F441682

General Info

Members Datasets Scaffolds Average Seq Length
428 222 423 114

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10352968|Ga0163163_103529682
Length 135
Sequence MARYCFLLQVRPELLDEYRGRHAAVWPEMLAALHATGWRNYSIFARADGLLVGYVEADDLAAAQAAMADTDVNTRWQADMSKYFIGLDGNSPAGDEEPARLLRPDESFLLLDEIFNLDDQLAAAGGPDMTDRSQT

Samples

Sample ID Description Type Environment
1 2643221604 Nocardioides sp. Root190 Isolate Unclassified
2 2643221617 Nocardioides sp. Root79 Isolate Unclassified
3 2643221620 Nocardioides sp. Root240 Isolate Unclassified
4 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
178 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
179 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
187 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
218 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0.47
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0.23
Rhizoplane 3.5
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 3.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1026410 3300001977 Bacteria 802
2 JGI25407J50210_10001077 3300003373 Bacteria 6010
3 JGI25407J50210_10002548 3300003373 Bacteria 4307
4 JGI25407J50210_10007571 3300003373 Bacteria 2723
5 Ga0070658_10093545 3300005327 Bacteria 2480
6 Ga0070676_10243497 3300005328 Bacteria 1197
7 Ga0070676_10880432 3300005328 Bacteria 666
8 Ga0070683_100110141 3300005329 Bacteria 2597
9 Ga0070690_101132181 3300005330 Bacteria 622
10 Ga0070670_100217783 3300005331 Bacteria 1661
11 Ga0070677_10185839 3300005333 Bacteria 993
12 Ga0068869_100080305 3300005334 Bacteria 2433
13 Ga0068869_101085871 3300005334 Bacteria 700
14 Ga0070666_11210192 3300005335 Bacteria 563
15 Ga0070680_101465183 3300005336 Bacteria 591
16 Ga0070680_101490804 3300005336 Bacteria 586
17 Ga0070682_100030344 3300005337 Bacteria 3262
18 Ga0070682_100566088 3300005337 Bacteria 892
19 Ga0068868_100090600 3300005338 Bacteria 2463
20 Ga0068868_100125122 3300005338 Bacteria 2099
21 Ga0070660_100338201 3300005339 Bacteria 1238
22 Ga0070660_100483387 3300005339 Bacteria 1029
23 Ga0070689_100319781 3300005340 Bacteria 1296
24 Ga0070661_100139274 3300005344 Bacteria 1828
25 Ga0070661_101136369 3300005344 Bacteria 652
26 Ga0070668_100013751 3300005347 Bacteria 6045
27 Ga0070668_100346225 3300005347 Bacteria 1257
28 Ga0070668_100801374 3300005347 Bacteria 837
29 Ga0070668_101251183 3300005347 Bacteria 674
30 Ga0070675_100524009 3300005354 Bacteria 1069
31 Ga0070674_100186137 3300005356 Bacteria 1594
32 Ga0070674_101277390 3300005356 Bacteria 654
33 Ga0070673_100941950 3300005364 Bacteria 802
34 Ga0070688_100104188 3300005365 Bacteria 1875
35 Ga0070659_100151414 3300005366 Bacteria 1892
36 Ga0070659_100810448 3300005366 Bacteria 815
37 Ga0070667_100346286 3300005367 Bacteria 1345
38 Ga0070713_100349850 3300005436 Bacteria 1371
39 Ga0070713_101336652 3300005436 Bacteria 695
40 Ga0070710_10456395 3300005437 Bacteria 867
41 Ga0070701_11097636 3300005438 Bacteria 560
42 Ga0070711_100627537 3300005439 Bacteria 899
43 Ga0070700_100273574 3300005441 Bacteria 1221
44 Ga0070663_100105953 3300005455 Bacteria 2105
45 Ga0070663_101151870 3300005455 Bacteria 680
46 Ga0070663_101287948 3300005455 Bacteria 644
47 Ga0070678_100019517 3300005456 Bacteria 4423
48 Ga0070678_100144055 3300005456 Bacteria 1910
49 Ga0070678_102009220 3300005456 Bacteria 547
50 Ga0070662_101292583 3300005457 Bacteria 628
51 Ga0070685_10111793 3300005466 Bacteria 1684
52 Ga0070685_10737342 3300005466 Bacteria 721
53 Ga0070707_101178686 3300005468 Bacteria 732
54 Ga0070679_101367734 3300005530 Bacteria 654
55 Ga0070679_101484097 3300005530 Bacteria 625
56 Ga0070684_100193027 3300005535 Bacteria 1853
57 Ga0070684_102045539 3300005535 Bacteria 541
58 Ga0068853_100198578 3300005539 Bacteria 1825
59 Ga0068853_100671931 3300005539 Bacteria 987
60 Ga0070686_100164428 3300005544 Bacteria 1565
61 Ga0070686_100452733 3300005544 Bacteria 987
62 Ga0070686_100863051 3300005544 Bacteria 734
63 Ga0070693_100697201 3300005547 Bacteria 743
64 Ga0070665_100043879 3300005548 Bacteria 4491
65 Ga0070665_100122869 3300005548 Bacteria 2598
66 Ga0070665_100149845 3300005548 Bacteria 2335
67 Ga0070665_100874433 3300005548 Bacteria 912
68 Ga0068855_100026009 3300005563 Bacteria 7000
69 Ga0070664_100085096 3300005564 Bacteria 2731
70 Ga0070664_100228899 3300005564 Bacteria 1666
71 Ga0070664_100889744 3300005564 Bacteria 835
72 Ga0068857_100481044 3300005577 Bacteria 1163
73 Ga0068854_100423003 3300005578 Bacteria 1107
74 Ga0068856_100479034 3300005614 Bacteria 1265
75 Ga0070702_100181669 3300005615 Bacteria 1377
76 Ga0070702_100240366 3300005615 Bacteria 1222
77 Ga0070702_101682299 3300005615 Bacteria 527
78 Ga0068852_100214877 3300005616 Bacteria 1826
79 Ga0068852_100418874 3300005616 Bacteria 1321
80 Ga0068852_101222016 3300005616 Bacteria 773
81 Ga0068852_101772620 3300005616 Bacteria 640
82 Ga0068859_100721751 3300005617 Bacteria 1087
83 Ga0068864_100178793 3300005618 Bacteria 1939
84 Ga0068864_100587135 3300005618 Bacteria 1080
85 Ga0068864_101335664 3300005618 Bacteria 718
86 Ga0068861_100273437 3300005719 Bacteria 1452
87 Ga0068861_101392489 3300005719 Bacteria 685
88 Ga0068861_102063037 3300005719 Bacteria 570
89 Ga0068851_10136399 3300005834 Bacteria 1331
90 Ga0068870_10105057 3300005840 Bacteria 1603
91 Ga0068870_10477535 3300005840 Bacteria 827
92 Ga0068863_100218756 3300005841 Bacteria 1835
93 Ga0068858_100155633 3300005842 Bacteria 2150
94 Ga0068860_100073923 3300005843 Bacteria 3240
95 Ga0068862_100071495 3300005844 Bacteria 2996
96 Ga0081455_10020716 3300005937 Bacteria 6184
97 Ga0081538_10001607 3300005981 Bacteria 23188
98 Ga0081538_10002527 3300005981 Bacteria 17828
99 Ga0081538_10003584 3300005981 Bacteria 14601
100 Ga0081538_10048796 3300005981 Bacteria 2576
101 Ga0081538_10145200 3300005981 Bacteria 1086
102 Ga0070717_10139839 3300006028 Bacteria 2087
103 Ga0070717_11936833 3300006028 Bacteria 532
104 Ga0070715_10738085 3300006163 Bacteria 592
105 Ga0070712_101361461 3300006175 Bacteria 619
