F441495

General Info

Members Datasets Scaffolds Average Seq Length
427 265 426 148

Family's Representative Sequence

Representative Sequence 3300041496|Ga0451839_0374069|Ga0451839_0374069_442_981
Length 179
Sequence MALPDLDGSVGHSFGLEIDGVQIKAITEVSGLKMEQDVIELKQNGPDGKYMIKKLPGRWKAGECTLTRPLTSDQSFEKWVKDSQFGKMGDVRKGGAIVVYDYEGTAVKRYKLTAAWPKSLEIGALKAGDTSVLFIEHDMALVFGYAQRVTVLGGGALLAQGTPDEIRADPVVRKAYLGH

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
139 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
150 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
167 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
168 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
169 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
172 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
175 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
176 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
179 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
180 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
181 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
265 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 3.28
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 12.88
Rhizosphere 81.5
Stem 0
Stem Tuber 0
Unclassified 4.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1056704 3300002073 Bacteria 503
2 Ga0055540_1000040 3300003792 Bacteria 157728
3 Ga0058863_11853458 3300004799 Bacteria 678
4 Ga0058861_10044385 3300004800 Bacteria 1181
5 Ga0058860_12152023 3300004801 Bacteria 693
6 Ga0058862_12636588 3300004803 Bacteria 596
7 Ga0065704_10574349 3300005289 Unclassified 621
8 Ga0070683_100123581 3300005329 Bacteria 2446
9 Ga0070683_101700700 3300005329 Bacteria 607
10 Ga0070670_100770318 3300005331 Bacteria 868
11 Ga0070680_100692724 3300005336 Bacteria 877
12 Ga0070682_100332380 3300005337 Bacteria 1127
13 Ga0068868_100543992 3300005338 Bacteria 1022
14 Ga0068868_101181937 3300005338 Bacteria 707
15 Ga0070660_101109732 3300005339 Bacteria 670
16 Ga0070689_101465720 3300005340 Bacteria 618
17 Ga0070691_10760805 3300005341 Bacteria 587
18 Ga0070687_100658279 3300005343 Bacteria 727
19 Ga0070687_100942845 3300005343 Bacteria 622
20 Ga0070687_101075301 3300005343 Bacteria 587
21 Ga0070668_100748686 3300005347 Bacteria 865
22 Ga0070671_100472254 3300005355 Bacteria 1077
23 Ga0070671_101262229 3300005355 Bacteria 651
24 Ga0070667_100499374 3300005367 Bacteria 1115
25 Ga0070667_101055595 3300005367 Bacteria 759
26 Ga0070667_101204196 3300005367 Bacteria 709
27 Ga0070709_10036990 3300005434 Bacteria 2978
28 Ga0070709_11785363 3300005434 Bacteria 503
29 Ga0070714_100052518 3300005435 Bacteria 3476
30 Ga0070714_101384890 3300005435 Bacteria 687
31 Ga0070713_100000475 3300005436 Bacteria 25564
32 Ga0070710_10044112 3300005437 Bacteria 2473
33 Ga0070710_10709446 3300005437 Bacteria 711
34 Ga0070711_100124044 3300005439 Bacteria 1915
35 Ga0070711_101679473 3300005439 Bacteria 556
36 Ga0070700_100334119 3300005441 Bacteria 1118
37 Ga0070663_100498758 3300005455 Bacteria 1010
38 Ga0070678_100161306 3300005456 Bacteria 1817
39 Ga0070678_100190062 3300005456 Bacteria 1688
40 Ga0070678_100792651 3300005456 Bacteria 860
41 Ga0070681_10969178 3300005458 Bacteria 770
42 Ga0070685_10341186 3300005466 Bacteria 1021
43 Ga0070698_100323026 3300005471 Bacteria 1474
44 Ga0070698_101535714 3300005471 Bacteria 617
45 Ga0070699_100877898 3300005518 Bacteria 821
46 Ga0068853_100405750 3300005539 Bacteria 1276
47 Ga0070665_100050470 3300005548 Bacteria 4175
48 Ga0070665_100721102 3300005548 Bacteria 1010
49 Ga0070665_100930418 3300005548 Bacteria 882
50 Ga0070665_101269127 3300005548 Bacteria 747
51 Ga0070704_101112275 3300005549 Bacteria 718
52 Ga0070664_100526023 3300005564 Bacteria 1092
53 Ga0068857_100433460 3300005577 Bacteria 1227
54 Ga0068857_100463817 3300005577 Bacteria 1186
55 Ga0068854_100604184 3300005578 Bacteria 937
56 Ga0068856_100179512 3300005614 Bacteria 2130
57 Ga0068856_101734130 3300005614 Bacteria 637
58 Ga0068859_100556048 3300005617 Bacteria 1242
59 Ga0068859_102102881 3300005617 Bacteria 623
60 Ga0068866_10176385 3300005718 Bacteria 1259
61 Ga0068861_100291853 3300005719 Bacteria 1409
62 Ga0068861_101861880 3300005719 Bacteria 598
63 Ga0068851_10567240 3300005834 Bacteria 688
64 Ga0068870_10285940 3300005840 Bacteria 1035
65 Ga0068860_100065611 3300005843 Bacteria 3447
66 Ga0068860_100567392 3300005843 Bacteria 1138
67 Ga0068862_100261979 3300005844 Bacteria 1578
68 Ga0068862_101751548 3300005844 Bacteria 630
69 Ga0081455_10243526 3300005937 Bacteria 1320
70 Ga0081539_10003971 3300005985 Bacteria 17100
71 Ga0081539_10054146 3300005985 Bacteria 2242
72 Ga0070717_10000745 3300006028 Bacteria 21247
73 Ga0070716_100072993 3300006173 Bacteria 2023
74 Ga0070716_100428301 3300006173 Bacteria 959
75 Ga0075428_100012948 3300006844 Bacteria 9276
76 Ga0075428_100143018 3300006844 Bacteria 2600
77 Ga0075428_101258881 3300006844 Bacteria 779
78 Ga0075428_101430352 3300006844 Bacteria 725
79 Ga0075430_100000610 3300006846 Bacteria 27294
80 Ga0075430_100090647 3300006846 Bacteria 2557
81 Ga0075430_101065732 3300006846 Bacteria 666
82 Ga0075431_100004541 3300006847 Bacteria 13628
83 Ga0075431_100034014 3300006847 Bacteria 5252
84 Ga0075429_100000625 3300006880 Bacteria 27294
85 Ga0075429_100010342 3300006880 Bacteria 8072
86 Ga0068865_101431494 3300006881 Bacteria 618
87 Ga0075436_100743920 3300006914 Bacteria 728
88 Ga0097620_100556093 3300006931 Bacteria 1242
89 Ga0097620_102102889 3300006931 Bacteria 623
90 Ga0105251_10265820 3300009011 Bacteria 774
91 Ga0111539_12056380 3300009094 Bacteria 662
92 Ga0105245_10119140 3300009098 Bacteria 2464
93 Ga0105245_10217527 3300009098 Bacteria 1841
94 Ga0105245_10799535 3300009098 Bacteria 981
95 Ga0114129_10001039 3300009147 Bacteria 36304
96 Ga0114129_10083062 3300009147 Bacteria 4450
97 Ga0105243_10300069 3300009148 Bacteria 1455
98 Ga0105243_11217931 3300009148 Bacteria 767
99 Ga0105241_10405911 3300009174 Bacteria 1196
100 Ga0105241_10640487 3300009174 Bacteria 964
101 Ga0105242_10656598 3300009176 Bacteria 1021
102 Ga0105242_10781667 3300009176 Bacteria 943
