 1251
291 Ga0495656_0009648 3300046615 Bacteria 3479
292 Ga0495625_0020179 3300046660 Bacteria 5150
293 Ga0495589_0000042 3300046794 Bacteria 138627
294 Ga0495660_0000139 3300046810 Bacteria 79059
295 Ga0495636_0000311 3300047318 Bacteria 18962
296 Ga0495636_0005470 3300047318 Bacteria 4991
297 Ga0495636_0035291 3300047318 Bacteria 2060
298 Ga0495672_0000002 3300047320 Bacteria 740116
299 Ga0495672_0000043 3300047320 Bacteria 266893
300 Ga0495679_050149 3300047446 Bacteria 1256
301 Ga0495685_043492 3300047447 Bacteria 1533
302 Ga0495673_0000041 3300047469 Bacteria 296723
303 Ga0495673_0107497 3300047469 Bacteria 1119
304 Ga0495686_0000807 3300047472 Bacteria 40575
305 Ga0495686_0018760 3300047472 Bacteria 4634
306 Ga0496100_0053367 3300048903 Bacteria 2632
307 Ga0496101_0005587 3300048904 Bacteria 8028
308 Ga0496102_0007083 3300048905 Bacteria 9570
309 Ga0496102_0078646 3300048905 Bacteria 3036
310 Ga0496103_0364357 3300048906 Bacteria 929
311 Ga0496104_0022530 3300048907 Bacteria 5786
312 Ga0496105_0002029 3300048908 Bacteria 14635
313 Ga0496105_0021563 3300048908 Bacteria 5213
314 Ga0496106_0316269 3300048909 Bacteria 1253
315 Ga0496106_0383371 3300048909 Bacteria 1129
316 Ga0496107_0022473 3300048910 Bacteria 4458
317 Ga0496107_0074158 3300048910 Bacteria 2476
318 Ga0496110_0254721 3300048913 Bacteria 1598
319 Ga0496111_0176095 3300048914 Bacteria 1590
320 Ga0496114_0003678 3300048917 Bacteria 11791
321 Ga0496114_0039420 3300048917 Bacteria 3909
322 Ga0496115_0008924 3300048918 Bacteria 7435
323 Ga0496116_0061610 3300048919 Bacteria 2428
324 Ga0496116_0069773 3300048919 Bacteria 2233
325 Ga0496116_0082325 3300048919 Bacteria 1991
326 Ga0496117_0000004 3300048920 Bacteria 877131
327 Ga0496117_0000165 3300048920 Bacteria 139029
328 Ga0496117_0002939 3300048920 Bacteria 20623
329 Ga0496117_0004294 3300048920 Bacteria 15871
330 Ga0496117_0005549 3300048920 Bacteria 13207
331 Ga0496117_0023131 3300048920 Bacteria 4963
332 Ga0496117_0098648 3300048920 Bacteria 1856
333 Ga0496118_0000939 3300048921 Bacteria 45490
334 Ga0496118_0001339 3300048921 Bacteria 37382
335 Ga0496118_0001517 3300048921 Bacteria 34567
336 Ga0496118_0006268 3300048921 Bacteria 13152
337 Ga0496118_0008355 3300048921 Bacteria 10713
338 Ga0496118_0011966 3300048921 Bacteria 8386
339 Ga0496118_0017135 3300048921 Bacteria 6610
340 Ga0496118_0221583 3300048921 Bacteria 1100
341 Ga0496119_0000064 3300048922 Bacteria 167571
342 Ga0496119_0000926 3300048922 Bacteria 37977
343 Ga0496120_0000054 3300048923 Bacteria 181170
344 Ga0496120_0000067 3300048923 Bacteria 167571
345 Ga0496121_0000393 3300048924 Bacteria 88841
346 Ga0496121_0001180 3300048924 Bacteria 45697
347 Ga0496121_0015034 3300048924 Bacteria 8147
348 Ga0496121_0061970 3300048924 Bacteria 3066
349 Ga0496121_0083619 3300048924 Bacteria 2519
350 Ga0496121_0131945 3300048924 Bacteria 1868
351 Ga0496122_0001559 3300048925 Bacteria 36262
352 Ga0496122_0010095 3300048925 Bacteria 9800
353 Ga0496122_0036286 3300048925 Bacteria 3989
354 Ga0496122_0036540 3300048925 Bacteria 3969
355 Ga0496122_0066724 3300048925 Bacteria 2597
356 Ga0496122_0112009 3300048925 Bacteria 1788
357 Ga0496123_0000547 3300048926 Bacteria 64404
358 Ga0496123_0005323 3300048926 Bacteria 13016
359 Ga0496123_0022136 3300048926 Bacteria 4909
360 Ga0496123_0032724 3300048926 Bacteria 3756
361 Ga0496123_0087580 3300048926 Bacteria 1862
362 Ga0496124_0001190 3300048927 Bacteria 40545
363 Ga0496124_0001664 3300048927 Bacteria 31677
364 Ga0496124_0050058 3300048927 Bacteria 3561
365 Ga0496124_0100006 3300048927 Bacteria 2351
366 Ga0496124_0117399 3300048927 Bacteria 2131
367 Ga0496124_0185165 3300048927 Bacteria 1598
368 Ga0496125_0000590 3300048928 Bacteria 61941
369 Ga0496125_0001097 3300048928 Bacteria 41681
370 Ga0496125_0001151 3300048928 Bacteria 40080
371 Ga0496125_0012507 3300048928 Bacteria 8419
372 Ga0496125_0072259 3300048928 Bacteria 2689
373 Ga0496125_0243374 3300048928 Bacteria 1140
374 Ga0496126_0000411 3300048929 Bacteria 86952