106 Ga0070712_101470255 3300006175 Bacteria 595
107 Ga0097621_100832389 3300006237 Bacteria 857
108 Ga0068865_100608234 3300006881 Bacteria 924
109 Ga0068865_101549779 3300006881 Bacteria 595
110 Ga0097620_100721743 3300006931 Bacteria 1087
111 Ga0105240_10034320 3300009093 Bacteria 6545
112 Ga0105240_10497427 3300009093 Bacteria 1356
113 Ga0111539_10249689 3300009094 Bacteria 2066
114 Ga0111539_11920563 3300009094 Bacteria 686
115 Ga0105245_10428510 3300009098 Bacteria 1327
116 Ga0105245_10534641 3300009098 Bacteria 1192
117 Ga0105247_10488745 3300009101 Bacteria 895
118 Ga0105243_10060824 3300009148 Bacteria 3018
119 Ga0105243_10379130 3300009148 Bacteria 1307
120 Ga0105243_10883770 3300009148 Bacteria 888
121 Ga0105241_10408469 3300009174 Bacteria 1193
122 Ga0105241_12301542 3300009174 Bacteria 536
123 Ga0105248_12432201 3300009177 Bacteria 597
124 Ga0105237_10075952 3300009545 Bacteria 3350
125 Ga0105237_10129505 3300009545 Bacteria 2518
126 Ga0105237_10287543 3300009545 Bacteria 1647
127 Ga0105238_10331706 3300009551 Bacteria 1508
128 Ga0105238_10408595 3300009551 Bacteria 1351
129 Ga0105238_10564798 3300009551 Bacteria 1143
130 Ga0105249_10311904 3300009553 Bacteria 1582
131 Ga0105249_11867144 3300009553 Bacteria 673
132 Ga0105028_116354 3300009993 Bacteria 793
133 Ga0105239_10800302 3300010375 Bacteria 1080
134 Ga0105239_11244157 3300010375 Bacteria 858
135 Ga0105246_10175022 3300011119 Bacteria 1647
136 Ga0157370_11277398 3300013104 Bacteria 662
137 Ga0157374_11181653 3300013296 Bacteria 786
138 Ga0157378_10230812 3300013297 Bacteria 1763
139 Ga0163162_10204125 3300013306 Bacteria 2106
140 Ga0163162_10544584 3300013306 Bacteria 1289
141 Ga0157372_10323997 3300013307 Bacteria 1794
142 Ga0157372_12253618 3300013307 Bacteria 626
143 Ga0157375_10373033 3300013308 Bacteria 1593
144 Ga0157375_10444166 3300013308 Bacteria 1463
145 Ga0157375_12246940 3300013308 Bacteria 650
146 Ga0163163_10352968 3300014325 Bacteria 1527
147 Ga0163163_10385869 3300014325 Bacteria 1458
148 Ga0163163_10474168 3300014325 Bacteria 1312
149 Ga0163163_10556675 3300014325 Bacteria 1209
150 Ga0163163_11989587 3300014325 Bacteria 641
151 Ga0163163_13129297 3300014325 Bacteria 516
152 Ga0157380_10725893 3300014326 Bacteria 1002
153 Ga0157377_10352640 3300014745 Bacteria 988
154 Ga0157379_10241117 3300014968 Bacteria 1640
155 Ga0157379_12076521 3300014968 Bacteria 563
156 Ga0157379_12491522 3300014968 Bacteria 517
157 Ga0157376_11500281 3300014969 Bacteria 707
158 Ga0163161_10140899 3300017792 Bacteria 1826
159 Ga0163161_10155436 3300017792 Bacteria 1741
160 Ga0206356_10328137 3300020070 Bacteria 954
161 Ga0206353_10282231 3300020082 Bacteria 712
162 Ga0213875_10077661 3300021388 Bacteria 1549
163 Ga0207682_10161877 3300025893 Bacteria 1014
164 Ga0207692_10313138 3300025898 Bacteria 958
165 Ga0207688_10002292 3300025901 Bacteria 10294
166 Ga0207688_10040744 3300025901 Bacteria 2581
167 Ga0207688_10072479 3300025901 Bacteria 1956
168 Ga0207688_10133327 3300025901 Bacteria 1457
169 Ga0207688_10256542 3300025901 Bacteria 1060
170 Ga0207680_10653416 3300025903 Bacteria 753
171 Ga0207645_10039746 3300025907 Bacteria 3014
172 Ga0207645_10360294 3300025907 Bacteria 974
173 Ga0207643_10051649 3300025908 Bacteria 2334
174 Ga0207705_10123223 3300025909 Bacteria 1925
175 Ga0207705_11085839 3300025909 Bacteria 617
176 Ga0207654_10535087 3300025911 Bacteria 831
177 Ga0207695_10437348 3300025913 Bacteria 1192
178 Ga0207671_10024819 3300025914 Bacteria 4504
179 Ga0207671_10629452 3300025914 Bacteria 855
180 Ga0207671_11270454 3300025914 Bacteria 574
181 Ga0207693_11346262 3300025915 Bacteria 532
182 Ga0207662_10149327 3300025918 Bacteria 1485
183 Ga0207662_10561457 3300025918 Bacteria 791
184 Ga0207657_10019820 3300025919 Bacteria 6376
185 Ga0207649_10361999 3300025920 Bacteria 1077
186 Ga0207694_10357526 3300025924 Bacteria 1210
187 Ga0207694_10378139 3300025924 Bacteria 1175
188 Ga0207650_11039675 3300025925 Bacteria 697
189 Ga0207659_10445457 3300025926 Bacteria 1090
190 Ga0207687_10069344 3300025927 Bacteria 2514
191 Ga0207687_10904155 3300025927 Bacteria 755
192 Ga0207687_11036706 3300025927 Bacteria 704
193 Ga0207700_11625085 3300025928 Bacteria 571
194 Ga0207664_10167972 3300025929 Bacteria 1876
195 Ga0207644_10227232 3300025931 Bacteria 1482
196 Ga0207690_10342916 3300025932 Bacteria 1179
197 Ga0207690_10455082 3300025932 Bacteria 1029
198 Ga0207706_10240902 3300025933 Bacteria 1581
199 Ga0207706_11051634 3300025933 Bacteria 682
200 Ga0207709_10481023 3300025935 Bacteria 965
201 Ga0207709_10766606 3300025935 Bacteria 777
202 Ga0207669_10183437 3300025937 Bacteria 1503
203 Ga0207704_10024298 3300025938 Bacteria 3283
204 Ga0207704_10524764 3300025938 Bacteria 958
205 Ga0207704_10967374 3300025938 Bacteria 719
206 Ga0207704_11931949 3300025938 Bacteria 508
207 Ga0207665_10385704 3300025939 Bacteria 1064
208 Ga0207691_10069864 3300025940 Bacteria 3172
209 Ga0207691_10121823 3300025940 Bacteria 2311
210 Ga0207689_10025944 3300025942 Bacteria 4906
211 Ga0207689_10083013 3300025942 Bacteria 2635
212 Ga0207661_10103264 3300025944 Bacteria 2399
213 Ga0207661_11214283 3300025944 Bacteria 694
214 Ga0207679_10621522 3300025945 Bacteria 975
215 Ga0207679_10790066 3300025945 Bacteria 865
216 Ga0207679_11891121 3300025945 Bacteria 544
217 Ga0207667_10367661 3300025949 Bacteria 1466
218 Ga0207712_10535452 3300025961 Bacteria 1006
219 Ga0207712_10640259 3300025961 Bacteria 923
220 Ga0207668_10103674 3300025972 Bacteria 2118
221 Ga0207668_10337483 3300025972 Bacteria 1256
222 Ga0207668_11562461 3300025972 Bacteria 595
223 Ga0207640_10020978 3300025981 Bacteria 3885
224 Ga0207658_10187127 3300025986 Bacteria 1718
225 Ga0207677_10159749 3300026023 Bacteria 1750
226 Ga0207677_10347133 3300026023 Bacteria 1242
227 Ga0207703_10183637 3300026035 Bacteria 1847
228 Ga0207703_10650956 3300026035 Bacteria 1000
229 Ga0207639_10212123 3300026041 Bacteria 1667
230 Ga0207678_10004026 3300026067 Bacteria 13222
231 Ga0207678_10136752 3300026067 Bacteria 2091