103 Ga0105237_10008877 3300009545 Bacteria 10834
104 Ga0105237_10558656 3300009545 Bacteria 1151
105 Ga0105238_10632927 3300009551 Bacteria 1079
106 Ga0105238_10796615 3300009551 Bacteria 960
107 Ga0105238_10798534 3300009551 Bacteria 959
108 Ga0105238_11507175 3300009551 Bacteria 701
109 Ga0105238_11537000 3300009551 Bacteria 695
110 Ga0105238_12097493 3300009551 Bacteria 599
111 Ga0105249_10377472 3300009553 Bacteria 1443
112 Ga0105249_10435317 3300009553 Bacteria 1348
113 Ga0105249_12333185 3300009553 Bacteria 608
114 Ga0105239_10001323 3300010375 Bacteria 33361
115 Ga0105239_10460617 3300010375 Bacteria 1443
116 Ga0105239_11588158 3300010375 Bacteria 756
117 Ga0105246_10106861 3300011119 Bacteria 2048
118 Ga0105246_10982466 3300011119 Bacteria 763
119 Ga0105246_11332107 3300011119 Bacteria 667
120 Ga0157371_10207253 3300013102 Bacteria 1406
121 Ga0157371_10776233 3300013102 Bacteria 721
122 Ga0157369_10013067 3300013105 Bacteria 9403
123 Ga0157374_10826094 3300013296 Bacteria 943
124 Ga0157374_10861307 3300013296 Bacteria 923
125 Ga0157374_10913902 3300013296 Bacteria 895
126 Ga0157374_11479374 3300013296 Bacteria 702
127 Ga0157374_12713816 3300013296 Bacteria 523
128 Ga0157378_10504013 3300013297 Bacteria 1210
129 Ga0163162_10595715 3300013306 Bacteria 1232
130 Ga0163162_10638153 3300013306 Bacteria 1189
131 Ga0157372_10064996 3300013307 Bacteria 4095
132 Ga0157372_10445228 3300013307 Bacteria 1510
133 Ga0157372_11631778 3300013307 Bacteria 742
134 Ga0157372_12747392 3300013307 Bacteria 565
135 Ga0157375_10229013 3300013308 Bacteria 2017
136 Ga0157375_10759853 3300013308 Bacteria 1120
137 Ga0157375_11001232 3300013308 Bacteria 975
138 Ga0163163_10840283 3300014325 Bacteria 982
139 Ga0163163_11222220 3300014325 Bacteria 814
140 Ga0163163_11774060 3300014325 Bacteria 677
141 Ga0163163_12713308 3300014325 Bacteria 552
142 Ga0157380_10154408 3300014326 Bacteria 1988
143 Ga0157377_10376827 3300014745 Bacteria 959
144 Ga0157376_10360980 3300014969 Bacteria 1393
145 Ga0157376_10461783 3300014969 Bacteria 1241
146 Ga0206352_11320934 3300020078 Bacteria 885
147 Ga0206353_10532936 3300020082 Bacteria 865
148 Ga0206353_11486661 3300020082 Bacteria 517
149 Ga0256744_151277 3300023309 Bacteria 653
150 Ga0209051_1000107 3300025303 Bacteria 157903
151 Ga0207692_10218476 3300025898 Bacteria 1129
152 Ga0207642_10146985 3300025899 Bacteria 1250
153 Ga0207688_10047401 3300025901 Bacteria 2400
154 Ga0207688_10073463 3300025901 Bacteria 1944
155 Ga0207688_10279676 3300025901 Bacteria 1016
156 Ga0207688_10454016 3300025901 Bacteria 799
157 Ga0207688_10590880 3300025901 Bacteria 699
158 Ga0207647_10806237 3300025904 Bacteria 505
159 Ga0207699_10131233 3300025906 Bacteria 1634
160 Ga0207643_10123204 3300025908 Bacteria 1537
161 Ga0207705_10378267 3300025909 Bacteria 1093
162 Ga0207654_10233057 3300025911 Bacteria 1227
163 Ga0207707_10435695 3300025912 Bacteria 1122
164 Ga0207671_10004373 3300025914 Bacteria 13548
165 Ga0207671_10646944 3300025914 Bacteria 842
166 Ga0207693_10218663 3300025915 Bacteria 1497
167 Ga0207663_11086208 3300025916 Bacteria 643
168 Ga0207662_10308163 3300025918 Bacteria 1054
169 Ga0207662_10836020 3300025918 Bacteria 650
170 Ga0207657_10721103 3300025919 Bacteria 774
171 Ga0207652_10863181 3300025921 Bacteria 801
172 Ga0207681_11105825 3300025923 Bacteria 666
173 Ga0207694_10610969 3300025924 Bacteria 917
174 Ga0207694_10749165 3300025924 Bacteria 824
175 Ga0207694_10760707 3300025924 Bacteria 818
176 Ga0207659_10236748 3300025926 Bacteria 1475
177 Ga0207687_10034347 3300025927 Bacteria 3443
178 Ga0207700_10000446 3300025928 Bacteria 24275
179 Ga0207664_10042477 3300025929 Bacteria 3549
180 Ga0207664_10081482 3300025929 Bacteria 2634
181 Ga0207690_10302252 3300025932 Bacteria 1252
182 Ga0207706_10995173 3300025933 Bacteria 705
183 Ga0207706_11124816 3300025933 Bacteria 655
184 Ga0207686_10306894 3300025934 Bacteria 1181
185 Ga0207709_10457519 3300025935 Bacteria 988
186 Ga0207670_10104643 3300025936 Bacteria 2028
187 Ga0207704_10912722 3300025938 Bacteria 739
188 Ga0207665_10454080 3300025939 Bacteria 984
189 Ga0207689_10530500 3300025942 Bacteria 988
190 Ga0207661_11526044 3300025944 Bacteria 612
191 Ga0207661_11758396 3300025944 Bacteria 565
192 Ga0207679_10292410 3300025945 Bacteria 1401
193 Ga0207679_10410877 3300025945 Bacteria 1192
194 Ga0207679_10918676 3300025945 Bacteria 801
195 Ga0207712_10116627 3300025961 Bacteria 2012
196 Ga0207668_10144132 3300025972 Bacteria 1835
197 Ga0207668_10414725 3300025972 Bacteria 1142
198 Ga0207640_10399614 3300025981 Bacteria 1119
199 Ga0207640_11127421 3300025981 Bacteria 695
200 Ga0207658_10154669 3300025986 Bacteria 1873
201 Ga0207658_10884894 3300025986 Bacteria 813
202 Ga0207677_10263587 3300026023 Bacteria 1406
203 Ga0207677_10364428 3300026023 Bacteria 1215
204 Ga0207677_11509030 3300026023 Bacteria 621
205 Ga0207703_10471042 3300026035 Bacteria 1176
206 Ga0207703_10486808 3300026035 Bacteria 1156
207 Ga0207703_10936553 3300026035 Bacteria 830
208 Ga0207639_10618807 3300026041 Bacteria 1000
209 Ga0207639_11170262 3300026041 Bacteria 722
210 Ga0207678_10000016 3300026067 Bacteria 137207
211 Ga0207678_10277271 3300026067 Bacteria 1438
212 Ga0207678_10327763 3300026067 Bacteria 1318
213 Ga0207708_10807387 3300026075 Bacteria 808
214 Ga0207702_10009493 3300026078 Bacteria 8173
215 Ga0207641_10571947 3300026088 Bacteria 1104
216 Ga0207648_10200086 3300026089 Bacteria 1771
217 Ga0207674_10120643 3300026116 Bacteria 2590
218 Ga0207674_10182839 3300026116 Bacteria 2047
219 Ga0207675_100385033 3300026118 Bacteria 1380
220 Ga0207683_10023981 3300026121 Bacteria 5250
221 Ga0207683_10100681 3300026121 Bacteria 2580
222 Ga0207683_10180774 3300026121 Bacteria 1912
223 Ga0207683_10203786 3300026121 Bacteria 1799
224 Ga0207683_10327873 3300026121 Bacteria 1403
225 Ga0207683_10429433 3300026121 Bacteria 1217
226 Ga0207698_11272017 3300026142 Bacteria 750
227 Ga0207428_10289295 3300027907 Bacteria 1215
228 Ga0268266_10052958 3300028379 Bacteria 3486
229 Ga0268266_10306040 3300028379 Bacteria 1484
230 Ga0268266_10632922 3300028379 Bacteria 1029
