F441472

General Info

Members Datasets Scaffolds Average Seq Length
427 220 854 268

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10146243|Ga0307517_101462431
Length 293
Sequence VNLPAPASAGRAANADRAAVPVRRAAGLSCRITVQEQHLPGESLEEKFAWAQQAGFDGIELRGKGDLGLAARLPELRRAAAAGVVMPTVCPEMAHFIGSFDADLRADAIRNMKSQLSVMAEIGGRGVMSPASWGMFSLRLPPFVPPRPAAEDRRVLLEALHELGRHAEREGVEFYLEPLNRYEDHMVNRLAEAAELCAASGSRAVRVVADTYHMNIEEADPAAALRDIAGRLGHVQVSDSNRLEPGAGHVDWGAHFRALAEIGYTGDLAVECRLSGPPTEVLPAAAAALRAAL

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
110 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
111 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
115 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
116 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
117 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
118 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
124 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
125 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2501939600 Micromonospora sp. L5 Isolate Unclassified
199 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
200 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
201 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
202 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
203 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
204 2808606448 Streptomyces sp. 193411 Isolate Unclassified
205 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
206 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
207 2857472729 Cohnella sp. R-74144 Isolate Unclassified
208 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
209 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
210 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
211 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
212 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
213 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
214 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
215 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
216 649633069 Micromonospora sp. L5 Isolate Unclassified
217 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
218 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
219 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
220 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.91
Metatranscriptomes 0.7
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0.23
Rhizoplane 2.58
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10146243 3300028786 Bacteria 1639
2 JGI25406J46586_10011883 3300003203 Bacteria 3800
3 JGI25406J46586_10012290 3300003203 Bacteria 3723
4 JGI25406J46586_10022448 3300003203 Bacteria 2514
5 JGI25406J46586_10057840 3300003203 Bacteria 1266
6 rootH2_10004490 3300003320 Bacteria 4461
7 JGI25407J50210_10002442 3300003373 Bacteria 4372
8 JGI25407J50210_10003027 3300003373 Bacteria 4016
9 Ga0070658_10039538 3300005327 Bacteria 3805
10 Ga0070658_10040696 3300005327 Bacteria 3750
11 Ga0070658_10168116 3300005327 Bacteria 1842
12 Ga0070683_100180303 3300005329 Bacteria 2005
13 Ga0070683_100310726 3300005329 Bacteria 1500
14 Ga0070682_100317905 3300005337 Bacteria 1149
15 Ga0070668_100001876 3300005347 Bacteria 15355
16 Ga0070668_100102757 3300005347 Bacteria 2266
17 Ga0070674_100397556 3300005356 Bacteria 1125
18 Ga0070659_100116738 3300005366 Bacteria 2158
19 Ga0070662_100004121 3300005457 Bacteria 9139
20 Ga0070685_10001363 3300005466 Bacteria 12822
21 Ga0070679_100685532 3300005530 Bacteria 967
22 Ga0070684_100048224 3300005535 Bacteria 3695
23 Ga0070684_100392972 3300005535 Bacteria 1278
24 Ga0070665_100129639 3300005548 Bacteria 2524
25 Ga0068855_100428951 3300005563 Unclassified 1445
26 Ga0068854_100362287 3300005578 Bacteria 1190
27 Ga0068852_100616277 3300005616 Bacteria 1091
28 Ga0068852_100617069 3300005616 Bacteria 1090
29 Ga0068864_100236799 3300005618 Bacteria 1690
30 Ga0068861_100156845 3300005719 Bacteria 1873
31 Ga0068862_100327814 3300005844 Bacteria 1415
32 Ga0068862_100481204 3300005844 Bacteria 1175
33 Ga0081455_10095629 3300005937 Bacteria 2397
34 Ga0081538_10000209 3300005981 Bacteria 65166
35 Ga0081538_10000790 3300005981 Bacteria 34416
36 Ga0081538_10003929 3300005981 Bacteria 13857
37 Ga0081538_10006930 3300005981 Bacteria 9858