232 Ga0207708_10014860 3300026075 Bacteria 5828
233 Ga0207708_10269512 3300026075 Bacteria 1377
234 Ga0207702_10117037 3300026078 Bacteria 2379
235 Ga0207702_10706658 3300026078 Bacteria 994
236 Ga0207702_11100509 3300026078 Bacteria 789
237 Ga0207648_11146255 3300026089 Bacteria 730
238 Ga0207676_10080208 3300026095 Bacteria 2649
239 Ga0207676_11098446 3300026095 Bacteria 786
240 Ga0207676_11202543 3300026095 Bacteria 751
241 Ga0207676_12130611 3300026095 Bacteria 559
242 Ga0207674_10104132 3300026116 Bacteria 2817
243 Ga0207675_100053901 3300026118 Bacteria 3752
244 Ga0207675_100180934 3300026118 Bacteria 2019
245 Ga0207675_100281421 3300026118 Bacteria 1616
246 Ga0207675_101335554 3300026118 Bacteria 737
247 Ga0207683_10095602 3300026121 Bacteria 2649
248 Ga0207683_10107800 3300026121 Bacteria 2492
249 Ga0207683_10313794 3300026121 Bacteria 1436
250 Ga0207698_10546762 3300026142 Bacteria 1134
251 Ga0207698_11839779 3300026142 Bacteria 620
252 Ga0207698_12108733 3300026142 Bacteria 577
253 Ga0268266_10041994 3300028379 Bacteria 3904
254 Ga0268266_10218970 3300028379 Bacteria 1749
255 Ga0268266_10588901 3300028379 Bacteria 1068
256 Ga0268266_10718348 3300028379 Bacteria 963
257 Ga0268265_10056229 3300028380 Bacteria 2993
258 Ga0268265_11072636 3300028380 Bacteria 799
259 Ga0268264_10324911 3300028381 Bacteria 1456
260 Ga0268264_10411937 3300028381 Bacteria 1301
261 Ga0307515_10069919 3300028794 Bacteria 4788
262 Ga0265328_10461187 3300031239 Bacteria 503
263 Ga0307513_10010109 3300031456 Bacteria 11880
264 Ga0307509_10018067 3300031507 Bacteria 8097
265 Ga0307408_100015655 3300031548 Bacteria 5054
266 Ga0307408_101108401 3300031548 Bacteria 734
267 Ga0307408_101553493 3300031548 Bacteria 627
268 Ga0265313_10368784 3300031595 Bacteria 567
269 Ga0307508_10053451 3300031616 Bacteria 3585
270 Ga0307516_10489086 3300031730 Bacteria 885
271 Ga0307405_10003987 3300031731 Bacteria 6915
272 Ga0307405_10008160 3300031731 Bacteria 5293
273 Ga0307405_10215820 3300031731 Bacteria 1404
274 Ga0307413_10028138 3300031824 Bacteria 3125
275 Ga0307413_10166750 3300031824 Bacteria 1554
276 Ga0307413_10166918 3300031824 Bacteria 1553
277 Ga0307413_10574744 3300031824 Bacteria 918
278 Ga0307413_10851648 3300031824 Bacteria 770
279 Ga0307413_10951064 3300031824 Bacteria 733
280 Ga0307410_10009334 3300031852 Bacteria 5497
281 Ga0307410_10012744 3300031852 Bacteria 4876
282 Ga0307410_10324114 3300031852 Bacteria 1223
283 Ga0307410_10515691 3300031852 Bacteria 986
284 Ga0307410_10670786 3300031852 Bacteria 871
285 Ga0307410_10822522 3300031852 Bacteria 791
286 Ga0307410_11351455 3300031852 Bacteria 624
287 Ga0307410_11959460 3300031852 Bacteria 522
288 Ga0326468_10003362 3300031889 Bacteria 1355
289 Ga0307406_10008089 3300031901 Bacteria 5857
290 Ga0307406_10108433 3300031901 Bacteria 1906
291 Ga0307406_10153055 3300031901 Bacteria 1648
292 Ga0307406_10485281 3300031901 Bacteria 999
293 Ga0307406_10827372 3300031901 Bacteria 783
294 Ga0307406_11438785 3300031901 Bacteria 605
295 Ga0307407_10000233 3300031903 Bacteria 16468
296 Ga0307407_10009348 3300031903 Bacteria 4559
297 Ga0307407_10023236 3300031903 Bacteria 3232
298 Ga0307407_10068171 3300031903 Bacteria 2106
299 Ga0307407_10656201 3300031903 Bacteria 786
300 Ga0307407_11302411 3300031903 Bacteria 570
301 Ga0307412_10017719 3300031911 Bacteria 4267
302 Ga0307412_10056283 3300031911 Bacteria 2620
303 Ga0307412_11746034 3300031911 Bacteria 571
304 Ga0307409_100004358 3300031995 Bacteria 7939
305 Ga0307409_100008577 3300031995 Bacteria 6215
306 Ga0307409_100049319 3300031995 Bacteria 3210
307 Ga0307409_100060031 3300031995 Bacteria 2963
308 Ga0307409_100111222 3300031995 Bacteria 2297
309 Ga0307409_100211790 3300031995 Bacteria 1742
310 Ga0307409_100389354 3300031995 Bacteria 1328
311 Ga0307409_100786538 3300031995 Bacteria 958
312 Ga0307409_100851502 3300031995 Bacteria 922
313 Ga0307409_101954625 3300031995 Bacteria 616
314 Ga0307409_102611516 3300031995 Bacteria 533
315 Ga0307416_100000373 3300032002 Bacteria 23221
316 Ga0307416_100002378 3300032002 Bacteria 10767
317 Ga0307416_100008898 3300032002 Bacteria 6522
318 Ga0307416_100035531 3300032002 Bacteria 3807
319 Ga0307416_100356842 3300032002 Bacteria 1482
320 Ga0307416_101086636 3300032002 Bacteria 904
321 Ga0307416_102035383 3300032002 Bacteria 677
322 Ga0307416_102492836 3300032002 Bacteria 616
323 Ga0307416_102618482 3300032002 Bacteria 602
324 Ga0307416_102797438 3300032002 Bacteria 583
325 Ga0307414_10130849 3300032004 Bacteria 1948
326 Ga0307414_10533486 3300032004 Bacteria 1043
327 Ga0307414_10900143 3300032004 Bacteria 811
328 Ga0307414_11161688 3300032004 Bacteria 714
329 Ga0307414_11817985 3300032004 Bacteria 568
330 Ga0307411_10015038 3300032005 Bacteria 4329
331 Ga0307411_10342789 3300032005 Bacteria 1215
332 Ga0307411_10517171 3300032005 Bacteria 1012
333 Ga0307415_100008624 3300032126 Bacteria 5663
334 Ga0307415_100040898 3300032126 Bacteria 3075
335 Ga0307415_100059533 3300032126 Bacteria 2634
336 Ga0307415_100164964 3300032126 Bacteria 1721
337 Ga0307415_100187369 3300032126 Bacteria 1629
338 Ga0307415_100279766 3300032126 Bacteria 1371
339 Ga0307415_100329962 3300032126 Bacteria 1276
340 Ga0307415_100754478 3300032126 Bacteria 884
341 Ga0307415_100998575 3300032126 Bacteria 778
342 Ga0307415_101069310 3300032126 Bacteria 754
343 Ga0307415_101345934 3300032126 Bacteria 678
344 Ga0307415_101479122 3300032126 Bacteria 649
345 Ga0307415_102072135 3300032126 Bacteria 555
346 Ga0307507_10024540 3300033179 Bacteria 6567
347 Ga0373962_0266735 3300035242 Bacteria 599
348 Ga0373927_0302163 3300035695 Bacteria 1053
349 Ga0373933_0755788 3300035724 Bacteria 640
350 Ga0395900_0332359 3300037418 Bacteria 1497
351 Ga0395898_0164601 3300037466 Unclassified 2121
352 Ga0395898_0271033 3300037466 Bacteria 1619
353 Ga0395898_1737490 3300037466 Bacteria 546
354 Ga0395905_0351892 3300037471 Bacteria 1365
355 Ga0436364_1402407 3300037853 Bacteria 4470
356 Ga0395901_0300314 3300038443 Bacteria 1665