231 Ga0268265_10680309 3300028380 Bacteria 992
232 Ga0268265_11437618 3300028380 Bacteria 692
233 Ga0268264_10049726 3300028381 Bacteria 3489
234 Ga0268264_10899401 3300028381 Bacteria 888
235 Ga0265334_10002552 3300028573 Bacteria 8494
236 Ga0307517_10323012 3300028786 Bacteria 853
237 Ga0307515_10104813 3300028794 Bacteria 3373
238 Ga0310981_1067785 3300029285 Bacteria 664
239 Ga0316177_1106628 3300030731 Bacteria 1344
240 Ga0316176_1051874 3300030732 Bacteria 1130
241 Ga0314311_1173716 3300030733 Bacteria 2012
242 Ga0316182_1391121 3300030745 Bacteria 740
243 Ga0307513_10000149 3300031456 Bacteria 99930
244 Ga0307508_10196742 3300031616 Bacteria 1617
245 Ga0316579_10000503 3300031691 Bacteria 12785
246 Ga0316576_10047030 3300031727 Bacteria 3125
247 Ga0316576_10291737 3300031727 Bacteria 1220
248 Ga0316578_10035303 3300031728 Bacteria 2874
249 Ga0307413_10100183 3300031824 Bacteria 1912
250 Ga0307518_10007724 3300031838 Bacteria 7690
251 Ga0326468_10040577 3300031889 Bacteria 663
252 Ga0307407_10109811 3300031903 Bacteria 1729
253 Ga0307409_100772003 3300031995 Bacteria 966
254 Ga0307416_100225769 3300032002 Bacteria 1801
255 Ga0307416_100315785 3300032002 Bacteria 1562
256 Ga0307416_102727843 3300032002 Bacteria 590
257 Ga0307411_10172868 3300032005 Bacteria 1631
258 Ga0307415_100186138 3300032126 Bacteria 1634
259 Ga0307415_100305212 3300032126 Bacteria 1320
260 Ga0307415_100501982 3300032126 Bacteria 1061
261 Ga0307415_100975090 3300032126 Bacteria 786
262 Ga0316580_10120904 3300032139 Bacteria 802
263 Ga0307507_10028815 3300033179 Bacteria 5905
264 Ga0307510_10070319 3300033180 Bacteria 3496
265 Ga0316592_1147962 3300033524 Bacteria 553
266 Ga0316588_1063374 3300033528 Bacteria 903
267 Ga0316574_0061208 3300035398 Bacteria 2364
268 Ga0373931_0412934 3300035691 Bacteria 857
269 Ga0316582_0094742 3300036647 Bacteria 1970
270 Ga0316584_0026771 3300036712 Bacteria 4240
271 Ga0436363_0228580 3300039450 Bacteria 2968
272 Ga0451787_400004 3300041441 Bacteria 677
273 Ga0451789_0039271 3300041443 Bacteria 628
274 Ga0451789_0366450 3300041443 Bacteria 2888
275 Ga0451791_0010454 3300041451 Bacteria 4459
276 Ga0451791_0127960 3300041451 Bacteria 724
277 Ga0451791_0691843 3300041451 Bacteria 811
278 Ga0451793_0438330 3300041452 Bacteria 2760
279 Ga0451793_1929778 3300041452 Bacteria 1243
280 Ga0451797_0180635 3300041453 Bacteria 549
281 Ga0451798_0786738 3300041458 Bacteria 1445
282 Ga0451798_0817801 3300041458 Bacteria 722
283 Ga0451800_1194654 3300041459 Bacteria 873
284 Ga0451802_0809031 3300041460 Bacteria 745
285 Ga0451804_0134178 3300041463 Bacteria 934
286 Ga0451833_1072790 3300041491 Bacteria 963
287 Ga0451833_1101133 3300041491 Bacteria 555
288 Ga0451837_0413780 3300041494 Bacteria 1503
289 Ga0451839_0374069 3300041496 Bacteria 1286
290 Ga0451841_0692692 3300041498 Bacteria 683
291 Ga0451847_0936001 3300041503 Bacteria 1190
292 Ga0451843_0391734 3300041509 Bacteria 2938
293 Ga0451843_0566890 3300041509 Bacteria 2097
294 Ga0451843_1065433 3300041509 Bacteria 1129
295 Ga0451855_0652150 3300041511 Bacteria 965
296 Ga0451853_3391179 3300041512 Bacteria 2399
297 Ga0439449_0001436 3300042007 Bacteria 9308
298 Ga0439440_0008326 3300042993 Bacteria 2127
299 Ga0466969_0069017 3300044656 Bacteria 1703
300 Ga0466972_0002049 3300044658 Bacteria 9875
301 Ga0466972_0010317 3300044658 Bacteria 4690
302 Ga0466965_0017209 3300044683 Bacteria 3452
303 Ga0466963_0108380 3300044694 Bacteria 1905
304 Ga0466964_0519929 3300044706 Bacteria 642
305 Ga0466971_0108629 3300044719 Bacteria 1279
306 Ga0466968_0002974 3300044735 Bacteria 6263
307 Ga0466968_0038955 3300044735 Bacteria 1999
308 Ga0466970_0112232 3300044765 Bacteria 1489
309 Ga0466957_0042114 3300044842 Bacteria 2762
310 Ga0466960_0020170 3300044901 Bacteria 2948
311 Ga0466960_0275788 3300044901 Bacteria 941
312 Ga0466959_0132645 3300045049 Bacteria 1765
313 Ga0466959_1050032 3300045049 Bacteria 542
314 Ga0466958_0067370 3300045836 Bacteria 2187
315 Ga0466958_0139963 3300045836 Bacteria 1523
316 Ga0466967_0168172 3300045976 Bacteria 2061
317 Ga0466967_0253756 3300045976 Bacteria 1681
318 Ga0466967_0402622 3300045976 Bacteria 1332
319 Ga0466967_0456823 3300045976 Bacteria 1249
320 Ga0466967_0562183 3300045976 Bacteria 1123
321 Ga0466967_1159527 3300045976 Bacteria 770
322 Ga0495603_0335328 3300046455 Bacteria 868
323 Ga0495603_0731902 3300046455 Bacteria 565
324 Ga0495629_0707012 3300046459 Bacteria 669
325 Ga0495641_0032021 3300046461 Bacteria 2507
326 Ga0495653_0144959 3300046463 Bacteria 1666
327 Ga0495653_0897233 3300046463 Bacteria 528
328 Ga0495639_0404371 3300046475 Bacteria 690
329 Ga0495662_0112632 3300046476 Bacteria 1334
330 Ga0495664_0165307 3300046477 Bacteria 1343
331 Ga0495585_0044523 3300046492 Bacteria 2479
332 Ga0495608_0395916 3300046511 Bacteria 845
333 Ga0495665_0185913 3300046531 Bacteria 1079
334 Ga0495665_0328370 3300046531 Bacteria 781
335 Ga0495665_0341351 3300046531 Bacteria 763
336 Ga0495640_0045821 3300046533 Bacteria 3033
337 Ga0495586_0404429 3300046535 Bacteria 786
338 Ga0495645_0592236 3300046543 Bacteria 683
339 Ga0495667_0092609 3300046559 Bacteria 1957
340 Ga0495588_0074418 3300046674 Bacteria 1769
341 Ga0495657_0291430 3300046675 Bacteria 975
342 Ga0495657_0576748 3300046675 Bacteria 652
343 Ga0495646_0100676 3300046680 Bacteria 1658
344 Ga0495658_0406051 3300046683 Bacteria 869
345 Ga0495600_0540695 3300046809 Bacteria 713
346 Ga0495604_0046984 3300047317 Bacteria 3364
347 Ga0495593_0200150 3300047673 Bacteria 1004
348 Ga0495602_0064169 3300048088 Bacteria 3178
349 Ga0495614_0469563 3300048089 Bacteria 597
350 Ga0496100_0054286 3300048903 Bacteria 2613
351 Ga0496100_0674299 3300048903 Bacteria 806
352 Ga0496101_0185214 3300048904 Bacteria 1605
353 Ga0496101_0902718 3300048904 Bacteria 696
354 Ga0496102_0148117 3300048905 Bacteria 2204
355 Ga0496102_0223307 3300048905 Bacteria 1776
356 Ga0496102_0308263 3300048905 Bacteria 1492
357 Ga0496102_0578911 3300048905 Bacteria 1045
358 Ga0496104_0023165 3300048907 Bacteria 5709
359 Ga0496104_0843300 3300048907 Bacteria 822
360 Ga0496105_0107953 3300048908 Bacteria 2298
361 Ga0496105_0153544 3300048908 Bacteria 1892