375 Ga0496126_0017506 3300048929 Bacteria 7138
376 Ga0496126_0043546 3300048929 Bacteria 4140
377 Ga0496126_0052696 3300048929 Bacteria 3696
378 Ga0496126_0151644 3300048929 Bacteria 1986
379 Ga0496126_0206753 3300048929 Bacteria 1654
380 Ga0495678_009041 3300049459 Bacteria 4973
381 Ga0501047_0166057 3300049581 Bacteria 2078
382 Ga0501074_0009774 3300049590 Bacteria 6966
383 Ga0501080_0096770 3300049742 Bacteria 2741
384 Ga0501044_0429682 3300049823 Bacteria 1230
385 nmdc:mga00v17_2076_c1 3300050491 Bacteria 10311
386 nmdc:mga07m45_107652_c1 3300050496 Bacteria 1604
387 nmdc:mga07m45_167903_c1 3300050496 Bacteria 1275
388 nmdc:mga0qj67_311931_c1 3300050509 Bacteria 1274
389 Ga0500555_000110 3300053103 Bacteria 38639
390 Ga0500621_000003 3300053126 Bacteria 596975
391 Ga0500633_0007390 3300053160 Bacteria 2764
392 Ga0466962_0002871 3300061719 Bacteria 8216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0145934 Ga0466965_0145934_26_685 187
2 3300048929 Ga0496126_0206753 Ga0496126_0206753_901_1632 198
3 3300034818 Ga0373950_0002781 Ga0373950_0002781_1127_1864 206
4 3300038443 Ga0395901_0224288 Ga0395901_0224288_962_1783 222
5 3300048925 Ga0496122_0036286 Ga0496122_0036286_2428_3282 222
6 3300048926 Ga0496123_0022136 Ga0496123_0022136_886_1740 222
7 3300042533 Ga0450901_003489 Ga0450901_003489_602_1417 223
8 3300003856 Ga0058692_1000032 Ga0058692_1000032121 224
9 3300027312 Ga0209371_1000055 Ga0209371_100005553 224
10 3300030500 Ga0268256_1000054 Ga0268256_1000054181 224
11 3300005289 Ga0065704_10008845 Ga0065704_100088452 225
12 3300005347 Ga0070668_100142034 Ga0070668_1001420342 225
13 3300009148 Ga0105243_10017040 Ga0105243_100170403 225
14 3300025711 Ga0207696_1000338 Ga0207696_100033833 225
15 3300025972 Ga0207668_10055416 Ga0207668_100554163 225
16 3300031911 Ga0307412_10047673 Ga0307412_100476732 225
17 3300032005 Ga0307411_10000103 Ga0307411_100001037 225
18 3300048913 Ga0496110_0254721 Ga0496110_0254721_493_1323 225
19 3300048914 Ga0496111_0176095 Ga0496111_0176095_15_806 225
20 3300048920 Ga0496117_0023131 Ga0496117_0023131_1732_2562 225
21 3300048921 Ga0496118_0011966 Ga0496118_0011966_1967_2797 225
22 3300048928 Ga0496125_0001097 Ga0496125_0001097_18435_19265 225
23 3300048929 Ga0496126_0052696 Ga0496126_0052696_686_1516 225
24 3300003320 rootH2_10023191 rootH2_100231917 226
25 3300003323 rootH1_10047105 rootH1_100471052 226
26 3300005327 Ga0070658_10003129 Ga0070658_100031292 226
27 3300005335 Ga0070666_10000010 Ga0070666_1000001069 226
28 3300005344 Ga0070661_100457289 Ga0070661_1004572891 226
29 3300005548 Ga0070665_100005878 Ga0070665_1000058789 226
30 3300005842 Ga0068858_100074345 Ga0068858_1000743452 226
31 3300005843 Ga0068860_100059148 Ga0068860_1000591482 226
32 3300009551 Ga0105238_10000915 Ga0105238_100009154 226
33 3300013306 Ga0163162_10002334 Ga0163162_100023343 226
34 3300014497 Ga0182008_10001173 Ga0182008_100011732 226
35 3300025206 Ga0209435_105999 Ga0209435_1059992 226
36 3300025299 Ga0209256_1004437 Ga0209256_10044372 226
37 3300025903 Ga0207680_10000002 Ga0207680_10000002321 226
38 3300025909 Ga0207705_10030609 Ga0207705_100306092 226
39 3300025920 Ga0207649_10422350 Ga0207649_104223501 226
40 3300025924 Ga0207694_10001235 Ga0207694_100012356 226
41 3300026035 Ga0207703_10031962 Ga0207703_100319623 226
42 3300028379 Ga0268266_10000004 Ga0268266_10000004319 226
43 3300028381 Ga0268264_10049616 Ga0268264_100496162 226
44 3300048924 Ga0496121_0083619 Ga0496121_0083619_416_1243 226
45 3300009093 Ga0105240_10001947 Ga0105240_100019477 227
46 3300015265 Ga0182005_1003460 Ga0182005_10034604 227
47 3300025913 Ga0207695_10001062 Ga0207695_1000106221 227
48 3300025935 Ga0207709_10002319 Ga0207709_100023193 227
49 3300048921 Ga0496118_0221583 Ga0496118_0221583_175_1008 227
50 3300048929 Ga0496126_0151644 Ga0496126_0151644_834_1667 227
51 iso_pu_bacteria 2643221585 2643932925 227
52 iso_pu_bacteria 2643221639 2644218533 227
53 iso_pu_bacteria 2643221646 2644260428 227
54 iso_pu_bacteria 2643221656 2644314175 227