38 Ga0081538_10012081 3300005981 Bacteria 6948
39 Ga0081538_10017855 3300005981 Bacteria 5361
40 Ga0081538_10018835 3300005981 Bacteria 5163
41 Ga0081538_10025127 3300005981 Bacteria 4214
42 Ga0081538_10042518 3300005981 Bacteria 2866
43 Ga0081539_10000822 3300005985 Bacteria 59996
44 Ga0081539_10001890 3300005985 Bacteria 32490
45 Ga0081539_10002337 3300005985 Bacteria 27268
46 Ga0081539_10004083 3300005985 Bacteria 16686
47 Ga0081539_10004279 3300005985 Bacteria 16013
48 Ga0081539_10004973 3300005985 Bacteria 14088
49 Ga0081539_10022317 3300005985 Bacteria 4193
50 Ga0075428_100014274 3300006844 Bacteria 8835
51 Ga0075430_100007624 3300006846 Bacteria 9144
52 Ga0075430_100096702 3300006846 Bacteria 2468
53 Ga0075431_100068872 3300006847 Bacteria 3651
54 Ga0075431_100125770 3300006847 Bacteria 2645
55 Ga0075431_100159649 3300006847 Bacteria 2318
56 Ga0075431_100298435 3300006847 Bacteria 1628
57 Ga0075433_10000840 3300006852 Bacteria 21519
58 Ga0075434_100003609 3300006871 Bacteria 13811
59 Ga0075429_100008059 3300006880 Bacteria 9159
60 Ga0075435_100000883 3300007076 Bacteria 18829
61 Ga0111539_10023932 3300009094 Bacteria 7504
62 Ga0111539_10341336 3300009094 Bacteria 1743
63 Ga0111539_10381022 3300009094 Bacteria 1642
64 Ga0111539_10987048 3300009094 Bacteria 979
65 Ga0111539_11086048 3300009094 Bacteria 930
66 Ga0114129_10001721 3300009147 Bacteria 29853
67 Ga0114129_10088362 3300009147 Bacteria 4296
68 Ga0114129_10123000 3300009147 Bacteria 3570
69 Ga0114129_10167561 3300009147 Bacteria 2997
70 Ga0105243_10301332 3300009148 Bacteria 1453
71 Ga0105238_10151304 3300009551 Bacteria 2296
72 Ga0105249_10004946 3300009553 Bacteria 11501
73 Ga0105249_10103303 3300009553 Bacteria 2684
74 Ga0105249_10714435 3300009553 Bacteria 1063
75 Ga0105239_10230044 3300010375 Bacteria 2080
76 Ga0105246_10311068 3300011119 Bacteria 1276
77 Ga0157370_10006986 3300013104 Bacteria 12330
78 Ga0157369_10847753 3300013105 Unclassified 938
79 Ga0163162_10127484 3300013306 Bacteria 2652
80 Ga0163162_10641133 3300013306 Bacteria 1186
81 Ga0157372_10064127 3300013307 Bacteria 4121
82 Ga0157375_10284007 3300013308 Bacteria 1818
83 Ga0163163_10413071 3300014325 Bacteria 1408
84 Ga0157380_10352643 3300014326 Bacteria 1377
85 Ga0157380_10618021 3300014326 Bacteria 1075
86 Ga0206354_11109127 3300020081 Bacteria 2363
87 Ga0206353_10842753 3300020082 Bacteria 1696
88 Ga0206353_11427132 3300020082 Bacteria 2689
89 Ga0213875_10148285 3300021388 Bacteria 1099
90 Ga0209677_101023 3300025253 Bacteria 13325
91 Ga0209758_1014062 3300025297 Bacteria 4297
92 Ga0207688_10055171 3300025901 Bacteria 2230
93 Ga0207643_10304387 3300025908 Bacteria 993
94 Ga0207705_10030655 3300025909 Bacteria 3838
95 Ga0207652_10566921 3300025921 Bacteria 1020
96 Ga0207694_10131852 3300025924 Bacteria 2004
97 Ga0207687_10180872 3300025927 Bacteria 1633
98 Ga0207706_10002464 3300025933 Bacteria 18047
99 Ga0207691_10214205 3300025940 Bacteria 1672
100 Ga0207689_10298977 3300025942 Bacteria 1334
101 Ga0207661_10205632 3300025944 Bacteria 1733
102 Ga0207661_10218854 3300025944 Bacteria 1682
103 Ga0207668_10001790 3300025972 Bacteria 12548
104 Ga0207668_10215896 3300025972 Bacteria 1537
105 Ga0207677_10074586 3300026023 Bacteria 2408
106 Ga0207677_10541134 3300026023 Bacteria 1013
107 Ga0207708_10501610 3300026075 Bacteria 1017
108 Ga0207702_10666818 3300026078 Unclassified 1024
109 Ga0207648_10516525 3300026089 Bacteria 1094
110 Ga0207674_10218389 3300026116 Bacteria 1854
111 Ga0207674_10480602 3300026116 Bacteria 1201
112 Ga0207675_100005699 3300026118 Bacteria 11920
113 Ga0207698_10253494 3300026142 Bacteria 1612
114 Ga0207428_10023026 3300027907 Bacteria 5245
115 Ga0268266_10101183 3300028379 Bacteria 2540
116 Ga0268265_10221091 3300028380 Bacteria 1657
117 Ga0265338_10075887 3300028800 Bacteria 2850
118 Ga0265339_10001482 3300031249 Bacteria 17327
119 Ga0265331_10127856 3300031250 Bacteria 1160
120 Ga0307513_10073844 3300031456 Bacteria 3549
121 Ga0307509_10056564 3300031507 Bacteria 4163
122 Ga0307408_100026560 3300031548 Bacteria 3979
123 Ga0307408_100036316 3300031548 Bacteria 3463
124 Ga0307408_100063577 3300031548 Bacteria 2700
125 Ga0307408_100178940 3300031548 Bacteria 1699