362 Ga0496105_0253740 3300048908 Bacteria 1424
363 Ga0496105_0467256 3300048908 Bacteria 994
364 Ga0496105_0959391 3300048908 Unclassified 642
365 Ga0496106_0290917 3300048909 Bacteria 1310
366 Ga0496107_0428607 3300048910 Bacteria 983
367 Ga0496108_0000921 3300048911 Bacteria 22945
368 Ga0496108_0003660 3300048911 Bacteria 12330
369 Ga0496109_0004457 3300048912 Bacteria 11697
370 Ga0496109_0005941 3300048912 Bacteria 10245
371 Ga0496109_0354377 3300048912 Bacteria 1386
372 Ga0496110_0007423 3300048913 Bacteria 8755
373 Ga0496110_0186742 3300048913 Bacteria 1882
374 Ga0496111_0008191 3300048914 Bacteria 6908
375 Ga0496111_0163623 3300048914 Bacteria 1652
376 Ga0496111_0849259 3300048914 Bacteria 659
377 Ga0496112_0005346 3300048915 Bacteria 11087
378 Ga0496112_0459072 3300048915 Bacteria 1211
379 Ga0496113_0001633 3300048916 Bacteria 12640
380 Ga0496113_0071989 3300048916 Bacteria 2630
381 Ga0496113_1458624 3300048916 Bacteria 529
382 Ga0496114_0037669 3300048917 Bacteria 4000
383 Ga0496114_0043409 3300048917 Bacteria 3728
384 Ga0496114_0051632 3300048917 Bacteria 3424
385 Ga0496114_0082645 3300048917 Bacteria 2715
386 Ga0496114_0198724 3300048917 Bacteria 1756
387 Ga0496114_0438206 3300048917 Bacteria 1157
388 Ga0496114_0532099 3300048917 Bacteria 1039
389 Ga0496115_0010511 3300048918 Bacteria 6920
390 Ga0496115_0319819 3300048918 Bacteria 1269
391 Ga0501031_0220267 3300049568 Bacteria 1236
392 Ga0501033_0211730 3300049570 Bacteria 1382
393 Ga0501037_0463984 3300049573 Bacteria 863
394 Ga0501038_0919847 3300049574 Bacteria 645
395 Ga0501039_0102318 3300049575 Bacteria 2236
396 Ga0501039_0396033 3300049575 Bacteria 1085
397 Ga0501040_0852680 3300049576 Bacteria 660
398 Ga0501041_0897305 3300049577 Bacteria 569
399 Ga0501042_1247815 3300049578 Bacteria 542
400 Ga0501046_0121120 3300049580 Bacteria 1990
401 Ga0501047_0170117 3300049581 Bacteria 2048
402 Ga0501047_0171790 3300049581 Bacteria 2036
403 Ga0501071_0104085 3300049587 Bacteria 2095
404 Ga0501072_0320554 3300049588 Bacteria 1232
405 Ga0501076_0108032 3300049592 Bacteria 2247
406 Ga0501076_0660764 3300049592 Bacteria 863
407 Ga0501081_0006541 3300049743 Bacteria 7572
408 Ga0501035_0987832 3300049822 Bacteria 662
409 Ga0501044_0152337 3300049823 Bacteria 2294
410 Ga0501044_0476518 3300049823 Bacteria 1152
411 nmdc:mga05p37_17168_c1 3300050507 Bacteria 8732
412 nmdc:mga09592_3_c1 3300050508 Bacteria 144376
413 nmdc:mga09592_62797_c1 3300050508 Bacteria 3143
414 nmdc:mga0qj67_122949_c1 3300050509 Bacteria 2100
415 nmdc:mga0qj67_17_c1 3300050509 Bacteria 121673
416 nmdc:mga06r32_385_c1 3300050510 Bacteria 37158
417 Ga0495619_0186729 3300053085 Bacteria 1435
418 Ga0500594_0052331 3300053118 Bacteria 1154
419 Ga0500600_0047975 3300053149 Bacteria 2433
420 Ga0501084_0512744 3300054114 Bacteria 1014
421 Ga0587117_022067 3300059627 Bacteria 897
422 Ga0587071_095647 3300060344 Bacteria 681
423 Ga0587111_0086077 3300060346 Bacteria 759
424 Ga0466962_0216865 3300061719 Bacteria 936
425 Ga0466962_0378216 3300061719 Bacteria 707
426 Ga0530510_0943133 3300061734 Bacteria 660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0843300 Ga0496104_0843300_24_497 114
2 iso_pu_bacteria 8057568493 8057573641 143
3 3300006844 Ga0075428_100012948 Ga0075428_1000129482 145
4 3300006846 Ga0075430_100000610 Ga0075430_10000061021 145
5 3300006847 Ga0075431_100004541 Ga0075431_10000454110 145
6 3300006880 Ga0075429_100000625 Ga0075429_1000006257 145
7 3300009147 Ga0114129_10001039 Ga0114129_1000103937 145
8 3300028794 Ga0307515_10104813 Ga0307515_101048134 145
9 3300032126 Ga0307415_100186138 Ga0307415_1001861382 145
10 3300050508 nmdc:mga09592_3_c1 nmdc:mga09592_3_c1_56350_56787 145
11 3300050509 nmdc:mga0qj67_17_c1 nmdc:mga0qj67_17_c1_34810_35247 145
12 3300050510 nmdc:mga06r32_385_c1 nmdc:mga06r32_385_c1_19631_20068 145
13 3300002073 JGI24745J21846_1056704 JGI24745J21846_10567041 147
14 3300003792 Ga0055540_1000040 Ga0055540_100004034 147
15 3300004799 Ga0058863_11853458 Ga0058863_118534581 147
16 3300004800 Ga0058861_10044385 Ga0058861_100443852 147
17 3300004801 Ga0058860_12152023 Ga0058860_121520231 147
18 3300004803 Ga0058862_12636588 Ga0058862_126365881 147
19 3300005289 Ga0065704_10574349 Ga0065704_105743491 147
20 3300005329 Ga0070683_100123581 Ga0070683_1001235814 147
21 3300005329 Ga0070683_101700700 Ga0070683_1017007001 147
22 3300005331 Ga0070670_100770318 Ga0070670_1007703182 147
23 3300005336 Ga0070680_100692724 Ga0070680_1006927242 147
24 3300005337 Ga0070682_100332380 Ga0070682_1003323802 147
25 3300005338 Ga0068868_100543992 Ga0068868_1005439922 147
26 3300005338 Ga0068868_101181937 Ga0068868_1011819372 147
27 3300005339 Ga0070660_101109732 Ga0070660_1011097322 147
28 3300005340 Ga0070689_101465720 Ga0070689_1014657201 147
29 3300005341 Ga0070691_10760805 Ga0070691_107608051 147
30 3300005343 Ga0070687_100658279 Ga0070687_1006582792 147
31 3300005343 Ga0070687_100942845 Ga0070687_1009428451 147
32 3300005343 Ga0070687_101075301 Ga0070687_1010753011 147
33 3300005347 Ga0070668_100748686 Ga0070668_1007486862 147
34 3300005355 Ga0070671_100472254 Ga0070671_1004722542 147
35 3300005355 Ga0070671_101262229 Ga0070671_1012622291 147
36 3300005367 Ga0070667_100499374 Ga0070667_1004993742 147
37 3300005367 Ga0070667_101055595 Ga0070667_1010555951 147
38 3300005367 Ga0070667_101204196 Ga0070667_1012041962 147
39 3300005434 Ga0070709_10036990 Ga0070709_100369903 147
40 3300005434 Ga0070709_11785363 Ga0070709_117853631 147
41 3300005435 Ga0070714_100052518 Ga0070714_1000525182 147
42 3300005435 Ga0070714_101384890 Ga0070714_1013848902 147
43 3300005436 Ga0070713_100000475 Ga0070713_10000047510 147
44 3300005437 Ga0070710_10044112 Ga0070710_100441123 147
45 3300005437 Ga0070710_10709446 Ga0070710_107094462 147
46 3300005439 Ga0070711_100124044 Ga0070711_1001240443 147
47 3300005439 Ga0070711_101679473 Ga0070711_1016794731 147
48 3300005441 Ga0070700_100334119 Ga0070700_1003341192 147
49 3300005455 Ga0070663_100498758 Ga0070663_1004987582 147
50 3300005456 Ga0070678_100161306 Ga0070678_1001613063 147
51 3300005456 Ga0070678_100190062 Ga0070678_1001900624 147