55 iso_pu_bacteria 2738541337 2739055910 227
56 3300006051 Ga0075364_10065183 Ga0075364_100651832 228
57 3300009148 Ga0105243_10003789 Ga0105243_1000378911 228
58 3300042116 Ga0450912_006224 Ga0450912_006224_82_909 228
59 3300048927 Ga0496124_0001664 Ga0496124_0001664_30276_31133 228
60 3300048927 Ga0496124_0050058 Ga0496124_0050058_617_1462 228
61 3300048928 Ga0496125_0243374 Ga0496125_0243374_37_882 228
62 3300050491 nmdc:mga00v17_2076_c1 nmdc:mga00v17_2076_c1_673_1521 228
63 3300009036 Ga0105244_10116175 Ga0105244_101161752 229
64 3300031727 Ga0316576_10183548 Ga0316576_101835482 229
65 3300047318 Ga0495636_0000311 Ga0495636_0000311_16203_17045 229
66 3300048917 Ga0496114_0039420 Ga0496114_0039420_2490_3362 229
67 3300048925 Ga0496122_0066724 Ga0496122_0066724_671_1501 229
68 3300048929 Ga0496126_0017506 Ga0496126_0017506_5944_6816 229
69 3300003323 rootH1_10004937 rootH1_100049372 230
70 3300003781 Ga0055536_1001895 Ga0055536_10018952 230
71 3300003781 Ga0055536_1001900 Ga0055536_10019002 230
72 3300003784 Ga0055534_1000252 Ga0055534_100025241 230
73 3300003791 Ga0055530_10002026 Ga0055530_1000202614 230
74 3300003794 Ga0055531_10000137 Ga0055531_1000013788 230
75 3300003794 Ga0055531_10002549 Ga0055531_100025492 230
76 3300003794 Ga0055531_10002554 Ga0055531_100025542 230
77 3300003794 Ga0055531_10053989 Ga0055531_100539891 230
78 3300006048 Ga0075363_100054426 Ga0075363_1000544261 230
79 3300009011 Ga0105251_10006174 Ga0105251_100061746 230
80 3300013102 Ga0157371_10130115 Ga0157371_101301152 230
81 3300014497 Ga0182008_10024645 Ga0182008_100246453 230
82 3300015261 Ga0182006_1014021 Ga0182006_10140214 230
83 3300025292 Ga0209676_1000594 Ga0209676_100059429 230
84 3300025292 Ga0209676_1001136 Ga0209676_10011362 230
85 3300025298 Ga0209050_1000328 Ga0209050_100032836 230
86 3300025298 Ga0209050_1001301 Ga0209050_100130132 230
87 3300025303 Ga0209051_1001685 Ga0209051_100168513 230
88 3300025303 Ga0209051_1002676 Ga0209051_10026766 230
89 3300025304 Ga0209257_1000086 Ga0209257_100008634 230
90 3300025304 Ga0209257_1000131 Ga0209257_100013142 230
91 3300025304 Ga0209257_1000655 Ga0209257_100065530 230
92 3300025304 Ga0209257_1000788 Ga0209257_100078811 230
93 3300025304 Ga0209257_1035431 Ga0209257_10354312 230
94 3300028379 Ga0268266_10256144 Ga0268266_102561442 230
95 3300030742 Ga0316183_1001193 Ga0316183_10011936 230
96 3300042006 Ga0439432_041229 Ga0439432_041229_161_1006 230
97 3300042007 Ga0439449_0019837 Ga0439449_0019837_1392_2237 230
98 3300046460 Ga0495638_0103724 Ga0495638_0103724_303_1160 230
99 3300048919 Ga0496116_0082325 Ga0496116_0082325_223_1080 230
100 3300048920 Ga0496117_0098648 Ga0496117_0098648_479_1336 230
101 3300048921 Ga0496118_0008355 Ga0496118_0008355_9456_10313 230
102 3300048925 Ga0496122_0112009 Ga0496122_0112009_557_1414 230
103 3300048926 Ga0496123_0087580 Ga0496123_0087580_475_1332 230
104 3300048927 Ga0496124_0185165 Ga0496124_0185165_159_1016 230
105 3300048928 Ga0496125_0072259 Ga0496125_0072259_1795_2652 230
106 3300003316 rootH1_10029004 rootH1_100290043 231
107 3300003322 rootL2_10029937 rootL2_100299372 231
108 3300003323 rootH1_10040818 rootH1_100408182 231
109 3300005331 Ga0070670_100054908 Ga0070670_1000549082 231
110 3300006353 Ga0075370_10038971 Ga0075370_100389712 231
111 3300006353 Ga0075370_10073367 Ga0075370_100733672 231
112 3300025925 Ga0207650_10106691 Ga0207650_101066912 231
113 3300028794 Ga0307515_10016568 Ga0307515_100165683 231
114 3300028794 Ga0307515_10105783 Ga0307515_101057832 231
115 3300031548 Ga0307408_100000023 Ga0307408_100000023190 231
116 3300037471 Ga0395905_0000151 Ga0395905_0000151_19025_19846 231
117 3300044712 Ga0453684_0244647 Ga0453684_0244647_311_1114 231
118 3300045051 Ga0451576_0096001 Ga0451576_0096001_1041_1844 231
119 3300045051 Ga0451576_0315317 Ga0451576_0315317_340_1143 231
120 3300047318 Ga0495636_0005470 Ga0495636_0005470_2368_3234 231
121 3300047447 Ga0495685_043492 Ga0495685_043492_427_1293 231