126 Ga0265313_10003598 3300031595 Bacteria 12454
127 Ga0307508_10007477 3300031616 Bacteria 10169
128 Ga0265342_10022708 3300031712 Bacteria 3985
129 Ga0307516_10015531 3300031730 Bacteria 8007
130 Ga0307405_10002311 3300031731 Bacteria 8367
131 Ga0307405_10022007 3300031731 Bacteria 3596
132 Ga0307405_10043825 3300031731 Bacteria 2732
133 Ga0307405_10071793 3300031731 Bacteria 2229
134 Ga0307413_10004401 3300031824 Bacteria 6125
135 Ga0307413_10022706 3300031824 Bacteria 3387
136 Ga0307413_10031186 3300031824 Bacteria 3004
137 Ga0307413_10125450 3300031824 Bacteria 1747
138 Ga0307413_10162172 3300031824 Bacteria 1572
139 Ga0307413_10163989 3300031824 Bacteria 1564
140 Ga0307413_10209670 3300031824 Bacteria 1414
141 Ga0307410_10001710 3300031852 Bacteria 10127
142 Ga0307410_10006605 3300031852 Bacteria 6273
143 Ga0307410_10016846 3300031852 Bacteria 4369
144 Ga0307410_10056233 3300031852 Bacteria 2674
145 Ga0307410_10079167 3300031852 Bacteria 2302
146 Ga0307410_10159520 3300031852 Bacteria 1688
147 Ga0307410_10239785 3300031852 Bacteria 1404
148 Ga0307410_10275225 3300031852 Bacteria 1318
149 Ga0307410_10610807 3300031852 Bacteria 910
150 Ga0307406_10061948 3300031901 Bacteria 2418
151 Ga0307406_10079636 3300031901 Unclassified 2173
152 Ga0307406_10086248 3300031901 Bacteria 2101
153 Ga0307406_10097100 3300031901 Bacteria 1997
154 Ga0307406_10279762 3300031901 Bacteria 1272
155 Ga0307406_10302356 3300031901 Bacteria 1230
156 Ga0307406_10342747 3300031901 Bacteria 1164
157 Ga0307406_10465843 3300031901 Bacteria 1017
158 Ga0307407_10001275 3300031903 Bacteria 8978
159 Ga0307407_10024306 3300031903 Bacteria 3175
160 Ga0307407_10030559 3300031903 Bacteria 2907
161 Ga0307407_10034956 3300031903 Bacteria 2756
162 Ga0307407_10042879 3300031903 Bacteria 2540
163 Ga0307407_10102936 3300031903 Bacteria 1776
164 Ga0307407_10154770 3300031903 Bacteria 1494
165 Ga0307407_10158538 3300031903 Bacteria 1478
166 Ga0307412_10000545 3300031911 Bacteria 22425
167 Ga0307412_10013753 3300031911 Bacteria 4754
168 Ga0307412_10055469 3300031911 Bacteria 2636
169 Ga0307412_10062111 3300031911 Bacteria 2514
170 Ga0307412_10162468 3300031911 Bacteria 1661
171 Ga0307412_10221950 3300031911 Bacteria 1449
172 Ga0307412_10278033 3300031911 Bacteria 1313
173 Ga0307409_100000973 3300031995 Bacteria 13369
174 Ga0307409_100003706 3300031995 Bacteria 8381
175 Ga0307409_100031204 3300031995 Bacteria 3842
176 Ga0307409_100053013 3300031995 Bacteria 3114
177 Ga0307409_100113407 3300031995 Bacteria 2278
178 Ga0307409_100150709 3300031995 Bacteria 2018
179 Ga0307409_100152487 3300031995 Bacteria 2008
180 Ga0307416_100001038 3300032002 Bacteria 14769
181 Ga0307416_100010417 3300032002 Bacteria 6138
182 Ga0307416_100020643 3300032002 Bacteria 4707
183 Ga0307416_100042232 3300032002 Bacteria 3558
184 Ga0307416_100070223 3300032002 Bacteria 2903
185 Ga0307416_100072272 3300032002 Bacteria 2870
186 Ga0307416_100248133 3300032002 Bacteria 1730
187 Ga0307416_100254721 3300032002 Bacteria 1711
188 Ga0307416_100412762 3300032002 Bacteria 1391
189 Ga0307414_10109853 3300032004 Bacteria 2096
190 Ga0307414_10138720 3300032004 Bacteria 1900
191 Ga0307414_10141784 3300032004 Bacteria 1883
192 Ga0307414_10283581 3300032004 Bacteria 1393
193 Ga0307414_10668872 3300032004 Bacteria 937
194 Ga0307411_10023896 3300032005 Bacteria 3632
195 Ga0307411_10027294 3300032005 Bacteria 3452
196 Ga0307411_10041615 3300032005 Bacteria 2925
197 Ga0307411_10045339 3300032005 Bacteria 2828
198 Ga0307411_10116174 3300032005 Bacteria 1926
199 Ga0307411_10154399 3300032005 Bacteria 1710
200 Ga0307411_10274553 3300032005 Bacteria 1338
201 Ga0307411_10394133 3300032005 Bacteria 1143
202 Ga0307415_100000299 3300032126 Bacteria 21425
203 Ga0307415_100002494 3300032126 Bacteria 9190
204 Ga0307415_100012287 3300032126 Bacteria 4945
205 Ga0307415_100043683 3300032126 Bacteria 2991
206 Ga0307415_100086131 3300032126 Bacteria 2260
207 Ga0307415_100103554 3300032126 Bacteria 2094
208 Ga0307415_100194148 3300032126 Bacteria 1604
209 Ga0307415_100249434 3300032126 Bacteria 1441
210 Ga0307415_100330263 3300032126 Bacteria 1275
211 Ga0307415_100415751 3300032126 Bacteria 1152
212 Ga0373951_0000143 3300035091 Bacteria 26580
213 Ga0395899_0001282 3300037312 Bacteria 21781