52 3300005456 Ga0070678_100792651 Ga0070678_1007926512 147
53 3300005458 Ga0070681_10969178 Ga0070681_109691781 147
54 3300005466 Ga0070685_10341186 Ga0070685_103411862 147
55 3300005471 Ga0070698_100323026 Ga0070698_1003230263 147
56 3300005471 Ga0070698_101535714 Ga0070698_1015357141 147
57 3300005518 Ga0070699_100877898 Ga0070699_1008778982 147
58 3300005539 Ga0068853_100405750 Ga0068853_1004057502 147
59 3300005548 Ga0070665_100050470 Ga0070665_1000504702 147
60 3300005548 Ga0070665_100721102 Ga0070665_1007211021 147
61 3300005548 Ga0070665_100930418 Ga0070665_1009304182 147
62 3300005548 Ga0070665_101269127 Ga0070665_1012691272 147
63 3300005549 Ga0070704_101112275 Ga0070704_1011122751 147
64 3300005564 Ga0070664_100526023 Ga0070664_1005260232 147
65 3300005577 Ga0068857_100433460 Ga0068857_1004334602 147
66 3300005577 Ga0068857_100463817 Ga0068857_1004638172 147
67 3300005578 Ga0068854_100604184 Ga0068854_1006041842 147
68 3300005614 Ga0068856_100179512 Ga0068856_1001795122 147
69 3300005614 Ga0068856_101734130 Ga0068856_1017341301 147
70 3300005617 Ga0068859_100556048 Ga0068859_1005560482 147
71 3300005617 Ga0068859_102102881 Ga0068859_1021028812 147
72 3300005718 Ga0068866_10176385 Ga0068866_101763852 147
73 3300005719 Ga0068861_100291853 Ga0068861_1002918533 147
74 3300005719 Ga0068861_101861880 Ga0068861_1018618801 147
75 3300005834 Ga0068851_10567240 Ga0068851_105672401 147
76 3300005840 Ga0068870_10285940 Ga0068870_102859402 147
77 3300005843 Ga0068860_100065611 Ga0068860_1000656113 147
78 3300005843 Ga0068860_100567392 Ga0068860_1005673922 147
79 3300005844 Ga0068862_100261979 Ga0068862_1002619791 147
80 3300005844 Ga0068862_101751548 Ga0068862_1017515481 147
81 3300005937 Ga0081455_10243526 Ga0081455_102435262 147
82 3300005985 Ga0081539_10003971 Ga0081539_100039713 147
83 3300005985 Ga0081539_10054146 Ga0081539_100541462 147
84 3300006028 Ga0070717_10000745 Ga0070717_100007456 147
85 3300006173 Ga0070716_100072993 Ga0070716_1000729932 147
86 3300006173 Ga0070716_100428301 Ga0070716_1004283012 147
87 3300006844 Ga0075428_100143018 Ga0075428_1001430184 147
88 3300006844 Ga0075428_101258881 Ga0075428_1012588811 147
89 3300006844 Ga0075428_101430352 Ga0075428_1014303522 147
90 3300006846 Ga0075430_100090647 Ga0075430_1000906472 147
91 3300006846 Ga0075430_101065732 Ga0075430_1010657321 147
92 3300006847 Ga0075431_100034014 Ga0075431_1000340144 147
93 3300006880 Ga0075429_100010342 Ga0075429_1000103422 147
94 3300006881 Ga0068865_101431494 Ga0068865_1014314941 147
95 3300006914 Ga0075436_100743920 Ga0075436_1007439202 147
96 3300006931 Ga0097620_100556093 Ga0097620_1005560932 147
97 3300006931 Ga0097620_102102889 Ga0097620_1021028892 147
98 3300009011 Ga0105251_10265820 Ga0105251_102658202 147
99 3300009094 Ga0111539_12056380 Ga0111539_120563802 147
100 3300009098 Ga0105245_10119140 Ga0105245_101191402 147
101 3300009098 Ga0105245_10217527 Ga0105245_102175272 147
102 3300009098 Ga0105245_10799535 Ga0105245_107995352 147
103 3300009147 Ga0114129_10083062 Ga0114129_100830624 147
104 3300009148 Ga0105243_10300069 Ga0105243_103000692 147
105 3300009148 Ga0105243_11217931 Ga0105243_112179311 147
106 3300009174 Ga0105241_10405911 Ga0105241_104059112 147
107 3300009174 Ga0105241_10640487 Ga0105241_106404871 147
108 3300009176 Ga0105242_10656598 Ga0105242_106565981 147
109 3300009176 Ga0105242_10781667 Ga0105242_107816672 147
110 3300009545 Ga0105237_10008877 Ga0105237_100088778 147
111 3300009545 Ga0105237_10558656 Ga0105237_105586562 147
112 3300009551 Ga0105238_10632927 Ga0105238_106329272 147
113 3300009551 Ga0105238_10796615 Ga0105238_107966152 147
114 3300009551 Ga0105238_10798534 Ga0105238_107985342 147
115 3300009551 Ga0105238_11507175 Ga0105238_115071752 147
116 3300009551 Ga0105238_11537000 Ga0105238_115370001 147
117 3300009551 Ga0105238_12097493 Ga0105238_120974931 147
118 3300009553 Ga0105249_10377472 Ga0105249_103774722 147
119 3300009553 Ga0105249_10435317 Ga0105249_104353172 147
120 3300009553 Ga0105249_12333185 Ga0105249_123331851 147
121 3300010375 Ga0105239_10001323 Ga0105239_100013234 147
122 3300010375 Ga0105239_10460617 Ga0105239_104606173 147
123 3300010375 Ga0105239_11588158 Ga0105239_115881582 147
124 3300011119 Ga0105246_10106861 Ga0105246_101068612 147
125 3300011119 Ga0105246_10982466 Ga0105246_109824662 147
126 3300011119 Ga0105246_11332107 Ga0105246_113321071 147
127 3300013102 Ga0157371_10207253 Ga0157371_102072532 147
128 3300013102 Ga0157371_10776233 Ga0157371_107762332 147
129 3300013105 Ga0157369_10013067 Ga0157369_100130675 147
130 3300013296 Ga0157374_10826094 Ga0157374_108260942 147
131 3300013296 Ga0157374_10861307 Ga0157374_108613072 147
132 3300013296 Ga0157374_10913902 Ga0157374_109139022 147
133 3300013296 Ga0157374_11479374 Ga0157374_114793741 147
134 3300013296 Ga0157374_12713816 Ga0157374_127138161 147
135 3300013297 Ga0157378_10504013 Ga0157378_105040132 147
136 3300013306 Ga0163162_10595715 Ga0163162_105957151 147
137 3300013306 Ga0163162_10638153 Ga0163162_106381532 147
138 3300013307 Ga0157372_10064996 Ga0157372_100649962 147
139 3300013307 Ga0157372_10445228 Ga0157372_104452282 147
140 3300013307 Ga0157372_11631778 Ga0157372_116317782 147
141 3300013307 Ga0157372_12747392 Ga0157372_127473921 147
142 3300013308 Ga0157375_10229013 Ga0157375_102290134 147
143 3300013308 Ga0157375_10759853 Ga0157375_107598532 147
144 3300013308 Ga0157375_11001232 Ga0157375_110012322 147
145 3300014325 Ga0163163_10840283 Ga0163163_108402832 147
146 3300014325 Ga0163163_11222220 Ga0163163_112222202 147
147 3300014325 Ga0163163_11774060 Ga0163163_117740601 147
148 3300014325 Ga0163163_12713308 Ga0163163_127133081 147
149 3300014326 Ga0157380_10154408 Ga0157380_101544084 147
150 3300014745 Ga0157377_10376827 Ga0157377_103768272 147
151 3300014969 Ga0157376_10360980 Ga0157376_103609802 147
152 3300014969 Ga0157376_10461783 Ga0157376_104617832 147
153 3300020078 Ga0206352_11320934 Ga0206352_113209342 147
154 3300020082 Ga0206353_10532936 Ga0206353_105329361 147
155 3300020082 Ga0206353_11486661 Ga0206353_114866611 147
156 3300023309 Ga0256744_151277 Ga0256744_1512771 147