357 Ga0395901_0312774 3300038443 Bacteria 1626
358 Ga0436365_0718771 3300039437 Bacteria 5286
359 Ga0436365_0946759 3300039437 Bacteria 972
360 Ga0451791_1474066 3300041451 Bacteria 591
361 Ga0451793_0449545 3300041452 Bacteria 1051
362 Ga0451795_1264373 3300041456 Bacteria 997
363 Ga0451800_0524290 3300041459 Bacteria 576
364 Ga0451800_0552614 3300041459 Bacteria 578
365 Ga0451807_0115306 3300041486 Bacteria 544
366 Ga0451843_0801185 3300041509 Bacteria 682
367 Ga0451853_2406808 3300041512 Bacteria 871
368 Ga0439448_0000973 3300042005 Bacteria 7102
369 Ga0439448_0031786 3300042005 Bacteria 1678
370 Ga0439455_0100894 3300042012 Bacteria 798
371 Ga0439455_0118992 3300042012 Bacteria 739
372 Ga0439463_010962 3300042016 Bacteria 2227
373 Ga0439463_023088 3300042016 Bacteria 1558
374 Ga0439463_185021 3300042016 Bacteria 541
375 Ga0439458_0039001 3300042157 Bacteria 1148
376 Ga0439458_0054862 3300042157 Bacteria 988
377 Ga0439464_0060025 3300042439 Bacteria 1112
378 Ga0439460_0141532 3300042461 Bacteria 798
379 Ga0439460_0265731 3300042461 Bacteria 595
380 Ga0439440_0003656 3300042993 Bacteria 2983
381 Ga0439440_0037851 3300042993 Bacteria 1166
382 Ga0466965_0233123 3300044683 Bacteria 984
383 Ga0466965_0583490 3300044683 Bacteria 634
384 Ga0466965_0621165 3300044683 Bacteria 615
385 Ga0466966_0394073 3300044684 Bacteria 832
386 Ga0466961_0269904 3300044693 Bacteria 1042
387 Ga0466963_1282277 3300044694 Bacteria 514
388 Ga0466971_0031182 3300044719 Bacteria 2387
389 Ga0466970_0002401 3300044765 Bacteria 9051
390 Ga0466957_0056838 3300044842 Bacteria 2393
391 Ga0466960_0025874 3300044901 Bacteria 2660
392 Ga0466959_0094176 3300045049 Bacteria 2149
393 Ga0466959_0660905 3300045049 Bacteria 701
394 Ga0466958_0614572 3300045836 Bacteria 707
395 Ga0466958_0858409 3300045836 Bacteria 592
396 Ga0466967_0023618 3300045976 Bacteria 5043
397 Ga0466967_0093072 3300045976 Bacteria 2742
398 Ga0466967_0145486 3300045976 Bacteria 2211
399 Ga0466967_0303357 3300045976 Bacteria 1537
400 Ga0495629_0549075 3300046459 Bacteria 776
401 Ga0495584_0169441 3300046491 Bacteria 1110
402 Ga0495594_0261362 3300046499 Bacteria 986
403 Ga0495630_1098443 3300046517 Bacteria 603
404 Ga0496102_1025535 3300048905 Bacteria 745
405 Ga0496104_1330109 3300048907 Bacteria 622
406 Ga0496106_0738305 3300048909 Bacteria 783
407 Ga0496108_0087314 3300048911 Bacteria 2649
408 Ga0496108_0119259 3300048911 Bacteria 2262
409 Ga0496109_0145527 3300048912 Bacteria 2217
410 Ga0496109_1031865 3300048912 Bacteria 760
411 Ga0496112_0837517 3300048915 Bacteria 844
412 Ga0496114_0193271 3300048917 Bacteria 1781
413 Ga0496121_0014835 3300048924 Bacteria 8223
414 nmdc:mga08y16_1328069_c1 3300050511 Bacteria 685
415 nmdc:mga08y16_145358_c1 3300050511 Bacteria 2465
416 nmdc:mga08y16_548232_c1 3300050511 Bacteria 1170
417 Ga0500578_0649006 3300053086 Bacteria 574
418 Ga0500559_0008673 3300053136 Bacteria 4443
419 Ga0500620_064815 3300053155 Bacteria 1249
420 Ga0590071_014285 3300059421 Bacteria 1862
421 Ga0590075_054646 3300059424 Bacteria 1026
422 Ga0590077_062897 3300059426 Bacteria 843
423 Ga0466962_0186794 3300061719 Bacteria 1011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100874433 Ga0070665_1008744332 102
2 3300014325 Ga0163163_10385869 Ga0163163_103858692 102
3 3300028379 Ga0268266_10588901 Ga0268266_105889012 102
4 3300031824 Ga0307413_10951064 Ga0307413_109510642 102
5 3300031901 Ga0307406_11438785 Ga0307406_114387851 102
6 3300031995 Ga0307409_100111222 Ga0307409_1001112222 102
7 3300032126 Ga0307415_100164964 Ga0307415_1001649642 102
8 3300041456 Ga0451795_1264373 Ga0451795_1264373_447_779 102
9 3300041459 Ga0451800_0552614 Ga0451800_0552614_134_466 102
10 3300005334 Ga0068869_101085871 Ga0068869_1010858712 103
11 3300005335 Ga0070666_11210192 Ga0070666_112101921 103
12 3300005336 Ga0070680_101490804 Ga0070680_1014908042 103
13 3300005338 Ga0068868_100090600 Ga0068868_1000906002 103
14 3300005344 Ga0070661_101136369 Ga0070661_1011363691 103
15 3300005347 Ga0070668_100801374 Ga0070668_1008013742 103
16 3300005347 Ga0070668_101251183 Ga0070668_1012511832 103
17 3300005366 Ga0070659_100810448 Ga0070659_1008104482 103
18 3300005367 Ga0070667_100346286 Ga0070667_1003462862 103
19 3300005466 Ga0070685_10111793 Ga0070685_101117932 103
20 3300005535 Ga0070684_102045539 Ga0070684_1020455391 103
21 3300005539 Ga0068853_100671931 Ga0068853_1006719312 103
22 3300005548 Ga0070665_100149845 Ga0070665_1001498452 103
23 3300005564 Ga0070664_100889744 Ga0070664_1008897442 103
24 3300005615 Ga0070702_101682299 Ga0070702_1016822991 103
25 3300005616 Ga0068852_101222016 Ga0068852_1012220162 103
26 3300005617 Ga0068859_100721751 Ga0068859_1007217512 103
27 3300005618 Ga0068864_101335664 Ga0068864_1013356642 103
28 3300005840 Ga0068870_10105057 Ga0068870_101050572 103
29 3300005841 Ga0068863_100218756 Ga0068863_1002187563 103
30 3300005842 Ga0068858_100155633 Ga0068858_1001556333 103
31 3300005843 Ga0068860_100073923 Ga0068860_1000739233 103
32 3300006175 Ga0070712_101361461 Ga0070712_1013614612 103
33 3300006237 Ga0097621_100832389 Ga0097621_1008323892 103
34 3300006931 Ga0097620_100721743 Ga0097620_1007217432 103
35 3300009148 Ga0105243_10883770 Ga0105243_108837701 103
36 3300009177 Ga0105248_12432201 Ga0105248_124322012 103
37 3300009551 Ga0105238_10408595 Ga0105238_104085952 103
38 3300009553 Ga0105249_10311904 Ga0105249_103119042 103
39 3300010375 Ga0105239_11244157 Ga0105239_112441572 103
40 3300011119 Ga0105246_10175022 Ga0105246_101750222 103
41 3300013104 Ga0157370_11277398 Ga0157370_112773982 103
42 3300013296 Ga0157374_11181653 Ga0157374_111816532 103
43 3300013297 Ga0157378_10230812 Ga0157378_102308122 103
44 3300013306 Ga0163162_10204125 Ga0163162_102041252 103
45 3300014325 Ga0163163_10556675 Ga0163163_105566752 103
46 3300014968 Ga0157379_10241117 Ga0157379_102411172 103
47 3300014969 Ga0157376_11500281 Ga0157376_115002812 103
48 3300025901 Ga0207688_10256542 Ga0207688_102565422 103