214 Ga0395899_0039248 3300037312 Bacteria 3545
215 Ga0395900_0001716 3300037418 Bacteria 25322
216 Ga0395900_0030116 3300037418 Bacteria 5571
217 Ga0395900_0060178 3300037418 Bacteria 3909
218 Ga0395900_0155079 3300037418 Bacteria 2339
219 Ga0395900_0190842 3300037418 Bacteria 2078
220 Ga0395900_0331343 3300037418 Bacteria 1500
221 Ga0395898_0000566 3300037466 Bacteria 68839
222 Ga0395898_0000727 3300037466 Bacteria 57899
223 Ga0395898_0067534 3300037466 Bacteria 3461
224 Ga0395898_0078734 3300037466 Bacteria 3180
225 Ga0395898_0315692 3300037466 Bacteria 1491
226 Ga0395905_0007403 3300037471 Bacteria 10917
227 Ga0395905_0063532 3300037471 Bacteria 3454
228 Ga0395905_0524411 3300037471 Bacteria 1085
229 Ga0436364_0738322 3300037853 Bacteria 2277
230 Ga0395901_0001169 3300038443 Bacteria 27889
231 Ga0395901_0006849 3300038443 Bacteria 11511
232 Ga0395901_0026257 3300038443 Bacteria 5979
233 Ga0395901_0049804 3300038443 Bacteria 4353
234 Ga0439436_0005593 3300041404 Bacteria 3854
235 Ga0439466_0056515 3300041411 Bacteria 1273
236 Ga0451791_0139733 3300041451 Bacteria 6816
237 Ga0451791_0418148 3300041451 Bacteria 1753
238 Ga0451802_0513202 3300041460 Unclassified 978
239 Ga0451833_0399185 3300041491 Bacteria 1696
240 Ga0451843_0536832 3300041509 Bacteria 1734
241 Ga0439433_0008605 3300041999 Bacteria 2215
242 Ga0439442_008568 3300042002 Bacteria 2063
243 Ga0439448_0007509 3300042005 Bacteria 3164
244 Ga0439448_0012172 3300042005 Bacteria 2571
245 Ga0439448_0012406 3300042005 Bacteria 2550
246 Ga0439448_0063284 3300042005 Bacteria 1225
247 Ga0439450_000125 3300042008 Bacteria 8132
248 Ga0439451_022397 3300042009 Bacteria 1274
249 Ga0439454_001466 3300042011 Bacteria 2277
250 Ga0439455_0000541 3300042012 Bacteria 5321
251 Ga0439462_0002196 3300042015 Bacteria 4501
252 Ga0439463_001276 3300042016 Bacteria 6727
253 Ga0439463_020578 3300042016 Bacteria 1646
254 Ga0450920_001372 3300042122 Bacteria 4019
255 Ga0450920_008847 3300042122 Bacteria 1846
256 Ga0450903_006489 3300042138 Bacteria 1940
257 Ga0450905_001876 3300042142 Bacteria 2693
258 Ga0450907_001177 3300042146 Bacteria 5920
259 Ga0439434_0000808 3300042435 Bacteria 9023
260 Ga0439444_0001554 3300042437 Bacteria 3015
261 Ga0439444_0014959 3300042437 Bacteria 1304
262 Ga0439464_0000020 3300042439 Bacteria 21231
263 Ga0439464_0016502 3300042439 Bacteria 1997
264 Ga0439464_0021729 3300042439 Bacteria 1762
265 Ga0439464_0024704 3300042439 Bacteria 1662
266 Ga0439464_0077026 3300042439 Bacteria 992
267 Ga0439460_0004147 3300042461 Bacteria 3525
268 Ga0439460_0021253 3300042461 Bacteria 1772
269 Ga0439460_0037794 3300042461 Bacteria 1405
270 Ga0450916_000009 3300042530 Bacteria 9913
271 Ga0450918_006385 3300042531 Bacteria 2104
272 Ga0439440_0002154 3300042993 Bacteria 3686
273 Ga0439440_0029760 3300042993 Bacteria 1283
274 Ga0466969_0054686 3300044656 Bacteria 1955
275 Ga0466972_0026415 3300044658 Bacteria 2878
276 Ga0466957_0027299 3300044842 Bacteria 3392
277 Ga0466960_0025491 3300044901 Bacteria 2676
278 Ga0466959_0079732 3300045049 Bacteria 2360
279 Ga0466958_0063789 3300045836 Bacteria 2247
280 Ga0466967_0051455 3300045976 Bacteria 3610
281 Ga0495592_0022373 3300046454 Bacteria 4811
282 Ga0495629_0005781 3300046459 Bacteria 9224
283 Ga0495651_0032263 3300046462 Bacteria 4086
284 Ga0495664_0162317 3300046477 Bacteria 1356
285 Ga0495584_0030777 3300046491 Bacteria 2718
286 Ga0495594_0000321 3300046499 Bacteria 23687
287 Ga0495663_0063170 3300046525 Unclassified 1167
288 Ga0495640_0029701 3300046533 Bacteria 3921
289 Ga0495656_0003800 3300046615 Bacteria 5131
290 Ga0495634_0047290 3300046642 Bacteria 2900
291 Ga0495657_0019366 3300046675 Bacteria 4910
292 Ga0495600_0035143 3300046809 Bacteria 3254
293 Ga0495676_0002728 3300047321 Bacteria 15842
294 Ga0495675_0280223 3300047444 Bacteria 994
295 Ga0496102_0082386 3300048905 Bacteria 2967
296 Ga0496104_0199239 3300048907 Bacteria 1914
297 Ga0496104_0201380 3300048907 Bacteria 1903
298 Ga0496110_0063359 3300048913 Bacteria 3267
299 Ga0496110_0141751 3300048913 Bacteria 2173
300 Ga0496112_0000593 3300048915 Bacteria 24887
301 Ga0496113_0084533 3300048916 Bacteria 2437
302 Ga0496115_0178736 3300048918 Bacteria 1755
303 Ga0496122_0003294 3300048925 Bacteria 21376