157 3300025303 Ga0209051_1000107 Ga0209051_100010734 147
158 3300025898 Ga0207692_10218476 Ga0207692_102184762 147
159 3300025899 Ga0207642_10146985 Ga0207642_101469852 147
160 3300025901 Ga0207688_10047401 Ga0207688_100474012 147
161 3300025901 Ga0207688_10073463 Ga0207688_100734633 147
162 3300025901 Ga0207688_10279676 Ga0207688_102796762 147
163 3300025901 Ga0207688_10454016 Ga0207688_104540162 147
164 3300025901 Ga0207688_10590880 Ga0207688_105908802 147
165 3300025904 Ga0207647_10806237 Ga0207647_108062371 147
166 3300025906 Ga0207699_10131233 Ga0207699_101312332 147
167 3300025908 Ga0207643_10123204 Ga0207643_101232044 147
168 3300025909 Ga0207705_10378267 Ga0207705_103782672 147
169 3300025911 Ga0207654_10233057 Ga0207654_102330572 147
170 3300025912 Ga0207707_10435695 Ga0207707_104356952 147
171 3300025914 Ga0207671_10004373 Ga0207671_1000437311 147
172 3300025914 Ga0207671_10646944 Ga0207671_106469442 147
173 3300025915 Ga0207693_10218663 Ga0207693_102186632 147
174 3300025916 Ga0207663_11086208 Ga0207663_110862082 147
175 3300025918 Ga0207662_10308163 Ga0207662_103081632 147
176 3300025918 Ga0207662_10836020 Ga0207662_108360201 147
177 3300025919 Ga0207657_10721103 Ga0207657_107211032 147
178 3300025921 Ga0207652_10863181 Ga0207652_108631811 147
179 3300025923 Ga0207681_11105825 Ga0207681_111058251 147
180 3300025924 Ga0207694_10610969 Ga0207694_106109692 147
181 3300025924 Ga0207694_10749165 Ga0207694_107491652 147
182 3300025924 Ga0207694_10760707 Ga0207694_107607072 147
183 3300025926 Ga0207659_10236748 Ga0207659_102367482 147
184 3300025927 Ga0207687_10034347 Ga0207687_100343474 147
185 3300025928 Ga0207700_10000446 Ga0207700_100004469 147
186 3300025929 Ga0207664_10042477 Ga0207664_100424773 147
187 3300025929 Ga0207664_10081482 Ga0207664_100814823 147
188 3300025932 Ga0207690_10302252 Ga0207690_103022522 147
189 3300025933 Ga0207706_10995173 Ga0207706_109951732 147
190 3300025933 Ga0207706_11124816 Ga0207706_111248161 147
191 3300025934 Ga0207686_10306894 Ga0207686_103068942 147
192 3300025935 Ga0207709_10457519 Ga0207709_104575192 147
193 3300025936 Ga0207670_10104643 Ga0207670_101046432 147
194 3300025938 Ga0207704_10912722 Ga0207704_109127222 147
195 3300025939 Ga0207665_10454080 Ga0207665_104540802 147
196 3300025942 Ga0207689_10530500 Ga0207689_105305002 147
197 3300025944 Ga0207661_11526044 Ga0207661_115260442 147
198 3300025944 Ga0207661_11758396 Ga0207661_117583961 147
199 3300025945 Ga0207679_10292410 Ga0207679_102924102 147
200 3300025945 Ga0207679_10410877 Ga0207679_104108772 147
201 3300025945 Ga0207679_10918676 Ga0207679_109186762 147
202 3300025961 Ga0207712_10116627 Ga0207712_101166272 147
203 3300025972 Ga0207668_10144132 Ga0207668_101441324 147
204 3300025972 Ga0207668_10414725 Ga0207668_104147252 147
205 3300025981 Ga0207640_10399614 Ga0207640_103996142 147
206 3300025981 Ga0207640_11127421 Ga0207640_111274211 147
207 3300025986 Ga0207658_10154669 Ga0207658_101546692 147
208 3300025986 Ga0207658_10884894 Ga0207658_108848942 147
209 3300026023 Ga0207677_10263587 Ga0207677_102635872 147
210 3300026023 Ga0207677_10364428 Ga0207677_103644282 147
211 3300026023 Ga0207677_11509030 Ga0207677_115090301 147
212 3300026035 Ga0207703_10471042 Ga0207703_104710422 147
213 3300026035 Ga0207703_10486808 Ga0207703_104868082 147
214 3300026035 Ga0207703_10936553 Ga0207703_109365532 147
215 3300026041 Ga0207639_10618807 Ga0207639_106188072 147
216 3300026041 Ga0207639_11170262 Ga0207639_111702622 147
217 3300026067 Ga0207678_10000016 Ga0207678_10000016101 147
218 3300026067 Ga0207678_10277271 Ga0207678_102772711 147
219 3300026067 Ga0207678_10327763 Ga0207678_103277631 147
220 3300026075 Ga0207708_10807387 Ga0207708_108073872 147
221 3300026078 Ga0207702_10009493 Ga0207702_100094933 147
222 3300026088 Ga0207641_10571947 Ga0207641_105719472 147
223 3300026089 Ga0207648_10200086 Ga0207648_102000863 147
224 3300026116 Ga0207674_10120643 Ga0207674_101206434 147
225 3300026116 Ga0207674_10182839 Ga0207674_101828392 147
226 3300026118 Ga0207675_100385033 Ga0207675_1003850332 147
227 3300026121 Ga0207683_10023981 Ga0207683_100239815 147
228 3300026121 Ga0207683_10100681 Ga0207683_101006812 147
229 3300026121 Ga0207683_10180774 Ga0207683_101807744 147
230 3300026121 Ga0207683_10203786 Ga0207683_102037862 147
231 3300026121 Ga0207683_10327873 Ga0207683_103278732 147
232 3300026121 Ga0207683_10429433 Ga0207683_104294332 147
233 3300026142 Ga0207698_11272017 Ga0207698_112720171 147
234 3300027907 Ga0207428_10289295 Ga0207428_102892952 147
235 3300028379 Ga0268266_10052958 Ga0268266_100529584 147
236 3300028379 Ga0268266_10306040 Ga0268266_103060402 147
237 3300028379 Ga0268266_10632922 Ga0268266_106329222 147
238 3300028380 Ga0268265_10680309 Ga0268265_106803092 147
239 3300028380 Ga0268265_11437618 Ga0268265_114376182 147
240 3300028381 Ga0268264_10049726 Ga0268264_100497264 147
241 3300028381 Ga0268264_10899401 Ga0268264_108994012 147
242 3300028573 Ga0265334_10002552 Ga0265334_100025522 147
243 3300028786 Ga0307517_10323012 Ga0307517_103230122 147
244 3300029285 Ga0310981_1067785 Ga0310981_10677851 147
245 3300030731 Ga0316177_1106628 Ga0316177_11066282 147
246 3300030732 Ga0316176_1051874 Ga0316176_10518742 147
247 3300030733 Ga0314311_1173716 Ga0314311_11737163 147
248 3300030745 Ga0316182_1391121 Ga0316182_13911212 147
249 3300031456 Ga0307513_10000149 Ga0307513_1000014993 147
250 3300031616 Ga0307508_10196742 Ga0307508_101967422 147
251 3300031691 Ga0316579_10000503 Ga0316579_100005039 147
252 3300031727 Ga0316576_10047030 Ga0316576_100470304 147
253 3300031727 Ga0316576_10291737 Ga0316576_102917373 147
254 3300031728 Ga0316578_10035303 Ga0316578_100353032 147
255 3300031824 Ga0307413_10100183 Ga0307413_101001832 147
256 3300031838 Ga0307518_10007724 Ga0307518_100077245 147
257 3300031889 Ga0326468_10040577 Ga0326468_100405771 147
258 3300031903 Ga0307407_10109811 Ga0307407_101098112 147
259 3300031995 Ga0307409_100772003 Ga0307409_1007720032 147
260 3300032002 Ga0307416_100225769 Ga0307416_1002257692 147
261 3300032002 Ga0307416_100315785 Ga0307416_1003157852 147