49 3300025914 Ga0207671_11270454 Ga0207671_112704542 103
50 3300025918 Ga0207662_10561457 Ga0207662_105614572 103
51 3300025920 Ga0207649_10361999 Ga0207649_103619992 103
52 3300025924 Ga0207694_10357526 Ga0207694_103575262 103
53 3300025925 Ga0207650_11039675 Ga0207650_110396752 103
54 3300025931 Ga0207644_10227232 Ga0207644_102272322 103
55 3300025932 Ga0207690_10455082 Ga0207690_104550822 103
56 3300025935 Ga0207709_10481023 Ga0207709_104810232 103
57 3300025938 Ga0207704_10967374 Ga0207704_109673742 103
58 3300025940 Ga0207691_10121823 Ga0207691_101218233 103
59 3300025942 Ga0207689_10025944 Ga0207689_100259445 103
60 3300025944 Ga0207661_10103264 Ga0207661_101032643 103
61 3300025945 Ga0207679_10621522 Ga0207679_106215222 103
62 3300025972 Ga0207668_11562461 Ga0207668_115624612 103
63 3300025986 Ga0207658_10187127 Ga0207658_101871272 103
64 3300026035 Ga0207703_10183637 Ga0207703_101836372 103
65 3300026041 Ga0207639_10212123 Ga0207639_102121232 103
66 3300026078 Ga0207702_11100509 Ga0207702_111005092 103
67 3300026095 Ga0207676_10080208 Ga0207676_100802083 103
68 3300026095 Ga0207676_11202543 Ga0207676_112025432 103
69 3300026118 Ga0207675_100180934 Ga0207675_1001809342 103
70 3300026121 Ga0207683_10313794 Ga0207683_103137942 103
71 3300028379 Ga0268266_10718348 Ga0268266_107183482 103
72 3300028381 Ga0268264_10411937 Ga0268264_104119372 103
73 3300031507 Ga0307509_10018067 Ga0307509_100180677 103
74 3300031730 Ga0307516_10489086 Ga0307516_104890862 103
75 3300032002 Ga0307416_102035383 Ga0307416_1020353832 103
76 3300033179 Ga0307507_10024540 Ga0307507_100245406 103
77 3300053086 Ga0500578_0649006 Ga0500578_0649006_202_531 103
78 3300005578 Ga0068854_100423003 Ga0068854_1004230032 104
79 3300031456 Ga0307513_10010109 Ga0307513_100101093 105
80 3300053155 Ga0500620_064815 Ga0500620_064815_616_954 105
81 3300021388 Ga0213875_10077661 Ga0213875_100776612 106
82 3300037853 Ga0436364_1402407 Ga0436364_1402407_2392_2754 106
83 3300039437 Ga0436365_0946759 Ga0436365_0946759_51_413 106
84 iso_pu_bacteria 2643221604 2644032794 106
85 iso_pu_bacteria 2643221617 2644100737 106
86 iso_pu_bacteria 2643221620 2644117145 106
87 iso_pu_bacteria 2811994874 2812334627 106
88 3300005337 Ga0070682_100566088 Ga0070682_1005660882 107
89 3300005456 Ga0070678_102009220 Ga0070678_1020092201 107
90 3300005544 Ga0070686_100164428 Ga0070686_1001644283 107
91 3300005719 Ga0068861_101392489 Ga0068861_1013924892 107
92 3300005937 Ga0081455_10020716 Ga0081455_100207166 107
93 3300025926 Ga0207659_10445457 Ga0207659_104454572 107
94 3300025929 Ga0207664_10167972 Ga0207664_101679722 107
95 3300025972 Ga0207668_10103674 Ga0207668_101036742 107
96 3300026023 Ga0207677_10159749 Ga0207677_101597492 107
97 3300026067 Ga0207678_10004026 Ga0207678_100040266 107
98 3300026118 Ga0207675_101335554 Ga0207675_1013355542 107
99 3300026142 Ga0207698_11839779 Ga0207698_118397792 107
100 3300028794 Ga0307515_10069919 Ga0307515_100699193 107
101 3300031616 Ga0307508_10053451 Ga0307508_100534513 107
102 3300031901 Ga0307406_10485281 Ga0307406_104852812 107
103 3300035695 Ga0373927_0302163 Ga0373927_0302163_568_921 107
104 3300035724 Ga0373933_0755788 Ga0373933_0755788_119_472 107
105 3300044683 Ga0466965_0233123 Ga0466965_0233123_597_941 107
106 3300044684 Ga0466966_0394073 Ga0466966_0394073_219_563 107
107 3300044901 Ga0466960_0025874 Ga0466960_0025874_831_1175 107
108 3300046517 Ga0495630_1098443 Ga0495630_1098443_240_593 107
109 iso_pu_bacteria 8002784119 8002787771 107
110 3300031903 Ga0307407_11302411 Ga0307407_113024112 108
111 3300031995 Ga0307409_100389354 Ga0307409_1003893542 108
112 3300032002 Ga0307416_102492836 Ga0307416_1024928362 108
113 3300032126 Ga0307415_100754478 Ga0307415_1007544782 108
114 3300005366 Ga0070659_100151414 Ga0070659_1001514142 109
115 3300005436 Ga0070713_101336652 Ga0070713_1013366521 109
116 3300006028 Ga0070717_11936833 Ga0070717_119368332 109
117 3300009993 Ga0105028_116354 Ga0105028_1163542 109
118 3300014968 Ga0157379_12491522 Ga0157379_124915221 109
119 3300025928 Ga0207700_11625085 Ga0207700_116250852 109
120 3300031548 Ga0307408_100015655 Ga0307408_1000156553 109
121 3300031731 Ga0307405_10003987 Ga0307405_100039875 109
122 3300032004 Ga0307414_11817985 Ga0307414_118179851 109
123 3300003373 JGI25407J50210_10001077 JGI25407J50210_100010773 110
124 3300003373 JGI25407J50210_10007571 JGI25407J50210_100075713 110
125 3300005328 Ga0070676_10880432 Ga0070676_108804321 110
126 3300005331 Ga0070670_100217783 Ga0070670_1002177832 110
127 3300005333 Ga0070677_10185839 Ga0070677_101858392 110
128 3300005336 Ga0070680_101465183 Ga0070680_1014651832 110
129 3300005347 Ga0070668_100346225 Ga0070668_1003462252 110
130 3300005354 Ga0070675_100524009 Ga0070675_1005240092 110
131 3300005356 Ga0070674_100186137 Ga0070674_1001861372 110
132 3300005364 Ga0070673_100941950 Ga0070673_1009419501 110
133 3300005455 Ga0070663_101287948 Ga0070663_1012879481 110
134 3300005456 Ga0070678_100019517 Ga0070678_1000195173 110
135 3300005530 Ga0070679_101484097 Ga0070679_1014840971 110
136 3300005615 Ga0070702_100240366 Ga0070702_1002403662 110
137 3300005618 Ga0068864_100587135 Ga0068864_1005871352 110
138 3300005719 Ga0068861_100273437 Ga0068861_1002734372 110
139 3300005981 Ga0081538_10001607 Ga0081538_100016078 110
140 3300005981 Ga0081538_10002527 Ga0081538_1000252710 110
141 3300005981 Ga0081538_10145200 Ga0081538_101452002 110
142 3300006881 Ga0068865_101549779 Ga0068865_1015497791 110
143 3300009098 Ga0105245_10428510 Ga0105245_104285102 110
144 3300009148 Ga0105243_10379130 Ga0105243_103791302 110
145 3300009553 Ga0105249_11867144 Ga0105249_118671441 110
146 3300013306 Ga0163162_10544584 Ga0163162_105445842 110
147 3300013308 Ga0157375_10444166 Ga0157375_104441662 110
148 3300014325 Ga0163163_10474168 Ga0163163_104741682 110
149 3300014326 Ga0157380_10725893 Ga0157380_107258932 110
150 3300014745 Ga0157377_10352640 Ga0157377_103526402 110
151 3300017792 Ga0163161_10155436 Ga0163161_101554362 110
152 3300025893 Ga0207682_10161877 Ga0207682_101618772 110