304 Ga0496123_0066609 3300048926 Bacteria 2280
305 Ga0501031_0005272 3300049568 Bacteria 8424
306 Ga0501031_0010795 3300049568 Bacteria 5950
307 Ga0501031_0085152 3300049568 Bacteria 2061
308 Ga0501031_0127510 3300049568 Bacteria 1662
309 Ga0501032_0017343 3300049569 Bacteria 5055
310 Ga0501032_0020916 3300049569 Bacteria 4553
311 Ga0501032_0023589 3300049569 Bacteria 4247
312 Ga0501032_0101792 3300049569 Bacteria 1903
313 Ga0501033_0009815 3300049570 Bacteria 7347
314 Ga0501033_0017024 3300049570 Bacteria 5494
315 Ga0501034_0012956 3300049571 Bacteria 8596
316 Ga0501034_0036256 3300049571 Bacteria 4996
317 Ga0501034_0067094 3300049571 Bacteria 3601
318 Ga0501036_0003525 3300049572 Bacteria 12522
319 Ga0501036_0027000 3300049572 Bacteria 4852
320 Ga0501036_0043019 3300049572 Bacteria 3824
321 Ga0501037_0003063 3300049573 Bacteria 12116
322 Ga0501037_0006491 3300049573 Bacteria 8555
323 Ga0501037_0023262 3300049573 Bacteria 4582
324 Ga0501037_0134004 3300049573 Bacteria 1775
325 Ga0501037_0171681 3300049573 Bacteria 1541
326 Ga0501038_0002017 3300049574 Bacteria 18744
327 Ga0501038_0006466 3300049574 Bacteria 10848
328 Ga0501038_0019085 3300049574 Bacteria 6183
329 Ga0501038_0033829 3300049574 Bacteria 4498
330 Ga0501038_0034270 3300049574 Bacteria 4465
331 Ga0501039_0000191 3300049575 Bacteria 44133
332 Ga0501039_0003021 3300049575 Bacteria 12584
333 Ga0501040_0000109 3300049576 Bacteria 42436
334 Ga0501040_0003137 3300049576 Bacteria 10725
335 Ga0501041_0000106 3300049577 Bacteria 35317
336 Ga0501041_0000687 3300049577 Bacteria 17962
337 Ga0501042_0000163 3300049578 Bacteria 30426
338 Ga0501042_0002891 3300049578 Bacteria 10660
339 Ga0501042_0019110 3300049578 Bacteria 4755
340 Ga0501043_0007831 3300049579 Bacteria 8445
341 Ga0501043_0018539 3300049579 Bacteria 5460
342 Ga0501043_0077083 3300049579 Bacteria 2619
343 Ga0501046_0003478 3300049580 Bacteria 14443
344 Ga0501046_0025136 3300049580 Bacteria 4877
345 Ga0501046_0037405 3300049580 Bacteria 3900
346 Ga0501046_0187326 3300049580 Bacteria 1545
347 Ga0501047_0000121 3300049581 Bacteria 95409
348 Ga0501047_0057415 3300049581 Bacteria 3764
349 Ga0501047_0105012 3300049581 Bacteria 2705
350 Ga0501047_0119205 3300049581 Bacteria 2521
351 Ga0501048_0000056 3300049582 Bacteria 56403
352 Ga0501048_0000203 3300049582 Bacteria 38873
353 Ga0501048_0083553 3300049582 Bacteria 2252
354 Ga0501068_0030105 3300049584 Bacteria 3218
355 Ga0501070_0148444 3300049586 Bacteria 1935
356 Ga0501070_0304000 3300049586 Bacteria 1299
357 Ga0501071_0001904 3300049587 Bacteria 12427
358 Ga0501071_0038888 3300049587 Bacteria 3401
359 Ga0501071_0555412 3300049587 Bacteria 882
360 Ga0501072_0000108 3300049588 Bacteria 61185
361 Ga0501074_0000412 3300049590 Bacteria 25547
362 Ga0501075_0000267 3300049591 Bacteria 28530
363 Ga0501075_0002471 3300049591 Bacteria 12323
364 Ga0501076_0000123 3300049592 Bacteria 42576
365 Ga0501076_0000233 3300049592 Bacteria 33934
366 Ga0501077_0000449 3300049593 Bacteria 24953
367 Ga0501077_0092749 3300049593 Bacteria 1913
368 Ga0501079_0003029 3300049741 Bacteria 12296
369 Ga0501079_0008434 3300049741 Bacteria 7812
370 Ga0501080_0013778 3300049742 Bacteria 7444
371 Ga0501081_0000261 3300049743 Bacteria 27500
372 Ga0501035_0027544 3300049822 Bacteria 5193
373 Ga0501035_0040718 3300049822 Bacteria 4197
374 Ga0501035_0107198 3300049822 Bacteria 2449
375 Ga0501035_0277506 3300049822 Bacteria 1417
376 Ga0501044_0012748 3300049823 Bacteria 9103
377 Ga0501044_0018557 3300049823 Bacteria 7454
378 Ga0501044_0059376 3300049823 Bacteria 3918
379 Ga0501044_0118480 3300049823 Bacteria 2650
380 Ga0501044_0346081 3300049823 Bacteria 1407
381 Ga0501045_0000443 3300049824 Bacteria 25493
382 Ga0501045_0001997 3300049824 Bacteria 13775
383 nmdc:mga05p37_1605_c1 3300050507 Bacteria 26178
384 nmdc:mga05p37_254392_c1 3300050507 Bacteria 2105
385 nmdc:mga05p37_29572_c1 3300050507 Bacteria 6685
386 nmdc:mga09592_77_c2 3300050508 Bacteria 27734
387 nmdc:mga0qj67_178_c2 3300050509 Bacteria 14400
388 nmdc:mga0qj67_181628_c1 3300050509 Bacteria 1709
389 nmdc:mga06r32_174418_c1 3300050510 Bacteria 2134
390 nmdc:mga06r32_428675_c1 3300050510 Bacteria 1303
391 nmdc:mga06r32_720_c2 3300050510 Bacteria 10317
392 nmdc:mga0n895_14656_c1 3300050512 Bacteria 7129