262 3300032002 Ga0307416_102727843 Ga0307416_1027278431 147
263 3300032005 Ga0307411_10172868 Ga0307411_101728684 147
264 3300032126 Ga0307415_100305212 Ga0307415_1003052122 147
265 3300032126 Ga0307415_100501982 Ga0307415_1005019822 147
266 3300032126 Ga0307415_100975090 Ga0307415_1009750901 147
267 3300032139 Ga0316580_10120904 Ga0316580_101209042 147
268 3300033179 Ga0307507_10028815 Ga0307507_100288153 147
269 3300033180 Ga0307510_10070319 Ga0307510_100703192 147
270 3300033524 Ga0316592_1147962 Ga0316592_11479621 147
271 3300033528 Ga0316588_1063374 Ga0316588_10633742 147
272 3300035398 Ga0316574_0061208 Ga0316574_0061208_522_968 147
273 3300035691 Ga0373931_0412934 Ga0373931_0412934_75_527 147
274 3300036647 Ga0316582_0094742 Ga0316582_0094742_558_1004 147
275 3300036712 Ga0316584_0026771 Ga0316584_0026771_819_1265 147
276 3300039450 Ga0436363_0228580 Ga0436363_0228580_1871_2314 147
277 3300041441 Ga0451787_400004 Ga0451787_400004_92_538 147
278 3300041443 Ga0451789_0039271 Ga0451789_0039271_17_460 147
279 3300041443 Ga0451789_0366450 Ga0451789_0366450_1390_1833 147
280 3300041451 Ga0451791_0010454 Ga0451791_0010454_2113_2556 147
281 3300041451 Ga0451791_0127960 Ga0451791_0127960_196_639 147
282 3300041451 Ga0451791_0691843 Ga0451791_0691843_60_503 147
283 3300041452 Ga0451793_0438330 Ga0451793_0438330_834_1277 147
284 3300041452 Ga0451793_1929778 Ga0451793_1929778_528_971 147
285 3300041453 Ga0451797_0180635 Ga0451797_0180635_45_488 147
286 3300041458 Ga0451798_0786738 Ga0451798_0786738_444_887 147
287 3300041458 Ga0451798_0817801 Ga0451798_0817801_112_684 147
288 3300041459 Ga0451800_1194654 Ga0451800_1194654_286_729 147
289 3300041460 Ga0451802_0809031 Ga0451802_0809031_36_482 147
290 3300041463 Ga0451804_0134178 Ga0451804_0134178_79_522 147
291 3300041491 Ga0451833_1072790 Ga0451833_1072790_490_933 147
292 3300041491 Ga0451833_1101133 Ga0451833_1101133_56_499 147
293 3300041494 Ga0451837_0413780 Ga0451837_0413780_526_969 147
294 3300041496 Ga0451839_0374069 Ga0451839_0374069_442_981 147
295 3300041498 Ga0451841_0692692 Ga0451841_0692692_168_611 147
296 3300041503 Ga0451847_0936001 Ga0451847_0936001_630_1073 147
297 3300041509 Ga0451843_0391734 Ga0451843_0391734_1177_1620 147
298 3300041509 Ga0451843_0566890 Ga0451843_0566890_979_1422 147
299 3300041509 Ga0451843_1065433 Ga0451843_1065433_248_691 147
300 3300041511 Ga0451855_0652150 Ga0451855_0652150_82_525 147
301 3300041512 Ga0451853_3391179 Ga0451853_3391179_1269_1712 147
302 3300042007 Ga0439449_0001436 Ga0439449_0001436_6737_7180 147
303 3300042993 Ga0439440_0008326 Ga0439440_0008326_916_1359 147
304 3300044656 Ga0466969_0069017 Ga0466969_0069017_1076_1519 147
305 3300044658 Ga0466972_0002049 Ga0466972_0002049_3396_3839 147
306 3300044658 Ga0466972_0010317 Ga0466972_0010317_2444_2887 147
307 3300044683 Ga0466965_0017209 Ga0466965_0017209_1494_1937 147
308 3300044694 Ga0466963_0108380 Ga0466963_0108380_1249_1692 147
309 3300044706 Ga0466964_0519929 Ga0466964_0519929_105_548 147
310 3300044719 Ga0466971_0108629 Ga0466971_0108629_87_530 147
311 3300044735 Ga0466968_0002974 Ga0466968_0002974_3946_4389 147
312 3300044735 Ga0466968_0038955 Ga0466968_0038955_1045_1488 147
313 3300044765 Ga0466970_0112232 Ga0466970_0112232_328_771 147
314 3300044842 Ga0466957_0042114 Ga0466957_0042114_234_677 147
315 3300044901 Ga0466960_0020170 Ga0466960_0020170_1276_1719 147
316 3300044901 Ga0466960_0275788 Ga0466960_0275788_335_778 147
317 3300045049 Ga0466959_0132645 Ga0466959_0132645_14_457 147
318 3300045049 Ga0466959_1050032 Ga0466959_1050032_69_512 147
319 3300045836 Ga0466958_0067370 Ga0466958_0067370_628_1071 147
320 3300045836 Ga0466958_0139963 Ga0466958_0139963_284_727 147
321 3300045976 Ga0466967_0168172 Ga0466967_0168172_859_1302 147
322 3300045976 Ga0466967_0253756 Ga0466967_0253756_669_1112 147
323 3300045976 Ga0466967_0402622 Ga0466967_0402622_633_1076 147
324 3300045976 Ga0466967_0456823 Ga0466967_0456823_613_1062 147
325 3300045976 Ga0466967_0562183 Ga0466967_0562183_571_1017 147
326 3300045976 Ga0466967_1159527 Ga0466967_1159527_271_714 147
327 3300046455 Ga0495603_0335328 Ga0495603_0335328_55_507 147
328 3300046455 Ga0495603_0731902 Ga0495603_0731902_44_487 147
329 3300046459 Ga0495629_0707012 Ga0495629_0707012_101_544 147
330 3300046461 Ga0495641_0032021 Ga0495641_0032021_1602_2045 147
331 3300046463 Ga0495653_0144959 Ga0495653_0144959_97_549 147
332 3300046463 Ga0495653_0897233 Ga0495653_0897233_33_485 147
333 3300046475 Ga0495639_0404371 Ga0495639_0404371_172_624 147
334 3300046476 Ga0495662_0112632 Ga0495662_0112632_785_1237 147
335 3300046477 Ga0495664_0165307 Ga0495664_0165307_342_794 147
336 3300046492 Ga0495585_0044523 Ga0495585_0044523_1122_1565 147
337 3300046511 Ga0495608_0395916 Ga0495608_0395916_74_526 147
338 3300046531 Ga0495665_0185913 Ga0495665_0185913_476_928 147
339 3300046531 Ga0495665_0328370 Ga0495665_0328370_219_671 147
340 3300046531 Ga0495665_0341351 Ga0495665_0341351_297_740 147
341 3300046533 Ga0495640_0045821 Ga0495640_0045821_605_1048 147
342 3300046535 Ga0495586_0404429 Ga0495586_0404429_275_727 147
343 3300046543 Ga0495645_0592236 Ga0495645_0592236_26_469 147
344 3300046559 Ga0495667_0092609 Ga0495667_0092609_888_1340 147
345 3300046674 Ga0495588_0074418 Ga0495588_0074418_1174_1626 147
346 3300046675 Ga0495657_0291430 Ga0495657_0291430_335_787 147
347 3300046675 Ga0495657_0576748 Ga0495657_0576748_100_543 147
348 3300046680 Ga0495646_0100676 Ga0495646_0100676_924_1367 147
349 3300046683 Ga0495658_0406051 Ga0495658_0406051_297_749 147
350 3300046809 Ga0495600_0540695 Ga0495600_0540695_216_668 147
351 3300047317 Ga0495604_0046984 Ga0495604_0046984_322_765 147
352 3300047673 Ga0495593_0200150 Ga0495593_0200150_225_677 147
353 3300048088 Ga0495602_0064169 Ga0495602_0064169_2161_2613 147
354 3300048089 Ga0495614_0469563 Ga0495614_0469563_92_544 147
355 3300048903 Ga0496100_0054286 Ga0496100_0054286_2134_2577 147
356 3300048903 Ga0496100_0674299 Ga0496100_0674299_162_605 147
357 3300048904 Ga0496101_0185214 Ga0496101_0185214_608_1060 147
358 3300048904 Ga0496101_0902718 Ga0496101_0902718_89_532 147
359 3300048905 Ga0496102_0148117 Ga0496102_0148117_1366_1809 147