122 3300050496 nmdc:mga07m45_107652_c1 nmdc:mga07m45_107652_c1_595_1434 231
123 3300050496 nmdc:mga07m45_167903_c1 nmdc:mga07m45_167903_c1_345_1154 231
124 iso_pu_bacteria 2643221544 2643743050 231
125 3300003756 Ga0055533_1000688 Ga0055533_10006887 232
126 3300025226 Ga0209674_100061 Ga0209674_100061206 232
127 3300034817 Ga0373948_0010295 Ga0373948_0010295_338_1159 232
128 3300035114 Ga0373939_0000049 Ga0373939_0000049_23716_24537 232
129 3300035242 Ga0373962_0060232 Ga0373962_0060232_242_1063 232
130 3300035691 Ga0373931_0002532 Ga0373931_0002532_2477_3298 232
131 3300042126 Ga0450888_000387 Ga0450888_000387_3314_4129 232
132 3300042127 Ga0450890_005579 Ga0450890_005579_157_972 232
133 3300042129 Ga0450891_001137 Ga0450891_001137_853_1668 232
134 3300042130 Ga0450892_000804 Ga0450892_000804_1588_2403 232
135 3300042138 Ga0450903_007759 Ga0450903_007759_57_872 232
136 3300042144 Ga0450889_000235 Ga0450889_000235_1932_2747 232
137 3300042532 Ga0450893_0028042 Ga0450893_0028042_66_881 232
138 3300032004 Ga0307414_10093561 Ga0307414_100935612 233
139 3300005336 Ga0070680_100048943 Ga0070680_1000489432 234
140 3300005339 Ga0070660_100037837 Ga0070660_1000378373 234
141 3300005563 Ga0068855_100040109 Ga0068855_1000401094 234
142 3300025909 Ga0207705_10100242 Ga0207705_101002422 234
143 3300025917 Ga0207660_10035547 Ga0207660_100355472 234
144 3300025919 Ga0207657_10020004 Ga0207657_100200045 234
145 3300025949 Ga0207667_10158562 Ga0207667_101585622 234
146 3300037312 Ga0395899_0003383 Ga0395899_0003383_2467_3291 234
147 3300037418 Ga0395900_0014177 Ga0395900_0014177_3885_4709 234
148 3300038443 Ga0395901_0060028 Ga0395901_0060028_159_983 234
149 3300041408 Ga0439453_0009846 Ga0439453_0009846_24_848 234
150 3300044673 Ga0453683_0012232 Ga0453683_0012232_1464_2288 234
151 3300046539 Ga0495621_0075179 Ga0495621_0075179_136_1059 234
152 3300046615 Ga0495656_0009648 Ga0495656_0009648_2415_3338 234
153 3300048919 Ga0496116_0069773 Ga0496116_0069773_502_1347 234
154 3300048925 Ga0496122_0036540 Ga0496122_0036540_2527_3393 234
155 3300048926 Ga0496123_0032724 Ga0496123_0032724_2611_3477 234
156 3300048929 Ga0496126_0043546 Ga0496126_0043546_2186_3052 234
157 3300049581 Ga0501047_0166057 Ga0501047_0166057_130_954 234
158 3300049823 Ga0501044_0429682 Ga0501044_0429682_199_1023 234
159 3300050509 nmdc:mga0qj67_311931_c1 nmdc:mga0qj67_311931_c1_241_1065 234
160 3300005548 Ga0070665_100559274 Ga0070665_1005592741 235
161 3300028379 Ga0268266_10497266 Ga0268266_104972662 235
162 3300037418 Ga0395900_0217707 Ga0395900_0217707_1055_1891 235
163 3300037471 Ga0395905_0001245 Ga0395905_0001245_17583_18413 235
164 3300037471 Ga0395905_0221292 Ga0395905_0221292_681_1517 235
165 3300042007 Ga0439449_0007077 Ga0439449_0007077_633_1472 235
166 3300042015 Ga0439462_0030736 Ga0439462_0030736_309_1148 235
167 3300042532 Ga0450893_0000871 Ga0450893_0000871_1163_1999 235
168 3300046525 Ga0495663_0024751 Ga0495663_0024751_490_1317 235
169 3300047318 Ga0495636_0035291 Ga0495636_0035291_98_925 235
170 iso_pu_bacteria 2511231024 2511377276 235
171 iso_pu_bacteria 2806310737 2807406588 235
172 iso_pu_bacteria 2806310745 2807454920 235
173 iso_pu_bacteria 2919155634 2919159924 235
174 iso_pu_bacteria 3007419365 3007425111 235
175 iso_pu_bacteria 3007803356 3007806055 235
176 iso_pu_bacteria 8052494512 8052499204 235
177 iso_pu_bacteria 8056115690 8056120560 235
178 iso_pu_bacteria 8056120720 8056121628 235
179 iso_pu_bacteria 8056137416 8056142199 235
180 3300006038 Ga0075365_10040729 Ga0075365_100407293 236
181 3300033180 Ga0307510_10026179 Ga0307510_100261794 236
182 3300037471 Ga0395905_0054278 Ga0395905_0054278_1053_1877 236
183 3300042015 Ga0439462_0037299 Ga0439462_0037299_432_1283 236
184 3300046471 Ga0495650_0001015 Ga0495650_0001015_5754_6584 236
185 3300048927 Ga0496124_0117399 Ga0496124_0117399_150_980 236
186 iso_pu_bacteria 2608642108 2608669202 236
187 iso_pu_bacteria 2687453129 2687578365 236
188 iso_pu_bacteria 2844528606 2844530735 236
189 iso_pu_bacteria 2865014394 2865015024 236