393 nmdc:mga0rr50_95114_c1 3300050513 Bacteria 2328
394 nmdc:mga0a205_6477_c1 3300050515 Bacteria 10587
395 Ga0500635_0000147 3300053080 Bacteria 39795
396 Ga0501084_0000204 3300054114 Bacteria 45861
397 Ga0501084_0000433 3300054114 Bacteria 32195
398 Ga0590074_002944 3300059423 Bacteria 2804
399 Ga0590075_002495 3300059424 Bacteria 4400
400 Ga0590077_002153 3300059426 Bacteria 4305
401 Ga0501082_0000254 3300060353 Bacteria 46864
402 Ga0501082_0000578 3300060353 Bacteria 32586
403 Ga0530510_0001066 3300061734 Bacteria 18203
404 Ga0530510_0006176 3300061734 Bacteria 8325
405 2501943855 2501939600 Bacteria 6907073
406 2623590235 2622736626 Bacteria 7181580
407 2676484460 2675903059 Bacteria 8644972
408 2775658098 2775506735 Bacteria 4556596
409 2784585807 2784132148 Bacteria 8627943
410 2791916498 2791354901 Bacteria 8322202
411 2809229301 2808606448 Bacteria 8656184
412 2812321287 2811994871 Bacteria 4497550
413 2856862471 2856858025 Bacteria 7255264
414 2857473615 2857472729 Bacteria 6568124
415 2857733867 2857733635 Bacteria 3532004
416 2866617643 2866612099 Bacteria 7543886
417 2912758190 2912757875 Bacteria 7940295
418 2939660810 2939657138 Bacteria 3740283
419 2964328495 2964326757 Bacteria 3290868
420 2990092481 2990088156 Bacteria 6657676
421 2996225270 2996221748 Bacteria 6799777
422 3006497669 3006493962 Bacteria 8825450
423 649815742 649633069 Bacteria 6962533
424 8023630647 8023623736 Bacteria 8593882
425 8033685033 8033684223 Bacteria 6906479
426 8055417226 8055412473 Bacteria 6257500
427 8057348409 8057345674 Bacteria 4160394
428 Ga0307517_10146243
429 JGI25406J46586_10011883
430 JGI25406J46586_10012290
431 JGI25406J46586_10022448
432 JGI25406J46586_10057840
433 rootH2_10004490
434 JGI25407J50210_10002442
435 JGI25407J50210_10003027
436 Ga0070658_10039538
437 Ga0070658_10040696
438 Ga0070658_10168116
439 Ga0070683_100180303
440 Ga0070683_100310726
441 Ga0070682_100317905
442 Ga0070668_100001876
443 Ga0070668_100102757
444 Ga0070674_100397556
445 Ga0070659_100116738
446 Ga0070662_100004121
447 Ga0070685_10001363
448 Ga0070679_100685532
449 Ga0070684_100048224
450 Ga0070684_100392972
451 Ga0070665_100129639
452 Ga0068855_100428951
453 Ga0068854_100362287
454 Ga0068852_100616277
455 Ga0068852_100617069
456 Ga0068864_100236799
457 Ga0068861_100156845
458 Ga0068862_100327814
459 Ga0068862_100481204
460 Ga0081455_10095629
461 Ga0081538_10000209
462 Ga0081538_10000790
463 Ga0081538_10003929
464 Ga0081538_10006930
465 Ga0081538_10012081
466 Ga0081538_10017855
467 Ga0081538_10018835
468 Ga0081538_10025127
469 Ga0081538_10042518
470 Ga0081539_10000822
471 Ga0081539_10001890
472 Ga0081539_10002337
473 Ga0081539_10004083
474 Ga0081539_10004279
475 Ga0081539_10004973
476 Ga0081539_10022317
477 Ga0075428_100014274
478 Ga0075430_100007624
479 Ga0075430_100096702
480 Ga0075431_100068872
481 Ga0075431_100125770
482 Ga0075431_100159649
483 Ga0075431_100298435
484 Ga0075433_10000840
485 Ga0075434_100003609
486 Ga0075429_100008059
487 Ga0075435_100000883
488 Ga0111539_10023932
489 Ga0111539_10341336
490 Ga0111539_10381022
491 Ga0111539_10987048
492 Ga0111539_11086048
493 Ga0114129_10001721
494 Ga0114129_10088362
495 Ga0114129_10123000
496 Ga0114129_10167561
497 Ga0105243_10301332
498 Ga0105238_10151304
499 Ga0105249_10004946
500 Ga0105249_10103303
501 Ga0105249_10714435
502 Ga0105239_10230044
503 Ga0105246_10311068
504 Ga0157370_10006986
505 Ga0157369_10847753
506 Ga0163162_10127484
507 Ga0163162_10641133
508 Ga0157372_10064127
509 Ga0157375_10284007
510 Ga0163163_10413071
511 Ga0157380_10352643
512 Ga0157380_10618021
513 Ga0206354_11109127
514 Ga0206353_10842753
515 Ga0206353_11427132
516 Ga0213875_10148285
517 Ga0209677_101023
518 Ga0209758_1014062
519 Ga0207688_10055171
520 Ga0207643_10304387
521 Ga0207705_10030655
522 Ga0207652_10566921
523 Ga0207694_10131852
524 Ga0207687_10180872
525 Ga0207706_10002464
526 Ga0207691_10214205
527 Ga0207689_10298977
528 Ga0207661_10205632
529 Ga0207661_10218854
530 Ga0207668_10001790
531 Ga0207668_10215896
532 Ga0207677_10074586
533 Ga0207677_10541134
534 Ga0207708_10501610
535 Ga0207702_10666818
536 Ga0207648_10516525
537 Ga0207674_10218389
538 Ga0207674_10480602
539 Ga0207675_100005699
540 Ga0207698_10253494