153 3300025901 Ga0207688_10133327 Ga0207688_101333272 110
154 3300025903 Ga0207680_10653416 Ga0207680_106534162 110
155 3300025907 Ga0207645_10360294 Ga0207645_103602941 110
156 3300025908 Ga0207643_10051649 Ga0207643_100516494 110
157 3300025927 Ga0207687_10904155 Ga0207687_109041552 110
158 3300025932 Ga0207690_10342916 Ga0207690_103429162 110
159 3300025935 Ga0207709_10766606 Ga0207709_107666062 110
160 3300025944 Ga0207661_11214283 Ga0207661_112142831 110
161 3300025961 Ga0207712_10640259 Ga0207712_106402592 110
162 3300026075 Ga0207708_10269512 Ga0207708_102695122 110
163 3300026095 Ga0207676_12130611 Ga0207676_121306112 110
164 3300026118 Ga0207675_100281421 Ga0207675_1002814212 110
165 3300026121 Ga0207683_10107800 Ga0207683_101078002 110
166 3300031548 Ga0307408_101553493 Ga0307408_1015534931 110
167 3300031731 Ga0307405_10215820 Ga0307405_102158202 110
168 3300031824 Ga0307413_10166750 Ga0307413_101667502 110
169 3300031824 Ga0307413_10166918 Ga0307413_101669182 110
170 3300031824 Ga0307413_10574744 Ga0307413_105747442 110
171 3300031852 Ga0307410_10822522 Ga0307410_108225222 110
172 3300031852 Ga0307410_11351455 Ga0307410_113514551 110
173 3300031901 Ga0307406_10008089 Ga0307406_100080894 110
174 3300031901 Ga0307406_10153055 Ga0307406_101530553 110
175 3300031901 Ga0307406_10827372 Ga0307406_108273722 110
176 3300031903 Ga0307407_10009348 Ga0307407_100093485 110
177 3300031903 Ga0307407_10023236 Ga0307407_100232362 110
178 3300031903 Ga0307407_10068171 Ga0307407_100681712 110
179 3300031903 Ga0307407_10656201 Ga0307407_106562011 110
180 3300031911 Ga0307412_10017719 Ga0307412_100177193 110
181 3300031911 Ga0307412_11746034 Ga0307412_117460342 110
182 3300031995 Ga0307409_100008577 Ga0307409_1000085775 110
183 3300031995 Ga0307409_100049319 Ga0307409_1000493192 110
184 3300031995 Ga0307409_100211790 Ga0307409_1002117902 110
185 3300031995 Ga0307409_100851502 Ga0307409_1008515022 110
186 3300032002 Ga0307416_100002378 Ga0307416_1000023784 110
187 3300032002 Ga0307416_101086636 Ga0307416_1010866362 110
188 3300032002 Ga0307416_102618482 Ga0307416_1026184821 110
189 3300032005 Ga0307411_10517171 Ga0307411_105171712 110
190 3300032126 Ga0307415_100187369 Ga0307415_1001873692 110
191 3300032126 Ga0307415_100279766 Ga0307415_1002797661 110
192 3300032126 Ga0307415_100329962 Ga0307415_1003299622 110
193 3300032126 Ga0307415_101069310 Ga0307415_1010693102 110
194 3300032126 Ga0307415_101345934 Ga0307415_1013459341 110
195 3300032126 Ga0307415_101479122 Ga0307415_1014791222 110
196 3300037418 Ga0395900_0332359 Ga0395900_0332359_204_557 110
197 3300037466 Ga0395898_0164601 Ga0395898_0164601_625_978 110
198 3300037466 Ga0395898_0271033 Ga0395898_0271033_471_827 110
199 3300037466 Ga0395898_1737490 Ga0395898_1737490_102_458 110
200 3300037471 Ga0395905_0351892 Ga0395905_0351892_228_581 110
201 3300038443 Ga0395901_0300314 Ga0395901_0300314_838_1194 110
202 3300038443 Ga0395901_0312774 Ga0395901_0312774_685_1038 110
203 3300041451 Ga0451791_1474066 Ga0451791_1474066_142_492 110
204 3300041452 Ga0451793_0449545 Ga0451793_0449545_218_568 110
205 3300041459 Ga0451800_0524290 Ga0451800_0524290_99_449 110
206 3300041486 Ga0451807_0115306 Ga0451807_0115306_150_500 110
207 3300041509 Ga0451843_0801185 Ga0451843_0801185_29_379 110
208 3300041512 Ga0451853_2406808 Ga0451853_2406808_167_517 110
209 3300042005 Ga0439448_0000973 Ga0439448_0000973_1828_2181 110
210 3300042005 Ga0439448_0031786 Ga0439448_0031786_483_824 110
211 3300042012 Ga0439455_0100894 Ga0439455_0100894_185_538 110
212 3300042012 Ga0439455_0118992 Ga0439455_0118992_47_388 110
213 3300042016 Ga0439463_023088 Ga0439463_023088_1061_1402 110
214 3300042016 Ga0439463_185021 Ga0439463_185021_166_507 110
215 3300042157 Ga0439458_0054862 Ga0439458_0054862_334_675 110
216 3300042461 Ga0439460_0141532 Ga0439460_0141532_16_369 110
217 3300042993 Ga0439440_0003656 Ga0439440_0003656_999_1340 110
218 3300042993 Ga0439440_0037851 Ga0439440_0037851_340_693 110
219 3300044719 Ga0466971_0031182 Ga0466971_0031182_1083_1436 110
220 3300044765 Ga0466970_0002401 Ga0466970_0002401_5412_5765 110
221 3300045049 Ga0466959_0094176 Ga0466959_0094176_1000_1353 110
222 3300045976 Ga0466967_0145486 Ga0466967_0145486_686_1039 110
223 3300048912 Ga0496109_1031865 Ga0496109_1031865_62_412 110
224 3300048917 Ga0496114_0193271 Ga0496114_0193271_583_954 110
225 3300048924 Ga0496121_0014835 Ga0496121_0014835_4318_4653 110
226 3300061719 Ga0466962_0186794 Ga0466962_0186794_164_517 110
227 3300001977 JGI24746J21847_1026410 JGI24746J21847_10264102 111
228 3300003373 JGI25407J50210_10002548 JGI25407J50210_100025482 111
229 3300005327 Ga0070658_10093545 Ga0070658_100935452 111
230 3300005328 Ga0070676_10243497 Ga0070676_102434972 111
231 3300005329 Ga0070683_100110141 Ga0070683_1001101413 111
232 3300005330 Ga0070690_101132181 Ga0070690_1011321812 111
233 3300005334 Ga0068869_100080305 Ga0068869_1000803054 111
234 3300005337 Ga0070682_100030344 Ga0070682_1000303444 111
235 3300005338 Ga0068868_100125122 Ga0068868_1001251223 111
236 3300005339 Ga0070660_100338201 Ga0070660_1003382012 111
237 3300005339 Ga0070660_100483387 Ga0070660_1004833872 111
238 3300005340 Ga0070689_100319781 Ga0070689_1003197813 111
239 3300005344 Ga0070661_100139274 Ga0070661_1001392742 111
240 3300005347 Ga0070668_100013751 Ga0070668_1000137515 111
241 3300005356 Ga0070674_101277390 Ga0070674_1012773901 111
242 3300005365 Ga0070688_100104188 Ga0070688_1001041883 111
243 3300005436 Ga0070713_100349850 Ga0070713_1003498502 111
244 3300005437 Ga0070710_10456395 Ga0070710_104563952 111
245 3300005438 Ga0070701_11097636 Ga0070701_110976361 111
246 3300005439 Ga0070711_100627537 Ga0070711_1006275371 111
247 3300005441 Ga0070700_100273574 Ga0070700_1002735742 111
248 3300005455 Ga0070663_100105953 Ga0070663_1001059532 111
249 3300005455 Ga0070663_101151870 Ga0070663_1011518701 111
250 3300005456 Ga0070678_100144055 Ga0070678_1001440552 111
251 3300005457 Ga0070662_101292583 Ga0070662_1012925832 111