190 iso_pu_bacteria 2881609920 2881612165 236
191 iso_pu_bacteria 2884411467 2884411617 236
192 iso_pu_bacteria 2919085039 2919087284 236
193 iso_pu_bacteria 2928963466 2928965060 236
194 iso_pu_bacteria 2945951305 2945953237 236
195 iso_pu_bacteria 2978975091 2978975758 236
196 3300003856 Ga0058692_1000107 Ga0058692_100010747 237
197 3300006058 Ga0075432_10028424 Ga0075432_100284242 237
198 3300009011 Ga0105251_10004953 Ga0105251_100049532 237
199 3300009011 Ga0105251_10031734 Ga0105251_100317342 237
200 3300009011 Ga0105251_10043458 Ga0105251_100434582 237
201 3300009011 Ga0105251_10060547 Ga0105251_100605472 237
202 3300009036 Ga0105244_10005434 Ga0105244_100054349 237
203 3300009036 Ga0105244_10015889 Ga0105244_100158891 237
204 3300009092 Ga0105250_10008018 Ga0105250_100080183 237
205 3300009092 Ga0105250_10059095 Ga0105250_100590952 237
206 3300009148 Ga0105243_10046109 Ga0105243_100461093 237
207 3300013104 Ga0157370_10027392 Ga0157370_100273924 237
208 3300025711 Ga0207696_1003620 Ga0207696_10036207 237
209 3300025711 Ga0207696_1007734 Ga0207696_10077343 237
210 3300025728 Ga0207655_1001644 Ga0207655_100164418 237
211 3300025728 Ga0207655_1039687 Ga0207655_10396872 237
212 3300025728 Ga0207655_1076865 Ga0207655_10768652 237
213 3300025735 Ga0207713_1001106 Ga0207713_10011065 237
214 3300025735 Ga0207713_1031924 Ga0207713_10319243 237
215 3300025735 Ga0207713_1038696 Ga0207713_10386962 237
216 3300027312 Ga0209371_1000028 Ga0209371_1000028347 237
217 3300030500 Ga0268256_1000030 Ga0268256_100003048 237
218 3300046515 Ga0495620_0000027 Ga0495620_0000027_113841_114671 237
219 3300046519 Ga0495632_0002568 Ga0495632_0002568_11116_11946 237
220 3300046522 Ga0495643_0000934 Ga0495643_0000934_6029_6859 237
221 3300046522 Ga0495643_0002287 Ga0495643_0002287_11972_12802 237
222 3300046524 Ga0495648_0002519 Ga0495648_0002519_9998_10828 237
223 3300047472 Ga0495686_0018760 Ga0495686_0018760_2457_3284 237
224 3300048920 Ga0496117_0002939 Ga0496117_0002939_13227_14057 237
225 3300048920 Ga0496117_0005549 Ga0496117_0005549_553_1383 237
226 3300048921 Ga0496118_0006268 Ga0496118_0006268_2727_3557 237
227 3300048924 Ga0496121_0131945 Ga0496121_0131945_759_1589 237
228 3300048925 Ga0496122_0010095 Ga0496122_0010095_6077_6907 237
229 3300048926 Ga0496123_0005323 Ga0496123_0005323_2733_3563 237
230 3300048927 Ga0496124_0001190 Ga0496124_0001190_498_1328 237
231 3300048928 Ga0496125_0012507 Ga0496125_0012507_2263_3093 237
232 iso_pu_bacteria 2721755523 2722881987 237
233 iso_pu_bacteria 2839138175 2839141880 237
234 3300025292 Ga0209676_1003109 Ga0209676_10031092 238
235 3300030732 Ga0316176_1075752 Ga0316176_10757523 238
236 3300033180 Ga0307510_10002543 Ga0307510_1000254315 238
237 3300042136 Ga0450900_005505 Ga0450900_005505_156_986 238
238 3300042137 Ga0450902_007353 Ga0450902_007353_416_1246 238
239 3300042142 Ga0450905_002224 Ga0450905_002224_1066_1896 238
240 3300042533 Ga0450901_000331 Ga0450901_000331_4421_5251 238
241 3300042876 Ga0451577_0037873 Ga0451577_0037873_2514_3386 238
242 3300046660 Ga0495625_0020179 Ga0495625_0020179_863_1693 238
243 3300048920 Ga0496117_0004294 Ga0496117_0004294_5967_6785 238
244 3300048921 Ga0496118_0001339 Ga0496118_0001339_15355_16173 238
245 3300048927 Ga0496124_0100006 Ga0496124_0100006_797_1627 238
246 3300048929 Ga0496126_0000411 Ga0496126_0000411_59772_60590 238
247 iso_pu_bacteria 2939631187 2939635855 238
248 3300003856 Ga0058692_1011823 Ga0058692_10118232 239
249 3300009093 Ga0105240_10001824 Ga0105240_100018248 239
250 3300010375 Ga0105239_10001603 Ga0105239_1000160319 239
251 3300013307 Ga0157372_10005933 Ga0157372_100059334 239
252 3300025913 Ga0207695_10001022 Ga0207695_100010228 239
253 3300027312 Ga0209371_1000819 Ga0209371_10008198 239
254 3300027312 Ga0209371_1001825 Ga0209371_10018254 239
255 3300030500 Ga0268256_1000678 Ga0268256_10006788 239
256 3300030500 Ga0268256_1001593 Ga0268256_100159311 239
257 3300041405 Ga0439438_001496 Ga0439438_001496_6597_7427 239