541 Ga0207428_10023026
542 Ga0268266_10101183
543 Ga0268265_10221091
544 Ga0265338_10075887
545 Ga0265339_10001482
546 Ga0265331_10127856
547 Ga0307513_10073844
548 Ga0307509_10056564
549 Ga0307408_100026560
550 Ga0307408_100036316
551 Ga0307408_100063577
552 Ga0307408_100178940
553 Ga0265313_10003598
554 Ga0307508_10007477
555 Ga0265342_10022708
556 Ga0307516_10015531
557 Ga0307405_10002311
558 Ga0307405_10022007
559 Ga0307405_10043825
560 Ga0307405_10071793
561 Ga0307413_10004401
562 Ga0307413_10022706
563 Ga0307413_10031186
564 Ga0307413_10125450
565 Ga0307413_10162172
566 Ga0307413_10163989
567 Ga0307413_10209670
568 Ga0307410_10001710
569 Ga0307410_10006605
570 Ga0307410_10016846
571 Ga0307410_10056233
572 Ga0307410_10079167
573 Ga0307410_10159520
574 Ga0307410_10239785
575 Ga0307410_10275225
576 Ga0307410_10610807
577 Ga0307406_10061948
578 Ga0307406_10079636
579 Ga0307406_10086248
580 Ga0307406_10097100
581 Ga0307406_10279762
582 Ga0307406_10302356
583 Ga0307406_10342747
584 Ga0307406_10465843
585 Ga0307407_10001275
586 Ga0307407_10024306
587 Ga0307407_10030559
588 Ga0307407_10034956
589 Ga0307407_10042879
590 Ga0307407_10102936
591 Ga0307407_10154770
592 Ga0307407_10158538
593 Ga0307412_10000545
594 Ga0307412_10013753
595 Ga0307412_10055469
596 Ga0307412_10062111
597 Ga0307412_10162468
598 Ga0307412_10221950
599 Ga0307412_10278033
600 Ga0307409_100000973
601 Ga0307409_100003706
602 Ga0307409_100031204
603 Ga0307409_100053013
604 Ga0307409_100113407
605 Ga0307409_100150709
606 Ga0307409_100152487
607 Ga0307416_100001038
608 Ga0307416_100010417
609 Ga0307416_100020643
610 Ga0307416_100042232
611 Ga0307416_100070223
612 Ga0307416_100072272
613 Ga0307416_100248133
614 Ga0307416_100254721
615 Ga0307416_100412762
616 Ga0307414_10109853
617 Ga0307414_10138720
618 Ga0307414_10141784
619 Ga0307414_10283581
620 Ga0307414_10668872
621 Ga0307411_10023896
622 Ga0307411_10027294
623 Ga0307411_10041615
624 Ga0307411_10045339
625 Ga0307411_10116174
626 Ga0307411_10154399
627 Ga0307411_10274553
628 Ga0307411_10394133
629 Ga0307415_100000299
630 Ga0307415_100002494
631 Ga0307415_100012287
632 Ga0307415_100043683
633 Ga0307415_100086131
634 Ga0307415_100103554
635 Ga0307415_100194148
636 Ga0307415_100249434
637 Ga0307415_100330263
638 Ga0307415_100415751
639 Ga0373951_0000143
640 Ga0395899_0001282
641 Ga0395899_0039248
642 Ga0395900_0001716
643 Ga0395900_0030116
644 Ga0395900_0060178
645 Ga0395900_0155079
646 Ga0395900_0190842
647 Ga0395900_0331343
648 Ga0395898_0000566
649 Ga0395898_0000727
650 Ga0395898_0067534
651 Ga0395898_0078734
652 Ga0395898_0315692
653 Ga0395905_0007403
654 Ga0395905_0063532
655 Ga0395905_0524411
656 Ga0436364_0738322
657 Ga0395901_0001169
658 Ga0395901_0006849
659 Ga0395901_0026257
660 Ga0395901_0049804
661 Ga0439436_0005593
662 Ga0439466_0056515
663 Ga0451791_0139733
664 Ga0451791_0418148
665 Ga0451802_0513202
666 Ga0451833_0399185
667 Ga0451843_0536832
668 Ga0439433_0008605
669 Ga0439442_008568
670 Ga0439448_0007509
671 Ga0439448_0012172
672 Ga0439448_0012406
673 Ga0439448_0063284
674 Ga0439450_000125
675 Ga0439451_022397
676 Ga0439454_001466
677 Ga0439455_0000541
678 Ga0439462_0002196
679 Ga0439463_001276
680 Ga0439463_020578
681 Ga0450920_001372
682 Ga0450920_008847
683 Ga0450903_006489
684 Ga0450905_001876
685 Ga0450907_001177
686 Ga0439434_0000808
687 Ga0439444_0001554
688 Ga0439444_0014959
689 Ga0439464_0000020
690 Ga0439464_0016502
691 Ga0439464_0021729
692 Ga0439464_0024704
693 Ga0439464_0077026
694 Ga0439460_0004147
695 Ga0439460_0021253
696 Ga0439460_0037794
697 Ga0450916_000009
698 Ga0450918_006385
699 Ga0439440_0002154
700 Ga0439440_0029760
701 Ga0466969_0054686
702 Ga0466972_0026415
703 Ga0466957_0027299
704 Ga0466960_0025491
705 Ga0466959_0079732
706 Ga0466958_0063789
707 Ga0466967_0051455
708 Ga0495592_0022373
709 Ga0495629_0005781
710 Ga0495651_0032263
711 Ga0495664_0162317
712 Ga0495584_0030777
713 Ga0495594_0000321
714 Ga0495663_0063170
715 Ga0495640_0029701
716 Ga0495656_0003800
717 Ga0495634_0047290
718 Ga0495657_0019366
719 Ga0495600_0035143
720 Ga0495676_0002728
721 Ga0495675_0280223
722 Ga0496102_0082386
723 Ga0496104_0199239
724 Ga0496104_0201380
725 Ga0496110_0063359
726 Ga0496110_0141751
727 Ga0496112_0000593