360 3300048905 Ga0496102_0223307 Ga0496102_0223307_80_523 147
361 3300048905 Ga0496102_0308263 Ga0496102_0308263_984_1430 147
362 3300048905 Ga0496102_0578911 Ga0496102_0578911_244_687 147
363 3300048907 Ga0496104_0023165 Ga0496104_0023165_2962_3414 147
364 3300048908 Ga0496105_0107953 Ga0496105_0107953_1560_2012 147
365 3300048908 Ga0496105_0153544 Ga0496105_0153544_148_591 147
366 3300048908 Ga0496105_0253740 Ga0496105_0253740_106_549 147
367 3300048908 Ga0496105_0467256 Ga0496105_0467256_11_454 147
368 3300048908 Ga0496105_0959391 Ga0496105_0959391_151_594 147
369 3300048909 Ga0496106_0290917 Ga0496106_0290917_533_976 147
370 3300048910 Ga0496107_0428607 Ga0496107_0428607_456_899 147
371 3300048911 Ga0496108_0000921 Ga0496108_0000921_7419_7862 147
372 3300048911 Ga0496108_0003660 Ga0496108_0003660_8228_8680 147
373 3300048912 Ga0496109_0004457 Ga0496109_0004457_4978_5421 147
374 3300048912 Ga0496109_0005941 Ga0496109_0005941_3090_3542 147
375 3300048912 Ga0496109_0354377 Ga0496109_0354377_372_815 147
376 3300048913 Ga0496110_0007423 Ga0496110_0007423_3626_4078 147
377 3300048913 Ga0496110_0186742 Ga0496110_0186742_684_1127 147
378 3300048914 Ga0496111_0008191 Ga0496111_0008191_4923_5375 147
379 3300048914 Ga0496111_0163623 Ga0496111_0163623_438_881 147
380 3300048914 Ga0496111_0849259 Ga0496111_0849259_152_595 147
381 3300048915 Ga0496112_0005346 Ga0496112_0005346_2747_3190 147
382 3300048915 Ga0496112_0459072 Ga0496112_0459072_233_685 147
383 3300048916 Ga0496113_0001633 Ga0496113_0001633_7932_8375 147
384 3300048916 Ga0496113_0071989 Ga0496113_0071989_944_1396 147
385 3300048916 Ga0496113_1458624 Ga0496113_1458624_40_492 147
386 3300048917 Ga0496114_0037669 Ga0496114_0037669_40_483 147
387 3300048917 Ga0496114_0043409 Ga0496114_0043409_3262_3705 147
388 3300048917 Ga0496114_0051632 Ga0496114_0051632_1751_2194 147
389 3300048917 Ga0496114_0082645 Ga0496114_0082645_909_1352 147
390 3300048917 Ga0496114_0198724 Ga0496114_0198724_390_842 147
391 3300048917 Ga0496114_0438206 Ga0496114_0438206_618_1070 147
392 3300048917 Ga0496114_0532099 Ga0496114_0532099_342_785 147
393 3300048918 Ga0496115_0010511 Ga0496115_0010511_3234_3677 147
394 3300048918 Ga0496115_0319819 Ga0496115_0319819_754_1206 147
395 3300049568 Ga0501031_0220267 Ga0501031_0220267_745_1188 147
396 3300049570 Ga0501033_0211730 Ga0501033_0211730_561_1004 147
397 3300049573 Ga0501037_0463984 Ga0501037_0463984_390_833 147
398 3300049574 Ga0501038_0919847 Ga0501038_0919847_101_547 147
399 3300049575 Ga0501039_0102318 Ga0501039_0102318_20_463 147
400 3300049575 Ga0501039_0396033 Ga0501039_0396033_83_526 147
401 3300049576 Ga0501040_0852680 Ga0501040_0852680_78_521 147
402 3300049577 Ga0501041_0897305 Ga0501041_0897305_14_457 147
403 3300049578 Ga0501042_1247815 Ga0501042_1247815_30_473 147
404 3300049580 Ga0501046_0121120 Ga0501046_0121120_258_701 147
405 3300049581 Ga0501047_0170117 Ga0501047_0170117_96_539 147
406 3300049581 Ga0501047_0171790 Ga0501047_0171790_77_520 147
407 3300049587 Ga0501071_0104085 Ga0501071_0104085_519_962 147
408 3300049588 Ga0501072_0320554 Ga0501072_0320554_655_1098 147
409 3300049592 Ga0501076_0108032 Ga0501076_0108032_837_1280 147
410 3300049592 Ga0501076_0660764 Ga0501076_0660764_378_821 147
411 3300049743 Ga0501081_0006541 Ga0501081_0006541_6041_6484 147
412 3300049822 Ga0501035_0987832 Ga0501035_0987832_130_573 147
413 3300049823 Ga0501044_0152337 Ga0501044_0152337_1760_2203 147
414 3300049823 Ga0501044_0476518 Ga0501044_0476518_689_1132 147
415 3300050507 nmdc:mga05p37_17168_c1 nmdc:mga05p37_17168_c1_4274_4717 147
416 3300050508 nmdc:mga09592_62797_c1 nmdc:mga09592_62797_c1_1355_1798 147
417 3300050509 nmdc:mga0qj67_122949_c1 nmdc:mga0qj67_122949_c1_10_453 147
418 3300053085 Ga0495619_0186729 Ga0495619_0186729_716_1168 147
419 3300053118 Ga0500594_0052331 Ga0500594_0052331_538_981 147
420 3300053149 Ga0500600_0047975 Ga0500600_0047975_1059_1502 147
421 3300054114 Ga0501084_0512744 Ga0501084_0512744_374_817 147
422 3300059627 Ga0587117_022067 Ga0587117_022067_15_461 147
423 3300060344 Ga0587071_095647 Ga0587071_095647_57_500 147
424 3300060346 Ga0587111_0086077 Ga0587111_0086077_306_749 147
425 3300061719 Ga0466962_0216865 Ga0466962_0216865_119_562 147
426 3300061719 Ga0466962_0378216 Ga0466962_0378216_225_668 147
427 3300061734 Ga0530510_0943133 Ga0530510_0943133_201_644 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

156

179

0.96

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

10

142

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1udv-assembly1.cif.gz_A crystal structure of the hyperthermophilic archaeal dna-binding protein sso10b2 at 1.85 a 0.8003 114 142
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.7862 13 146
6j0b-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state 0.7861 13 146
7adz-assembly1.cif.gz_1a cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.7648 13 146
7b5h-assembly1.cif.gz_AN cryo-em structure of the contractile injection system base plate from anabaena pcc7120 0.7322 1 146
ID Description Score Start End Superfamily
af_Q8IJX8_12_107_3.30.110.20 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.8484 114 141 3.30.110.20
2bkyY00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.8251 114 142 3.30.110.20
2ex3K05 Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;DNA polymerase; domain 5 0.7378 35 59 4.10.80.20
3qauA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hydroxymethylglutaryl-CoA reductase, class I/II, NAD/NADP-binding domain 0.7371 114 138 3.30.70.420
af_Q4CW22_11_117_3.30.110.20 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.7036 114 142 3.30.110.20
ID Description Score Start End GO Terms
AF-A0A352X8L7-F1-model_v4 Phage tail protein 0.8943 62 146 GO:0005198
AF-A0A3M1E306-F1-model_v4 Phage tail protein 0.8926 64 146 GO:0005198
AF-A0A6L4AAF0-F1-model_v4 Phage tail protein 0.8919 54 146 GO:0005198
AF-A0A5M3Y8P0-F1-model_v4 deleted 0.8896 62 146
AF-A0A4Q3J232-F1-model_v4 Phage tail protein 0.8822 59 146 GO:0005198

Feature Viewer

pLDDT pTM Quality
84.82 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map