258 3300046500 Ga0495596_0040116 Ga0495596_0040116_137_964 239
259 3300046506 Ga0495583_0025376 Ga0495583_0025376_606_1433 239
260 3300046513 Ga0495616_0008727 Ga0495616_0008727_1585_2415 239
261 3300046518 Ga0495631_0098419 Ga0495631_0098419_82_912 239
262 3300046528 Ga0495642_0047136 Ga0495642_0047136_214_1041 239
263 3300046810 Ga0495660_0000139 Ga0495660_0000139_52279_53109 239
264 3300047320 Ga0495672_0000002 Ga0495672_0000002_449394_450224 239
265 3300048904 Ga0496101_0005587 Ga0496101_0005587_1485_2303 239
266 3300048909 Ga0496106_0383371 Ga0496106_0383371_286_1104 239
267 3300048910 Ga0496107_0022473 Ga0496107_0022473_2333_3151 239
268 3300048910 Ga0496107_0074158 Ga0496107_0074158_141_959 239
269 3300048917 Ga0496114_0003678 Ga0496114_0003678_553_1383 239
270 3300048924 Ga0496121_0000393 Ga0496121_0000393_79636_80454 239
271 3300048924 Ga0496121_0015034 Ga0496121_0015034_6660_7478 239
272 3300053126 Ga0500621_000003 Ga0500621_000003_52635_53465 239
273 iso_pu_bacteria 2818991457 2819662716 239
274 iso_pu_bacteria 2852684882 2852687543 239
275 iso_pu_bacteria 2895498888 2895501352 239
276 iso_pu_bacteria 2895511927 2895514495 239
277 iso_pu_bacteria 2895522137 2895524023 239
278 iso_pu_bacteria 2895525241 2895527511 239
279 iso_pu_bacteria 2919130084 2919134275 239
280 iso_pu_bacteria 2929195423 2929198980 239
281 3300002737 JGI25162J39368_1007206 JGI25162J39368_10072062 240
282 3300003856 Ga0058692_1002986 Ga0058692_10029866 240
283 3300005347 Ga0070668_100002531 Ga0070668_1000025314 240
284 3300005457 Ga0070662_100066276 Ga0070662_1000662763 240
285 3300005548 Ga0070665_100000092 Ga0070665_10000009227 240
286 3300009011 Ga0105251_10008983 Ga0105251_100089835 240
287 3300011119 Ga0105246_10120102 Ga0105246_101201023 240
288 3300013104 Ga0157370_10002903 Ga0157370_1000290319 240
289 3300013306 Ga0163162_10054747 Ga0163162_100547473 240
290 3300013307 Ga0157372_10351363 Ga0157372_103513632 240
291 3300014497 Ga0182008_10024704 Ga0182008_100247042 240
292 3300014969 Ga0157376_10013351 Ga0157376_100133512 240
293 3300015265 Ga0182005_1000049 Ga0182005_100004951 240
294 3300017792 Ga0163161_10006009 Ga0163161_100060097 240
295 3300025225 Ga0209566_105366 Ga0209566_1053662 240
296 3300025233 Ga0209437_100109 Ga0209437_100109175 240
297 3300025233 Ga0209437_100111 Ga0209437_100111174 240
298 3300025233 Ga0209437_103687 Ga0209437_1036872 240
299 3300025256 Ga0209759_1005374 Ga0209759_10053744 240
300 3300025711 Ga0207696_1001979 Ga0207696_100197910 240
301 3300025728 Ga0207655_1014535 Ga0207655_10145353 240
302 3300025728 Ga0207655_1020541 Ga0207655_10205413 240
303 3300025735 Ga0207713_1000001 Ga0207713_1000001838 240
304 3300027312 Ga0209371_1000288 Ga0209371_10002886 240
305 3300027312 Ga0209371_1001645 Ga0209371_10016457 240
306 3300027312 Ga0209371_1005323 Ga0209371_10053232 240
307 3300028379 Ga0268266_10000001 Ga0268266_100000013505 240
308 3300030500 Ga0268256_1000135 Ga0268256_100013557 240
309 3300030500 Ga0268256_1002291 Ga0268256_100229110 240
310 3300030500 Ga0268256_1003662 Ga0268256_10036626 240
311 3300036647 Ga0316582_0143590 Ga0316582_0143590_204_1040 240
312 3300037471 Ga0395905_0151294 Ga0395905_0151294_981_1811 240
313 3300041407 Ga0439447_002053 Ga0439447_002053_713_1546 240
314 3300041411 Ga0439466_0000023 Ga0439466_0000023_37149_37982 240
315 3300041512 Ga0451853_2432414 Ga0451853_2432414_889_1722 240
316 3300042010 Ga0439452_023787 Ga0439452_023787_33_866 240
317 3300042146 Ga0450907_000118 Ga0450907_000118_15093_15926 240
318 3300044672 Ga0466982_0001323 Ga0466982_0001323_4321_5139 240
319 3300046452 Ga0495617_002282 Ga0495617_002282_1085_1906 240
320 3300046460 Ga0495638_0000176 Ga0495638_0000176_72084_72905 240
321 3300046471 Ga0495650_0000527 Ga0495650_0000527_28101_28922 240
322 3300046501 Ga0495607_0000133 Ga0495607_0000133_50171_50992 240
323 3300046507 Ga0495606_0080751 Ga0495606_0080751_773_1594 240
324 3300046512 Ga0495610_0005031 Ga0495610_0005031_229_1050 240
325 3300046513 Ga0495616_0105397 Ga0495616_0105397_347_1168 240