728 Ga0496113_0084533
729 Ga0496115_0178736
730 Ga0496122_0003294
731 Ga0496123_0066609
732 Ga0501031_0005272
733 Ga0501031_0010795
734 Ga0501031_0085152
735 Ga0501031_0127510
736 Ga0501032_0017343
737 Ga0501032_0020916
738 Ga0501032_0023589
739 Ga0501032_0101792
740 Ga0501033_0009815
741 Ga0501033_0017024
742 Ga0501034_0012956
743 Ga0501034_0036256
744 Ga0501034_0067094
745 Ga0501036_0003525
746 Ga0501036_0027000
747 Ga0501036_0043019
748 Ga0501037_0003063
749 Ga0501037_0006491
750 Ga0501037_0023262
751 Ga0501037_0134004
752 Ga0501037_0171681
753 Ga0501038_0002017
754 Ga0501038_0006466
755 Ga0501038_0019085
756 Ga0501038_0033829
757 Ga0501038_0034270
758 Ga0501039_0000191
759 Ga0501039_0003021
760 Ga0501040_0000109
761 Ga0501040_0003137
762 Ga0501041_0000106
763 Ga0501041_0000687
764 Ga0501042_0000163
765 Ga0501042_0002891
766 Ga0501042_0019110
767 Ga0501043_0007831
768 Ga0501043_0018539
769 Ga0501043_0077083
770 Ga0501046_0003478
771 Ga0501046_0025136
772 Ga0501046_0037405
773 Ga0501046_0187326
774 Ga0501047_0000121
775 Ga0501047_0057415
776 Ga0501047_0105012
777 Ga0501047_0119205
778 Ga0501048_0000056
779 Ga0501048_0000203
780 Ga0501048_0083553
781 Ga0501068_0030105
782 Ga0501070_0148444
783 Ga0501070_0304000
784 Ga0501071_0001904
785 Ga0501071_0038888
786 Ga0501071_0555412
787 Ga0501072_0000108
788 Ga0501074_0000412
789 Ga0501075_0000267
790 Ga0501075_0002471
791 Ga0501076_0000123
792 Ga0501076_0000233
793 Ga0501077_0000449
794 Ga0501077_0092749
795 Ga0501079_0003029
796 Ga0501079_0008434
797 Ga0501080_0013778
798 Ga0501081_0000261
799 Ga0501035_0027544
800 Ga0501035_0040718
801 Ga0501035_0107198
802 Ga0501035_0277506
803 Ga0501044_0012748
804 Ga0501044_0018557
805 Ga0501044_0059376
806 Ga0501044_0118480
807 Ga0501044_0346081
808 Ga0501045_0000443
809 Ga0501045_0001997
810 nmdc:mga05p37_1605_c1
811 nmdc:mga05p37_254392_c1
812 nmdc:mga05p37_29572_c1
813 nmdc:mga09592_77_c2
814 nmdc:mga0qj67_178_c2
815 nmdc:mga0qj67_181628_c1
816 nmdc:mga06r32_174418_c1
817 nmdc:mga06r32_428675_c1
818 nmdc:mga06r32_720_c2
819 nmdc:mga0n895_14656_c1
820 nmdc:mga0rr50_95114_c1
821 nmdc:mga0a205_6477_c1
822 Ga0500635_0000147
823 Ga0501084_0000204
824 Ga0501084_0000433
825 Ga0590074_002944
826 Ga0590075_002495
827 Ga0590077_002153
828 Ga0501082_0000254
829 Ga0501082_0000578
830 Ga0530510_0001066
831 Ga0530510_0006176
832 2501943855
833 2623590235
834 2676484460
835 2775658098
836 2784585807
837 2791916498
838 2809229301
839 2812321287
840 2856862471
841 2857473615
842 2857733867
843 2866617643
844 2912758190
845 2939660810
846 2964328495
847 2990092481
848 2996225270
849 3006497669
850 649815742
851 8023630647
852 8033685033
853 8055417226
854 8057348409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

48

292

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.9081 1 266
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8984 1 266
3kws-assembly1.cif.gz_B crystal structure of putative sugar isomerase (yp_001305149.1) from parabacteroides distasonis atcc 8503 at 1.68 a resolution 0.8584 1 269
5zfs-assembly1.cif.gz_B crystal structure of arthrobacter globiformis m30 sugar epimerase which can produce d-allulose from d-fructose 0.8404 1 269
3kws-assembly1.cif.gz_B crystal structure of putative sugar isomerase (yp_001305149.1) from parabacteroides distasonis atcc 8503 at 1.68 a resolution 0.8401 1 269
ID Description Score Start End Superfamily
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9054 1 266 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8989 1 266 3.20.20.150
3kwsB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8506 1 269 3.20.20.150
5zfsB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8404 1 269 3.20.20.150
5zfsB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8346 1 269 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A7K3F482-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9851 1 90 GO:0016853
AF-A0A1V5ZAB6-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9719 182 267
AF-A0A7W9G5W0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9679 1 267 GO:0016853
AF-A0A2M9CFL0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9612 2 266 GO:0016853
AF-A0A7W9G5W0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9606 1 267 GO:0016853

Map