252 3300005466 Ga0070685_10737342 Ga0070685_107373422 111
253 3300005468 Ga0070707_101178686 Ga0070707_1011786861 111
254 3300005530 Ga0070679_101367734 Ga0070679_1013677342 111
255 3300005535 Ga0070684_100193027 Ga0070684_1001930272 111
256 3300005539 Ga0068853_100198578 Ga0068853_1001985783 111
257 3300005544 Ga0070686_100452733 Ga0070686_1004527332 111
258 3300005544 Ga0070686_100863051 Ga0070686_1008630512 111
259 3300005547 Ga0070693_100697201 Ga0070693_1006972012 111
260 3300005548 Ga0070665_100043879 Ga0070665_1000438795 111
261 3300005548 Ga0070665_100122869 Ga0070665_1001228693 111
262 3300005563 Ga0068855_100026009 Ga0068855_1000260095 111
263 3300005564 Ga0070664_100085096 Ga0070664_1000850962 111
264 3300005564 Ga0070664_100228899 Ga0070664_1002288992 111
265 3300005577 Ga0068857_100481044 Ga0068857_1004810443 111
266 3300005614 Ga0068856_100479034 Ga0068856_1004790342 111
267 3300005615 Ga0070702_100181669 Ga0070702_1001816692 111
268 3300005616 Ga0068852_100214877 Ga0068852_1002148773 111
269 3300005616 Ga0068852_100418874 Ga0068852_1004188742 111
270 3300005616 Ga0068852_101772620 Ga0068852_1017726201 111
271 3300005618 Ga0068864_100178793 Ga0068864_1001787932 111
272 3300005719 Ga0068861_102063037 Ga0068861_1020630372 111
273 3300005834 Ga0068851_10136399 Ga0068851_101363992 111
274 3300005840 Ga0068870_10477535 Ga0068870_104775351 111
275 3300005844 Ga0068862_100071495 Ga0068862_1000714953 111
276 3300005981 Ga0081538_10003584 Ga0081538_1000358410 111
277 3300005981 Ga0081538_10048796 Ga0081538_100487963 111
278 3300006028 Ga0070717_10139839 Ga0070717_101398393 111
279 3300006163 Ga0070715_10738085 Ga0070715_107380852 111
280 3300006175 Ga0070712_101470255 Ga0070712_1014702552 111
281 3300006881 Ga0068865_100608234 Ga0068865_1006082341 111
282 3300009093 Ga0105240_10034320 Ga0105240_100343205 111
283 3300009093 Ga0105240_10497427 Ga0105240_104974273 111
284 3300009094 Ga0111539_10249689 Ga0111539_102496892 111
285 3300009094 Ga0111539_11920563 Ga0111539_119205632 111
286 3300009098 Ga0105245_10534641 Ga0105245_105346412 111
287 3300009101 Ga0105247_10488745 Ga0105247_104887452 111
288 3300009148 Ga0105243_10060824 Ga0105243_100608243 111
289 3300009174 Ga0105241_10408469 Ga0105241_104084692 111
290 3300009174 Ga0105241_12301542 Ga0105241_123015421 111
291 3300009545 Ga0105237_10075952 Ga0105237_100759521 111
292 3300009545 Ga0105237_10129505 Ga0105237_101295052 111
293 3300009545 Ga0105237_10287543 Ga0105237_102875432 111
294 3300009551 Ga0105238_10331706 Ga0105238_103317062 111
295 3300009551 Ga0105238_10564798 Ga0105238_105647982 111
296 3300010375 Ga0105239_10800302 Ga0105239_108003022 111
297 3300013307 Ga0157372_10323997 Ga0157372_103239973 111
298 3300013307 Ga0157372_12253618 Ga0157372_122536181 111
299 3300013308 Ga0157375_10373033 Ga0157375_103730333 111
300 3300013308 Ga0157375_12246940 Ga0157375_122469402 111
301 3300014325 Ga0163163_10352968 Ga0163163_103529682 111
302 3300014325 Ga0163163_11989587 Ga0163163_119895871 111
303 3300014325 Ga0163163_13129297 Ga0163163_131292971 111
304 3300014968 Ga0157379_12076521 Ga0157379_120765212 111
305 3300017792 Ga0163161_10140899 Ga0163161_101408992 111
306 3300020070 Ga0206356_10328137 Ga0206356_103281372 111
307 3300020082 Ga0206353_10282231 Ga0206353_102822312 111
308 3300025898 Ga0207692_10313138 Ga0207692_103131381 111
309 3300025901 Ga0207688_10002292 Ga0207688_100022927 111
310 3300025901 Ga0207688_10040744 Ga0207688_100407443 111
311 3300025901 Ga0207688_10072479 Ga0207688_100724792 111
312 3300025907 Ga0207645_10039746 Ga0207645_100397463 111
313 3300025909 Ga0207705_10123223 Ga0207705_101232232 111
314 3300025909 Ga0207705_11085839 Ga0207705_110858392 111
315 3300025911 Ga0207654_10535087 Ga0207654_105350872 111
316 3300025913 Ga0207695_10437348 Ga0207695_104373482 111
317 3300025914 Ga0207671_10024819 Ga0207671_100248193 111
318 3300025914 Ga0207671_10629452 Ga0207671_106294522 111
319 3300025915 Ga0207693_11346262 Ga0207693_113462621 111
320 3300025918 Ga0207662_10149327 Ga0207662_101493273 111
321 3300025919 Ga0207657_10019820 Ga0207657_100198204 111
322 3300025924 Ga0207694_10378139 Ga0207694_103781392 111
323 3300025927 Ga0207687_10069344 Ga0207687_100693442 111
324 3300025927 Ga0207687_11036706 Ga0207687_110367062 111
325 3300025933 Ga0207706_10240902 Ga0207706_102409024 111
326 3300025933 Ga0207706_11051634 Ga0207706_110516341 111
327 3300025937 Ga0207669_10183437 Ga0207669_101834373 111
328 3300025938 Ga0207704_10024298 Ga0207704_100242985 111
329 3300025938 Ga0207704_10524764 Ga0207704_105247642 111
330 3300025938 Ga0207704_11931949 Ga0207704_119319491 111
331 3300025939 Ga0207665_10385704 Ga0207665_103857041 111
332 3300025940 Ga0207691_10069864 Ga0207691_100698643 111
333 3300025942 Ga0207689_10083013 Ga0207689_100830134 111
334 3300025945 Ga0207679_10790066 Ga0207679_107900662 111
335 3300025945 Ga0207679_11891121 Ga0207679_118911212 111
336 3300025949 Ga0207667_10367661 Ga0207667_103676612 111
337 3300025961 Ga0207712_10535452 Ga0207712_105354522 111
338 3300025972 Ga0207668_10337483 Ga0207668_103374833 111
339 3300025981 Ga0207640_10020978 Ga0207640_100209783 111
340 3300026023 Ga0207677_10347133 Ga0207677_103471333 111
341 3300026035 Ga0207703_10650956 Ga0207703_106509562 111
342 3300026067 Ga0207678_10136752 Ga0207678_101367522 111
343 3300026075 Ga0207708_10014860 Ga0207708_100148605 111
344 3300026078 Ga0207702_10117037 Ga0207702_101170373 111
345 3300026078 Ga0207702_10706658 Ga0207702_107066582 111
346 3300026089 Ga0207648_11146255 Ga0207648_111462552 111
347 3300026095 Ga0207676_11098446 Ga0207676_110984462 111
348 3300026116 Ga0207674_10104132 Ga0207674_101041322 111
349 3300026118 Ga0207675_100053901 Ga0207675_1000539015 111
350 3300026121 Ga0207683_10095602 Ga0207683_100956022 111
351 3300026142 Ga0207698_10546762 Ga0207698_105467622 111
352 3300026142 Ga0207698_12108733 Ga0207698_121087331 111
353 3300028379 Ga0268266_10041994 Ga0268266_100419942 111