326 3300046518 Ga0495631_0000036 Ga0495631_0000036_1489_2310 240
327 3300046524 Ga0495648_0001781 Ga0495648_0001781_5564_6397 240
328 3300046524 Ga0495648_0002102 Ga0495648_0002102_21_842 240
329 3300046538 Ga0495609_0084856 Ga0495609_0084856_110_931 240
330 3300046794 Ga0495589_0000042 Ga0495589_0000042_60681_61502 240
331 3300047320 Ga0495672_0000043 Ga0495672_0000043_197772_198605 240
332 3300047446 Ga0495679_050149 Ga0495679_050149_104_937 240
333 3300047469 Ga0495673_0000041 Ga0495673_0000041_237783_238604 240
334 3300047469 Ga0495673_0107497 Ga0495673_0107497_123_944 240
335 3300047472 Ga0495686_0000807 Ga0495686_0000807_8093_8914 240
336 3300048903 Ga0496100_0053367 Ga0496100_0053367_460_1293 240
337 3300048905 Ga0496102_0007083 Ga0496102_0007083_1176_2009 240
338 3300048905 Ga0496102_0078646 Ga0496102_0078646_449_1279 240
339 3300048906 Ga0496103_0364357 Ga0496103_0364357_81_911 240
340 3300048907 Ga0496104_0022530 Ga0496104_0022530_3243_4061 240
341 3300048908 Ga0496105_0002029 Ga0496105_0002029_9909_10727 240
342 3300048908 Ga0496105_0021563 Ga0496105_0021563_2586_3419 240
343 3300048909 Ga0496106_0316269 Ga0496106_0316269_14_844 240
344 3300048919 Ga0496116_0061610 Ga0496116_0061610_1581_2405 240
345 3300048920 Ga0496117_0000004 Ga0496117_0000004_163340_164170 240
346 3300048920 Ga0496117_0000165 Ga0496117_0000165_14223_15056 240
347 3300048921 Ga0496118_0000939 Ga0496118_0000939_18205_19035 240
348 3300048921 Ga0496118_0001517 Ga0496118_0001517_14259_15077 240
349 3300048921 Ga0496118_0017135 Ga0496118_0017135_4295_5128 240
350 3300048922 Ga0496119_0000064 Ga0496119_0000064_63409_64242 240
351 3300048922 Ga0496119_0000926 Ga0496119_0000926_20515_21333 240
352 3300048923 Ga0496120_0000054 Ga0496120_0000054_16673_17491 240
353 3300048923 Ga0496120_0000067 Ga0496120_0000067_103331_104164 240
354 3300048924 Ga0496121_0001180 Ga0496121_0001180_2578_3411 240
355 3300048925 Ga0496122_0001559 Ga0496122_0001559_25157_25987 240
356 3300048926 Ga0496123_0000547 Ga0496123_0000547_62150_62980 240
357 3300048928 Ga0496125_0001151 Ga0496125_0001151_31484_32317 240
358 3300049459 Ga0495678_009041 Ga0495678_009041_3268_4101 240
359 3300053103 Ga0500555_000110 Ga0500555_000110_7382_8203 240
360 3300053160 Ga0500633_0007390 Ga0500633_0007390_1694_2515 240
361 iso_pu_bacteria 2842757796 2842759678 240
362 3300031731 Ga0307405_10256397 Ga0307405_102563971 241
363 3300042007 Ga0439449_0016839 Ga0439449_0016839_283_1128 241
364 3300044672 Ga0466982_0000007 Ga0466982_0000007_38195_39016 241
365 3300044684 Ga0466966_0001249 Ga0466966_0001249_13672_14493 241
366 3300044719 Ga0466971_0016051 Ga0466971_0016051_261_1082 241
367 3300044735 Ga0466968_0014991 Ga0466968_0014991_1174_1995 241
368 3300044765 Ga0466970_0059644 Ga0466970_0059644_1189_2010 241
369 3300044901 Ga0466960_0008325 Ga0466960_0008325_854_1675 241
370 3300045836 Ga0466958_0162422 Ga0466958_0162422_70_891 241
371 3300048918 Ga0496115_0008924 Ga0496115_0008924_432_1256 241
372 3300049590 Ga0501074_0009774 Ga0501074_0009774_1765_2607 241
373 3300049742 Ga0501080_0096770 Ga0501080_0096770_341_1183 241
374 3300061719 Ga0466962_0002871 Ga0466962_0002871_752_1573 241
375 3300001979 JGI24740J21852_10008251 JGI24740J21852_100082513 242
376 3300001989 JGI24739J22299_10000762 JGI24739J22299_100007622 242
377 3300003320 rootH2_10273930 rootH2_102739302 242
378 3300003578 Ga0006562J51391_1033717 Ga0006562J51391_10337173 242
379 3300003578 Ga0006562J51391_1033718 Ga0006562J51391_10337183 242
380 3300003775 Ga0055524_1044542 Ga0055524_10445421 242
381 3300003781 Ga0055536_1001318 Ga0055536_10013185 242
382 3300003781 Ga0055536_1004685 Ga0055536_10046851 242
383 3300003781 Ga0055536_1018376 Ga0055536_10183762 242
384 3300003794 Ga0055531_10025096 Ga0055531_100250961 242
385 3300005262 Ga0065165_1002123 Ga0065165_10021233 242
386 3300005334 Ga0068869_100117733 Ga0068869_1001177332 242
387 3300005366 Ga0070659_100121253 Ga0070659_1001212532 242
388 3300005455 Ga0070663_100018995 Ga0070663_1000189952 242
389 3300005563 Ga0068855_100025379 Ga0068855_1000253792 242
390 3300005577 Ga0068857_100000765 Ga0068857_1000007653 242
391 3300005578 Ga0068854_100006033 Ga0068854_1000060333 242
392 3300005616 Ga0068852_100042917 Ga0068852_1000429172 242
393 3300005617 Ga0068859_100113354 Ga0068859_1001133542 242
394 3300005842 Ga0068858_100057043 Ga0068858_1000570432 242
395 3300006931 Ga0097620_100113361 Ga0097620_1001133612 242
396 3300009093 Ga0105240_10027799 Ga0105240_100277992 242
397 3300009093 Ga0105240_10036799 Ga0105240_100367992 242
398 3300009177 Ga0105248_10044178 Ga0105248_100441784 242
399 3300009545 Ga0105237_10000145 Ga0105237_1000014556 242
400 3300009551 Ga0105238_10316376 Ga0105238_103163761 242
401 3300010375 Ga0105239_10086992 Ga0105239_100869924 242
402 3300012500 Ga0157314_1000113 Ga0157314_10001132 242
403 3300013308 Ga0157375_10022239 Ga0157375_100222391 242
404 3300015262 Ga0182007_10000173 Ga0182007_1000017345 242
405 3300025258 Ga0209129_1005092 Ga0209129_10050922 242
406 3300025292 Ga0209676_1000436 Ga0209676_100043653 242
407 3300025292 Ga0209676_1000781 Ga0209676_10007812 242
408 3300025292 Ga0209676_1000875 Ga0209676_100087512 242
409 3300025297 Ga0209758_1000647 Ga0209758_100064731 242
410 3300025299 Ga0209256_1005725 Ga0209256_10057252 242
411 3300025304 Ga0209257_1003998 Ga0209257_10039982 242
412 3300025904 Ga0207647_10007615 Ga0207647_100076156 242
413 3300025913 Ga0207695_10005281 Ga0207695_100052813 242
414 3300025913 Ga0207695_10027845 Ga0207695_100278452 242
415 3300025914 Ga0207671_10000028 Ga0207671_10000028141 242
416 3300025933 Ga0207706_10061708 Ga0207706_100617082 242
417 3300025941 Ga0207711_10023485 Ga0207711_100234855 242
418 3300025949 Ga0207667_10000480 Ga0207667_1000048036 242
419 3300025949 Ga0207667_10011589 Ga0207667_100115893 242
420 3300025981 Ga0207640_10000313 Ga0207640_1000031323 242
421 3300025981 Ga0207640_10001974 Ga0207640_100019742 242
422 3300026035 Ga0207703_10067039 Ga0207703_100670392 242
423 3300026067 Ga0207678_10042782 Ga0207678_100427822 242
424 3300026116 Ga0207674_10000091 Ga0207674_1000009156 242
425 3300041413 Ga0439465_0010570 Ga0439465_0010570_1437_2339 242
426 3300042007 Ga0439449_0005300 Ga0439449_0005300_965_1867 242
427 3300048924 Ga0496121_0061970 Ga0496121_0061970_2033_2854 242
428 3300048928 Ga0496125_0000590 Ga0496125_0000590_39648_40469 242
429 iso_pu_bacteria 2643221581 2643915162 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17827

PrmC_N

PrmC N-terminal domain

31

98

0.94

PF05175

MTS

Methyltransferase small domain

124

227

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9446 3 242
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9333 3 242
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.8769 7 242
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.8529 7 242
1nv9-assembly1.cif.gz_A hemk, apo structure 0.8484 7 239
ID Description Score Start End Superfamily
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9635 2 79 1.10.8.10
1t43A01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9362 3 81 1.10.8.10
1t43A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.928 82 242 3.40.50.150
2b3tA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9194 2 81 1.10.8.10
1vq1B01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.912 3 70 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A6S6T7L3-F1-model_v4 Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2 0.9976 149 241 GO:0032259
GO:0036009
AF-T1D5V7-F1-model_v4 HemK family modification methylase 0.9872 130 242 GO:0003676
GO:0032259
GO:0036009
AF-A0A1H1AVJ5-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9822 2 241 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A831KJC4-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9778 72 242 GO:0003676
GO:0032259
GO:0036009
AF-A0A354EAN8-F1-model_v4 deleted 0.9766 143 242

Feature Viewer

pLDDT pTM Quality
92.97 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map