354 3300028379 Ga0268266_10218970 Ga0268266_102189702 111
355 3300028380 Ga0268265_10056229 Ga0268265_100562293 111
356 3300028380 Ga0268265_11072636 Ga0268265_110726361 111
357 3300028381 Ga0268264_10324911 Ga0268264_103249112 111
358 3300031239 Ga0265328_10461187 Ga0265328_104611871 111
359 3300031548 Ga0307408_101108401 Ga0307408_1011084012 111
360 3300031595 Ga0265313_10368784 Ga0265313_103687841 111
361 3300031731 Ga0307405_10008160 Ga0307405_100081604 111
362 3300031824 Ga0307413_10028138 Ga0307413_100281383 111
363 3300031824 Ga0307413_10851648 Ga0307413_108516481 111
364 3300031852 Ga0307410_10009334 Ga0307410_100093346 111
365 3300031852 Ga0307410_10012744 Ga0307410_100127444 111
366 3300031852 Ga0307410_10324114 Ga0307410_103241142 111
367 3300031852 Ga0307410_10515691 Ga0307410_105156912 111
368 3300031852 Ga0307410_10670786 Ga0307410_106707862 111
369 3300031852 Ga0307410_11959460 Ga0307410_119594601 111
370 3300031889 Ga0326468_10003362 Ga0326468_100033622 111
371 3300031901 Ga0307406_10108433 Ga0307406_101084333 111
372 3300031903 Ga0307407_10000233 Ga0307407_100002334 111
373 3300031911 Ga0307412_10056283 Ga0307412_100562832 111
374 3300031995 Ga0307409_100004358 Ga0307409_1000043584 111
375 3300031995 Ga0307409_100060031 Ga0307409_1000600314 111
376 3300031995 Ga0307409_100786538 Ga0307409_1007865382 111
377 3300031995 Ga0307409_101954625 Ga0307409_1019546252 111
378 3300031995 Ga0307409_102611516 Ga0307409_1026115161 111
379 3300032002 Ga0307416_100000373 Ga0307416_1000003734 111
380 3300032002 Ga0307416_100008898 Ga0307416_1000088986 111
381 3300032002 Ga0307416_100035531 Ga0307416_1000355313 111
382 3300032002 Ga0307416_100356842 Ga0307416_1003568422 111
383 3300032002 Ga0307416_102797438 Ga0307416_1027974381 111
384 3300032004 Ga0307414_10130849 Ga0307414_101308492 111
385 3300032004 Ga0307414_10533486 Ga0307414_105334862 111
386 3300032004 Ga0307414_10900143 Ga0307414_109001431 111
387 3300032004 Ga0307414_11161688 Ga0307414_111616882 111
388 3300032005 Ga0307411_10015038 Ga0307411_100150384 111
389 3300032005 Ga0307411_10342789 Ga0307411_103427892 111
390 3300032126 Ga0307415_100008624 Ga0307415_1000086244 111
391 3300032126 Ga0307415_100040898 Ga0307415_1000408984 111
392 3300032126 Ga0307415_100059533 Ga0307415_1000595333 111
393 3300032126 Ga0307415_100998575 Ga0307415_1009985752 111
394 3300032126 Ga0307415_102072135 Ga0307415_1020721351 111
395 3300035242 Ga0373962_0266735 Ga0373962_0266735_198_548 111
396 3300039437 Ga0436365_0718771 Ga0436365_0718771_1306_1653 111
397 3300042016 Ga0439463_010962 Ga0439463_010962_965_1315 111
398 3300042157 Ga0439458_0039001 Ga0439458_0039001_432_782 111
399 3300042439 Ga0439464_0060025 Ga0439464_0060025_364_714 111
400 3300042461 Ga0439460_0265731 Ga0439460_0265731_62_412 111
401 3300044683 Ga0466965_0583490 Ga0466965_0583490_217_567 111
402 3300044683 Ga0466965_0621165 Ga0466965_0621165_49_399 111
403 3300044693 Ga0466961_0269904 Ga0466961_0269904_69_416 111
404 3300044694 Ga0466963_1282277 Ga0466963_1282277_67_417 111
405 3300044842 Ga0466957_0056838 Ga0466957_0056838_908_1255 111
406 3300045049 Ga0466959_0660905 Ga0466959_0660905_202_552 111
407 3300045836 Ga0466958_0614572 Ga0466958_0614572_276_626 111
408 3300045836 Ga0466958_0858409 Ga0466958_0858409_219_566 111
409 3300045976 Ga0466967_0023618 Ga0466967_0023618_1258_1602 111
410 3300045976 Ga0466967_0093072 Ga0466967_0093072_2312_2662 111
411 3300045976 Ga0466967_0303357 Ga0466967_0303357_238_576 111
412 3300046459 Ga0495629_0549075 Ga0495629_0549075_15_413 111
413 3300046491 Ga0495584_0169441 Ga0495584_0169441_735_1088 111
414 3300046499 Ga0495594_0261362 Ga0495594_0261362_399_797 111
415 3300048905 Ga0496102_1025535 Ga0496102_1025535_57_392 111
416 3300048907 Ga0496104_1330109 Ga0496104_1330109_101_436 111
417 3300048909 Ga0496106_0738305 Ga0496106_0738305_288_623 111
418 3300048911 Ga0496108_0087314 Ga0496108_0087314_1013_1357 111
419 3300048911 Ga0496108_0119259 Ga0496108_0119259_1043_1378 111
420 3300048912 Ga0496109_0145527 Ga0496109_0145527_560_895 111
421 3300048915 Ga0496112_0837517 Ga0496112_0837517_429_764 111
422 3300050511 nmdc:mga08y16_1328069_c1 nmdc:mga08y16_1328069_c1_81_431 111
423 3300050511 nmdc:mga08y16_145358_c1 nmdc:mga08y16_145358_c1_1432_1767 111
424 3300050511 nmdc:mga08y16_548232_c1 nmdc:mga08y16_548232_c1_686_1027 111
425 3300053136 Ga0500559_0008673 Ga0500559_0008673_179_556 111
426 3300059421 Ga0590071_014285 Ga0590071_014285_1360_1704 111
427 3300059424 Ga0590075_054646 Ga0590075_054646_402_746 111
428 3300059426 Ga0590077_062897 Ga0590077_062897_329_673 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

3

117

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.878 2 104
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8592 1 104
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8547 1 104
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8429 1 104
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8394 1 104
ID Description Score Start End Superfamily
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8482 1 98 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8402 1 98 3.30.70.100
af_A0A1D6LR68_362_448_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8073 40 59 2.60.40.790
af_I1LID7_431_528_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7917 40 59 2.60.40.790
af_K7MGP7_422_535_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7907 40 60 2.60.40.790
ID Description Score Start End GO Terms
AF-X1DUB9-F1-model_v4 L-rhamnose mutarotase 0.9983 1 69 GO:0016857
GO:0019301
AF-A0A2V9QIW7-F1-model_v4 L-rhamnose/proton symporter RhaT 0.9962 1 86 GO:0005886
GO:0015153
GO:0015293
GO:0016857
GO:0019301
AF-A0A7V9DG13-F1-model_v4 L-rhamnose mutarotase 0.982 1 62 GO:0016857
GO:0019301
AF-Q5BRL3-F1-model_v4 SJCHGC07853 protein 0.9704 2 65 GO:0016857
GO:0019301
AF-A0A7W3ML87-F1-model_v4 deleted 0.9671 2 103

Feature Viewer

pLDDT pTM Quality
90.97 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map